2LEBA

Solution structure of human srsf2 (sc35) rrm in complex with 5'-uccagu-3'
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
b'MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/arginine-rich splicing factor 2
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lebA00
1UW4A 2EK1A 4IOAQ 3UE2A 2DGXA 4IUFA 3S8SA 4C4WA 2J8AA 1SJ3P 2XS5A 4CH1A 2X1FA 1P1TA 3CC7S 2ERRA 1YJWS 2MY7A 3VAIA 3THPA 1VC0A 2LMIA 2MHNA 4A8XA 3I56S 2CPZA 2WBRA 2GHPA 2I38A 1VQ6S 3VAMA 4YUDA 3MXHP 1UFWA 5MLCV 2DIVA 1K73T 1UAWA 1JJHA 1SXLA 3DXBA 5CA5A 1VQ7S 3S01A 3Q2TC 3K0JA 1X5SA 4IOCQ 2MSTA 2ADBA 1OO0B 1WEYA 1NJIT 3N9UC 1YWXA 3CMES 4Z2XA 1WG4A 2KN4A 2D9PA 4ERDA 2MZTA 4ZKAA 3P5TL 5CYJA 4LMZA 2DGQA 3H2VE 3CC4S 1VQMS 1PGZA 2CJKA 2A3JA 3H2UB 1RK8A 2K3KA 5LSOA 2KT5A 1VQ8S 5LXYA 1H2VZ 2LQ5A 5DETA 2M70A 1FJEB 3EGZA 1ZZFA 2DNHA 3JB9k 2N7CA 2KXHA 2M2BA 1H2UX 3SMZA 1Q82T 3PIPQ 1U1LA 1VBYA 2MZSA 3CCMS 2XNQA 1WWHA 3MUVP 4PR6A 2O3DA 2RQ4A 2KFYA 2BOPA 2L08A 2DNNA 3P3DA 2K8GA 2FC8A 1HD0A 2DK2A 2VONA 2DNQA 3P6YC 1FJ7A 2DGTA 1XN9A 2L41A 2LECA 1Q7YT 2OJ3A 4TU8A 1U1NA 1M90T 4WFNQ 1H2TZ 3FEYB 3LPYA 4OZ0A 3BS9A 2RS8A 3CCES 1U1RA 2MZRA 2KH9A 3MUMP 3MDFA 3NNHA 4OZ1A 2LEAA 4WFAQ 2M7SA 1QVFR 2MKSA 1U1QA 3NS6A 2J0QD 3DLLQ 1URNA 3EX7B 2HGMA 2MZJA 2BZ2A 5BJRA 2DNPA 1RKJA 2CPFA 1VQLS 1YJ9S 1X4DA 5GAGU 4UY8T 2MQPA 3UCGA 4QU7A 4C7QA 4F26A 3D2WA 2JVOA 2KI2A 3SDEA 2DNLA 2DO0A 2OTLS 1M5KC 2LYVA 3UCUP 5DDOC 2RU3A 3S6EA 2E5HA 1QVGR 2KG1A 1WI6A 2RRAA 1KC8T 1WTBA 1DZ5A 3CCLS 2YTCA 5GAHU 1K9MT 1SJ4P 1N52B 2E5GA 1R8HA 2AYEA 2YH0A 2CQCA 2DNYA 5D78A 1VQNS 4TU9A 1B7FA 5IQQA 1NU4A 1YJNS 3NMRA 3U1LA 3CD6S 2KM8C 2LA4A 1U1KA 2LKZA 1WEZA 1NO8A 2KG0A 1YIJS 4C0OC 2MQMA 4P6QA 4FXVA 3BEGB 2DHGA 4F25A 1OPIA 3VAKA 2G1DA 4QPTA 1Q86T 2CPJA 2DGSA 1HL6A 3R27A 3LQVA 2M8HA 2MQNA 2AYMA 1DHMA 3CXCR 2NZ4A 2JVRA 4CIOA 4Y00A 2E5JA 2LA6A 2MPUA 2QEXS 2DHAA 2YWKA 3BO2A 1YTYA 1JMTA 2XS7A 5GVQA 1K8AT 3SDEB 2MJUA 1YI2S 2DISA 1F9FA 2KXFA 3CF5Q 4QU6A 4QQBA 1FT8A 3MD1A 4EGLA 3CMAS 3ZZYA 1SJRA 2DH9A 4YB1P 2PEHA 1N88A 2DGUA 2DGWA 3IRWP 2CQDA 2KM8B 1WHYA 5DDPC 2HZCA 2VODA 3V4MA 2N3OA 2CPIA 2CQ2A 3RW7A 1W2BR 5HO4A 4BS2A 1WHWA 1A9NB 3SXLA 2FY1A 2CQGA 2OTJS 4F02A 3EGNA 3G9CA 5HL7Q 1ZH5A 5DDQC 5JVHQ 3VAHA 4RU2A 3Q2SC 3CTRA 2VOPA 1P27B 1VQ4S 1U2FA 2ZJPQ 2MZ1A 3BO4A 3G71S 1M1KT 2D3OR 1FNXH 3ZZZA 4J5OA 1VBZA 1UP1A 5DDRC 2RRBA 3TO8A 3MUTP 3UD3P 1BY9A 1U6FA 4WFBQ 4UQTA 3VALA 2DGVA 4FXWA 1JJ2R 2KRBA 2NLWA 1X4EA 2HGLA 2F3JA 1H6KX 2CQ1A 5DM7Q 2MKHA 1DBDA 4CQ1A 4TU7A 2U2FA 3THTA 1R8PA 1WF0A 2X1BA 5IFMA 3G8TA 5JVGQ 2XB2D 1HA1A 2X1AA 3VF0B 2RNEA 1KOOA 2KRRA 3MD3A 2MZQA 3TP2A 4U67Q 1YHQS 3G6ES 1JJ4A 2M88A 2DNOA 2LXIA 3S7RA 5ITHA 2MY8A 2KXNB 3CCSS 5CXTA 2CPXA 2JWNA 2U1AA 1U1MA 4W92B 1S72S 2CQ4A 2Q79A 1G2EA 1X4GA 3UWTA 1YITS 4W90B 1M5VC 1WELA 1AUDA 1VQ5S 2D9OA 2CQPA 2M0GB 1VC6A 2DHSA 2HVZA 1U1PA 5IM0A 3CCJS 5LSLA 1FHTA 3VAGA 1S79A 3CC2S 3CCRS 3PIOQ 1WF1A 1ZZNA 4PRFA 4CH0S 1U6BA 3ULHA 2G0CA 1VQ9S 1QM9A 1X4CA 2DNGA 1KD1T 2CQIA 2N3LA 2ADCA 3HHNB 1WHVA 2VOOA 2F9JA 2CPHA 1WG1A 2DO4A 5LJ5Y 3CCUS 2QA4S 2L9WA 2MGZA 2J76E 2RS2A 1VQKS 2OIHA 2CQBA 2RQCA 2CPYA 3BO3A 2MKKA 3OW2R 2M4MA 4PKDB 2CQ3A 2RVJA 1FXLA 1M5OC 2FHOB 2QFJA 1VC5A 5D77A 3I55S 2CQHA 2MQOA 1PO6A 2DNRA 2FPHX 2ZJQQ 2V94A 2JX2A 3NNAA 2JRSA 1WHXA 5GMKa 3IWNC 2OSQA 4WKRA 1D9AA 5FJ4A 2KYXA 2LCWA 2MKJA 4WIIA 1X5OA 2EK6A 4LJMA 2RT3A 5IM0B 2LXUA 3J7YU 2YH1A 2G4BA 2HGNA 1N8RT 1M5PC 1IQTA 1SJQA 3CUNA 4Y0FA 2XSFA 2X1GA 2XNRA 2E5IA 2CQ0A 4ED5A 2EVZA 4LIRA 2AYGA 2FC9A 1X5PA 2GO9A 3FEXB 1D8ZA 2DNMA 2CPEA 2DH8A 2YKAA 3J7ZT 3VAJA 2DITA 3CCVS 5EN1A 2MGZB 2I2YA 1VBXA 4YOEA 1OWXA 3B4DA 5DM6Q 4WCEQ 3VAFA 2E44A 2M9KA 3MURP 3G8SA 2MXYA 3CPWR 2XS2A 1VQOS 1DRZA 1WF2A 3G96A 1N54B 1KOHA 2HYIB 1X0FA 3UD4P 3CULA 2KU7A 2DNKA 2ZJRQ 3MOJB 2M8DB 2MMYA 1L3KA 2SXLA 5GADU 1CVJA 4M5DB 2DNZA 2J0SD 1X4BA 5H1SV 4TLQA 2OSRA 3L3CA 2LEBA 1SJFA 2KHCA 2DB1A 1A7GE 3R1LA 1O0PA 2DH7A 3B4MA 2MKCA 5LXRA 1OIAA 5GAEU 3G4SS 3CCQS 4IO9Q 1U1OA 1X4AA 1Q81T 2DHXA 1VQPS 1X4HA 1WEXA 3RW6A 3NS5A 1X4FA 2DGOA 2MQLA 2MYFA 3MI7X 2KVIA 3HI9A 2MKIA 3U1MA 2MB0B 2UP1A 1HD1A 1WI8A 2PE8A 2AYBA 3UCZP 4WF9Q 3R1HA 2F9DA 3NNCA 5LJ3Y 2B0GA 2MJNA 2AD9A 2CPDA 3US5A 1KQSR 1FO1A 2N82B 3TYTA 1WG5A 2MQQA 1FJCA 2M52A 2DIUA 4V19X 2RUGA 2MSSA 3P49B 1X5TA
chains in the Genus database with same CATH superfamily
4OIXA 1J2VA 2WZ1A 2XS5A 3F41A 4RUCA 4H4OB 2E29A 3BDEA 1HBMA 3QJJA 2XYPB 2ACYA 2N4CA 3CJ2A 3AD8C 2C3UA 3JTOA 4I2PB 1UAWA 2R42A 1VQ7S 1B0PA 5F8HA 2JOQA 1OO0B 4A8OA 1PIEA 5D4PA 5KTQA 1JKHA 4GC6A 1KLNA 4O44A 3CC4S 5KG0A 1KP6A 8ATCB 1R89A 4UZCA 1RISA 1FJEB 3M2RA 3JB9k 2O67A 3QGGA 4DR5F 4MT1A 1IXKA 3P3DA 2IJNA 2FC8A 2DK2A 3U02A 3D3BJ 2ASJA 4XO0A 3BKUA 1UTAA 2CWKA 5E3QA 3HMJG 1URRA 1N34F 1PILA 2FYXA 4ZP9A 3T19A 1S9GB 3NS6A 2W9BA 3DDKA 2C3OA 3POTA 4OX7A 4F26A 3OL7A 3CVKA 3MCNA 3JTNA 4LR9A 5K8PA 2OTLS 4KKOA 2O1PA 2AW0A 3GIJA 3QWPA 1EKSA 4NLTA 3HD1A 3FEZA 3DXSX 4KBIA 1U0HA 3J7Z5 5HQMA 1B70B 1HWIA 2XQCA 4QPXA 2YH0A 3BGUA 1HQUA 2NSBA 3AB4B 3LUYA 2HFZA 1LK5A 2ZM6J 4FPRA 4EUVA 4P6QA 2HBYB 1YRTA 4TLRA 4X62F 3NCPA 5KFNA 1WKJA 2BANA 4FF1A 2AYMA 1Y3JA 3V81B 3TVKA 2XZTB 3DLJA 2CNOB 2GAGC 2HFSA 1V3ZA 4Y2KA 4ZPWR 2CQDA 2KKHA 1S7HA 1BMQB 3GFHA 4RW7B 5E5NA 4B3RJ 1EETA 2HFNA 2Z0GA 4JUZA 2MLZA 1HWUA 4ZHRB 3UDEA 2UUBF 3S1TA 3ZZPA 3VV2B 4PQUB 4B3MJ 1J27A 1O8BA 5DDRC 2EEYA 1AYEA 3IRXB 2KJWA 4DFMA 3M9OB 3TJ9A 3Q24A 4TU7A 1CJVB 1FTRA 1WF0A 3G8TA 5I3QA 3I9ZA 1DY3A 2RNEA 2HW3A 3EVOA 3D68A 2R4FA 4P9SA 3R8YA 3H2LA 2XYHB 4K4WA 3PEHA 4YQWA 1SQFA 3GZ7A 1S6QB 1YG0A 1VC6A 4LSLB 5ETRA 1CS4B 2CG4A 3VAGA 4IKAA 2GMLA 1UFKA 1WF1A 1S6UA 1U6BA 2RDDA 2KZZA 2Z56B 4F04B 3H7HB 4ECTA 2EPIA 4K4SA 3WX4A 4WXOA 1LWCB 4OJ1A 1HFEL 4DEZA 2OIHA 1FA0A 4O3OA 2CQBA 2RQCA 2Q6CA 2H48B 1R8AA 1CJTB 2RQKA 1VQSA 2QYGA 5I4MA 2ZUGA 3FK4A 1PO6A 2XLKA 2OEMA 2V4RA 1IBCB 4HKQA 4RNNA 5K9FA 1N36J 3M8SA 1P1LA 4ZCMA 5A0YA 4CO3A 4F7VA 2AU0A 4V1Ak 4DQPA 3MGJA 2OEJA 3MCMA 4P7VA 3X3UA 1AUSL 2KB2A 5KG2A 2EVZA 3FEXB 2ALZA 5AT1B 3VAJA 3T9NA 1LWFB 1N32F 3AODA 4A47A 3PZPA 3MURP 3G8SA 3MR2A 3BBCA 2WB4A 2RB7A 4NLXA 1KOHA 5C5JA 2VD3A 5KG6A 2B4UA 2G13A 4UF4A 1LV5A 1C1BA 4WFZA 3M30A 3Q8QB 1S99A 2OPRB 4J9OA 1RUSA 5LXRA 2ILZA 3EGWB 5A6WA 1XMQF 1VQPS 1WEXA 2QTWA 3UN2A 1HD1A 4URQU 2PT0A 2XMJA 1ZPVA 4PXCA 2X7IA 2M52A 3TEHB 1D9DA 4JI1J 1RYSA 3NGTA 3SSSA 3KMSA 1LWEB 3J7A1 3I56S 4L76A 4CLUA 2XY5A 2HVHA 3BR9A 2ZBRA 1JJHA 3DRRA 3LP0B 1IVZA 3OJSA 4J9PA 3Q8VA 1TL7B 4Z2XA 1EP4B 2YX7A 3DRSA 1H98A 3KHHA 3P5TL 2GNKA 3T1AA 3KLHB 2HQCA 1EZZB 2CJKA 2W9CB 2A3JA 2K3KA 2N4DA 1VQ8S 1HR0F 2CZVC 1RTHA 3EGZA 1RLCL 4JI0F 2QC3A 4A8FA 1DJ0A 1Q82T 1U1LA 3AH6A 4R25A 2OI2A 3VZHA 2HG4A 2GQ2A 2IAJA 2W2MP 4F0MA 4OI6A 2OJ3A 1H2TZ 3CIMA 5EDWA 1CEZA 1IM4A 1HBNA 2RDIA 2VQFJ 2C2OB 3CJ0A 2J0QD 4RW6A 2VF3A 1FJGJ 2BZ2A 4K2JA 1RT6A 4HVZA 3PTWA 4UY8T 3UCGA 5AE3A 2HQIA 3D2WA 1QSYA 2RJZA 4DS4A 1BE4A 3M6UA 5DS7A 1QVGR 4C98A 1QUVA 5E3AA 2AQ4A 4B02A 4USIA 1ICEB 7FD1A 4QR1A 2YTCA 2EG1A 4C11B 3V2UC 3LGHA 1YZ7A 3JQMA 2VG5A 4PG4A 1F9HA 4DV6F 4F25A 3PW5A 1U48A 2LQJA 4U8YA 4EO8A 2ZHOA 3OL8A 1GXUA 3M1VB 2JVRA 2XY6A 4DSEA 4X4QA 1S9EB 5D3GA 2MPUA 4I4BA 4J9NA 1NJWA 4JI2F 4YHHJ 5FDLA 2W4DA 2F5GA 3DC2A 3Q0AA 5KFKA 1UVMA 4NE9C 3ZZUA 2DGWA 4KHPF 1MG7A 1WC1A 5DDPC 4LUBA 2ZD1A 2N3OA 4NI2A 1T9XA 4CM0A 4NXMF 2LLZA 4NA3A 4BS2A 3MECB 3O2IA 3D0HE 4NRTA 4MTPA 5JVHQ 3KK2A 1M1GA 1ITPA 3OUYA 4DU7A 4IG0B 1SKWA 2FJWA 2X51A 2CQ1A 5KFYA 1Q78A 1J5EF 1D8YA 3PYEA 4CRJA 1J5OB 3UDLA 3OLAA 2E1AA 2W8LA 4IRDA 1S1XB 2GIRA 3QGHA 3C2PA 4W90B 4DI6A 3NCQA 4H54A 4ATNA 1UJ6A 3AB2B 3LP1B 4KV8B 4M5KA 4TY8B 3OTOF 2HNZB 4NWBA 3SV3A 2W7PA 1AROP 5KFPA 1QJHA 5CABA 4ECXA 1VQ9S 3GCWP 2N3LA 1I94F 4DJBA 5IT4A 5KFLA 3CDAA 4K0KJ 4USKA 2ZH6A 5LJ5Y 3RRKA 4BLGA 4TXSA 5A8WA 4LFCF 3NRBA 5KT6A 2APOA 1PC5A 1CBKA 3A1YG 1RLDA 3QLHB 3SQGB 2NCKL 4NZ0A 1TL1A 2LEPA 4AL6A 4GVBB 4AXJA 2HFUA 3DLBA 2JL9A 3I0RA 4DZDA 2R7RA 3R2DJ 2KYXA 5HATA 2ZWPA 4YB7A 3MM8A 2NXJA 3CJ8A 1SH0A 2VDIA 1TTHB 5DG7A 5J2MA 4O4RA 1RAGB 4U96A 2W1BA 2XNRA 2FC9A 4NEZA 4B3TJ 3IXQA 4HLBA 1KVKA 3T1HJ 2C2EA 2BABA 3JSYA 3OFFA 2FVQA 5A8RB 4KE5A 4JI7F 1BWVA 2XCPA 3D6MB 1Q0NA 2DKOB 2RILA 4DHVA 5CYMA 1WUUA 3WQPA 3B8HA 3QIPB 3LW5C 5D6GA 2MQLA 3NBPA 4JBCA 4WF9Q 4ID5B 1IWAA 5E41A 2WBMA 3E01B 2DEJA 3QYYA 2RUGA 4M95A 4DG1A 2CJYB 2IMOA 3GLJA 3BR8A 4IUFA 2Z8QA 1P1TA 3CC7S 2YX1A 1JNZB 3TQ1A 5F0WA 3BDPA 1XERA 3MTJA 4P7TA 4KQZA 3ITHB 3L7UA 3AXKA 3NY0A 3DGPB 2Y8YA 4LF6J 2BR0A 3PJXA 3C6UA 4ZKAA 2F40A 3W60A 3H98A 2GAHC 2BUNA 2G2OA 2DNHA 1RT7A 3CCMS 3BSOA 2WW8A 4YP3A 4PR6A 3PR5B 2L08A 2DBBA 3LALA 2BJ7A 1YJVA 1YJRA 2VIHA 3ZXWA 1C0UB 1IKYB 3RR8A 1GXTA 3W2VB 3MAHA 2KYZA 1S1WB 3CJ5A 2B9WA 4ZJOA 3CJTA 3ET6B 1S1UB 4UT4A 3Q8SB 2DCLA 1WTBA 4GKJF 1DZ5A 2AWZA 1VRUB 3SI8A 1HWJA 1FCAA 1U47A 2QL9B 2OKQA 1KKHA 3U1LA 3QZ8A 1U26A 1NO8A 5LMUF 2MQMA 3MCSA 4FXVA 4ECUA 3T1YF 3B78A 2DGSA 2ZBIA 2P6SA 1IBKJ 2R7TA 2B7CB 1DHMA 5B0CA 2OGUA 2E5JA 3HFZB 1RA6A 2DHAA 5CAAA 2XS7A 2R7VA 2ZE2B 3KKFA 2QG9B 2K3IA 4RO0A 5GVQA 3V6KA 4BDPA 2XYGB 4ECSA 4FKXA 2UUAF 1YJTA 2EFPA 3IRWP 4HR2A 3AJ2A 1Q16B 3EZ5A 1LWXA 2RU9A 1KWMA 3J80U 2DY9A 4ZLPA 1KNZA 3TZYA 1GMUA 2CQGA 4XAKA 2OLWA 2CJAA 4DSKA 1APSA 4K5RA 3T41A 3ZNUA 1T0TV 5C2GA 3MUTP 3H20A 3P45B 5DZ7A 3U1NA 4DV0F 3KK1B 3H5SA 2IBKA 3Q86A 3MFIA 2AGOA 1LQ9A 3GG0A 2AGPA 3NEKA 4W92B 1RZMA 2HWIA 1S6PB 3IGVA 1R6VA 1S49A 4B9SA 2HVZA 3T5HA 1FHTA 3EMTA 3O44A 2UVRA 1S79A 2IJRA 1ZZNA 2G0CA 1NKEA 3MEEB 5KFXA 4RWWA 4UQGA 2WSEC 4X84A 4UY85 3KMQA 1T3OA 3IRXA 3DRPA 3WX8A 1SUQA 3QT5A 1IWGA 1RT3B 4J7CA 2UUCF 5CQGA 2ILYA 3JQKA 2UZAA 4N76A 2GMHA 3K5OA 1CJVA 1CULB 4DL2A 3DLGB 4K8RA 2PDAA 1PSDA 2UU9F 3NNAA 2JRSA 3C8YA 3DOLB 2JLEA 2ROEA 4WIIA 1X5OA 5T41A 2HPUA 2EG2A 1UKUA 4CLYA 3GFZA 2GA7A 1I5OB 2JC1A 2ZZMA 4WYLA 4Y0FA 1D8ZA 4ES2A 3TZWA 4QJVA 4QW9A 4R8UA 2E44A 2AV5A 1Q1KA 4OX8A 2V63A 2UXDF 4A8QA 1LWCA 2G2YA 5CZVA 4K4TA 4C8LA 2KT3A 2WSCC 2DJWA 2SXLA 3VTIA 5GADU 3OHBA 1SJ1A 4WP3A 4G1PA 3L3CA 1EJ7L 3U7JA 1VRTB 2ZBPA 1RAAB 1RWKB 4UOHA 4Q8EA 1PYSB 5EGYA 3HJVA 4USWA 4J9QA 4DQQA 2BW7A 2DR5A 1X4FA 5D4OA 1ZM4A 1VJQA 2RKIB 2UP1A 1WI8A 4WYWA 3UDCA 3PW0A 4C8NA 1VK8A 2NXUA 1VJWA 1Y10A 1TFWA 4KB7A 1RBOB 3H8YA 4LSNA 1LWFA 4PYDA 4CH1A 3GILA 3UPFA 3ENVA 4PABA 4LQ9A 3PEJA 4TYAA 4MK9A 1Z2ZA 3RB0A 2I38A 4JV2A 1NK9A 1IKXB 1M5HA 4IOCQ 3M32B 3BBFA 2GHVC 1I51B 2GZOA 1HWKA 3H2UB 3IS9B 1UJ5A 5DETA 4B9VA 2F4FA 3PXGa 1C4AA 3ILLA 3ILJA 2AMCB 1NH8A 4NYOA 2XULA 2R7SA 3A8KA 3V6JA 4DV3F 2EBEA 3UVJB 1FFWB 3TJAA 1LWEA 3NNHA 2KVQE 3ENQA 3FBBA 3V6DB 2I5JB 3N4WA 3T6JA 3CIZA 1LW0A 3LP0A 5K5MA 4C7QA 2CVIA 2H51B 3RZAA 1HNXJ 1TL7A 1EP4A 2DNLA 3TAPA 3BSAA 3W65A 1HMVA 2RQMA 4XDDA 4IRCA 3KLHA 4LBIA 5IOLA 4USMA 1N52B 1X60A 5KFCA 3BPDA 4IR1A 1TKZB 4HHJA 4LBHA 2V69A 3RBEA 5IXUA 2QRRA 1O5JA 1RAIB 2QLXA 3MM7B 2YVSA 4EWTA 4HT5A 3TUJC 5C7PA 2V2KA 2MHEA 4FNIA 3HX9A 1C0TB 5HVHA 1OSDA 3VGSA 2IFXA 4X4UA 3SZ2A 1Z2LA 3CD7A 1NPRA 2WB1D 3AHPA 3ETOA 4DR5J 3VR1A 3BREA 3QJLA 1NBEB 4C11A 1A9NB 1NK8A 2FJEB 3BGFA 5CCMA 1TUVA 4M8LA 4N77A 2EFGA 1YJUA 2VOPA 1P27B 4P71A 5I3UB 4M94A 4Q8FA 1WDTA 1VLOA 3K5LA 2IY5B 1OPZA 2AJQA 5ETPA 3FCVA 2YNGA 2GC8A 3PM9A 4NCGB 1NUEA 3M1VA 5DM7Q 2U2FA 3E2EA 5FLXU 4ED0A 2AJFE 4RBVA 1FWPA 1BLUA 3MEGB 1YHQS 4EFAC 2B9YA 3CCSS 6FDRA 3UWTA 1TK8A 1U1PA 4JI8F 2VJUA 2YKMA 2E9ZA 3PIOQ 3OVSA 2IRUA 4CH0S 3L95X 3M8ZA 4IFYB 5DZ6A 2Y1RI 2H5JB 4X62J 3D6FB 3ZNJ1 2F9JA 4NX9A 4ZVEA 5F8LA 4R5PA 1H74A 3GFYA 4Y3CA 1FFGB 4GVLA 3M2UA 1I3OB 3BO3A 2YQ3A 2Q1LA 1V3SA 1M5OC 4QWDA 5D77A 2FZGB 3LA0A 4AQYF 3DI6B 3KG4A 1J5OA 3C66A 3HLUA 3G6XA 5ETSA 2HZVA 2A0FB 4N8NA 5HP1A 1S1XA 2F4VJ 2EK6A 3I4HX 2CG8A 3I31A 2HNZA 4I7FA 3CJQA 4KT0C 1ELOA 1LXNA 2ATLA 2RUSA 1X0PA 3W9IA 2Y9HA 3J7AN 2D3ZA 1TAQA 2GO9A 2UUBJ 4WE1B 4MFBA 1VBXA 5DM6Q 1JXVA 1R43A 3WZ0A 5CCLA 4O0NA 1Q8KA 3PFOA 4DR2F 2RF2B 1X0FA 1WOSA 2W24A 2ZJRQ 4P74A 4EMDA 4PAAA 4U7UD 4OYAA 3IM9A 2LEBA 2C2MB 3NGKA 5FD1A 3HHLB 1T9WA 2ZH9A 2BJDA 1FI4A 3OLBA 4CWBA 4A4JA 3U1MA 4ZLNA 5KT3A 5BR8F 1WD6A 3DM2B 1KQSR 2H54B 1GH8A 5IC6B 1B4SA 1U45A 2DPJA 3OL9A 3KLEA 5L38A 2CUYA 2RD5C 4ECQA 3CDEA 4Q45A 1FDNA 1VOMA 1WEYA 1YWXA 1AZSB 4ERDA 1KTVA 2V6AA 2XO7A 2OELA 2IYIA 3PYDA 1PGZA 4O23A 2LVWA 5F8NA 4CH7A 1RK8A 1NK4A 3GJTB 4NLWA 4OZ5A 2YKNB 2KXHA 1XMBA 9RUBA 1VBYA 1UPPA 4YDDB 2PIIA 2H1YA 3EVWA 1KDNA 4K7QA 3C6TB 3N6NA 4PYAA 2R8KA 3AFGA 2DGTA 2R2RA 1N32J 5HBMB 1KR4A 1HI1A 2RHQB 2XGPA 3FEYB 1RP5A 4DLGA 4UUXA 2GVZA 2M7SA 3QFHA 2MKSA 3K5NA 3ITHA 3RBZA 3KJQB 3NS7B 1JLQB 3DGPA 2IRYA 1NMEB 1MN9A 3JYTB 2RU3A 2HFVA 1N5TA 2F8HA 4DSLA 4DL7A 1LFWA 4IFVB 2BJ3A 3GR1A 1TFYA 4IH7A 3C15B 4DV2F 3NMRA 3BKFA 3N6MA 1BQMA 1FRLA 4E98A 2A6MA 4G65A 3TI0A 1TKDA 2V9WA 1C0UA 1B3TA 4MK8A 1IKYA 4JI1F 4YR3A 2DR6A 3H4DA 1S1WA 1JMTA 2YNFB 2GFFA 4J9SA 1F2HA 3ZZYA 3RAMA 5IC4B 4DSFA 1N88A 1MNEA 4MIBA 4N7TA 1HR0J 2H5IB 3QMQA 4JI0J 1VRUA 3PKYA 1WHWA 1PBUA 3Q8PB 4DCPB 4N56A 1UVNA 1C4CA 3EGNA 2GIQA 3KDNA 3H5YA 3AA9A 3CTRA 3TA1A 1RWMB 1VHFA 2DHHA 5IS2A 3HHDA 1RAHB 1E6VB 1K0VA 3U27A 4DSJA 1X9WA 4FXWA 3G82A 2KRBA 1DBDA 2UVWA 1YBUA 3OXGA 1RT2B 1EKRA 2VQFF 2KT2A 3AOBA 2F65A 3CNQP 1JJCB 4P10A 2HBZB 2YWEA 3MD3A 3RR7A 2H3EB 3ONQA 5ITHA 4ZIWA 2V68A 1XIQA 1JLBA 3OTBA 2PO4A 1U2RA 2XMKA 2NXCA 3IC1A 1WELA 4ZJQA 2CQPA 2P9EA 3RJMB 1FKOA 4DR7F 4QCLA 2DYAA 4DV6J 2VJVA 3M8QB 3TZZA 3OR2B 3UN3A 3H90A 3TVYA 1WHVA 2VOOA 1G4CA 2VPYB 1F60B 2B56A 1RSCA 3CJ3A 1FE0A 3TRGA 4CNZA 4JI2J 2CQ3A 1Y0HA 1KSPA 3OTEA 1G3OA 2HK3A 4ZCIA 2I9SA 4KHPJ 3HM9A 1VYAA 3BSCA 5I42B 1FXDA 1S6PA 1XTZA 2AJ0A 3GWCA 2BVZA 2NZCA 1RAOA 2Y1LB 4B3OB 3HHLC 4CO5A 3FGVA 5D4NA 3PNIA 4YR2A 2J9DA 4ENOA 2CPEA 3CDUA 4AYBD 1X7VA 1Z4UA 3HXMA 5AXLA 2H4WB 2ZBQA 1DRZA 1RT3A 4N5SA 1SV5A 4KGZB 3HDSA 1J5EJ 2MMYA 1CULA 3UI3A 3TARA 2WOMB 4OX9F 3OJUA 3FJ2A 2YBVA 5DO2A 3KXDA 1LK7A 2DH7A 3B4MA 4LFAF 1R27B 4Q0BB 1SKRA 5KFWA 2GV1A 1KQGB 1TV6A 3OTOJ 2MYFA 3FZBA 1HNWF 3E3XA 1BGXT 1G7CB 2W8KA 4DS5A 1FO1A 2C3MA 5HLFB 3MM5B 2N82B 5HJXA 1FJCA 5IZHA 1I94J 2B43A 2QX0A 2RDJA 3DGVA 3SFGA 3BGRB 1Y11A 4LFCJ 1CLFA 3OQ2A 4EBEA 3SCKE 1VQ6S 3JSMA 4A8WA 1UFWA 5MLCV 5KAKA 3QT7A 5M2RA 1UCNA 1Q79A 4NLQA 2OPQB 1B0VA 2GO8A 2D9PA 3W64A 3UR3C 5CYJA 3PCOB 4LMZA 4F4YA 5B0DA 3FFIB 4CTAA 2DXDA 1Z1ZA 2J9CA 1RT1B 2KZMA 1KHVA 3LWMA 5A76A 2RKIA 3SMZA 4OFZA 5G4DA 1RWXB 1WWHA 2KFYA 1RAFB 4BWMA 1KFSA 2BJ1A 2QMWA 3RBXA 1RU2A 2ASYA 1Q7YT 2V67A 4RUBA 4DBQA 1U1NA 4WFNQ 4DV5F 3EE3A 2CJ9A 5BXIA 4JI7J 4ETZA 2MZRA 3MUMP 2QMXA 3C16B 1IKXA 1JX4A 1GAOA 4LFBF 1VQLS 3MM9B 4QU7A 4PWDA 3M32A 2DCUB 2ACMA 3UCUP 1UETA 2R7OA 3AOCA 2PI4A 2KG1A 4MMOA 3SIPB 2H4YB 4NLUA 1ZYQA 3DRYA 3TR5A 3D7SB 5J1EB 2X3DA 3MPDA 4K4ZA 4NLPA 4DL5A 1DTQB 2LKZA 1XBWA 2RHSB 4QPTA 5GADI 1HL6A 1RWWB 2NXEA 3M6XA 4WBFA 4H4KA 4Q2MA 3KLFB 1ZTTA 4ELTA 1S1TB 1IR0A 4A8KA 1IR1A 4F67A 4ZMMA 2JLFA 3W8GA 4C48A 1ROFA 2KXFA 3F56A 2MDAA 3KJFB 3FCHA 4DSIA 4FVMA 5HJYA 1DARA 1L3SA 4Q7AA 4FF4A 1S0VA 2CQ2A 3R3TA 4DL3A 2VKZG 3MCOA 3IAS9 2I6WA 3VAHA 1DQAA 1TKZA 1UMJA 2F63A 3G71S 3NWRA 1HBOB 1CJUB 2K7KA 5DG9A 3TO8A 1BQNB 2HHSA 2XG8A 9ATCB 4L3KA 1NJZA 4OHXA 2YXLA 3K57A 3KLGB 1JLAB 2I0XA 3OL6A 1X4EA 3FKBA 1LKZA 2J5AA 3NCRA 3MM7A 1R8PA 4I69A 5J2PB 1B99A 2FHJD 3MAAA 3VF0B 1TKTA 3SFUA 2MZQA 3PYGA 4OZ2A 1C0TA 5CXTA 4GKJJ 4HHHA 1S1VB 4LF4J 3C14A 4KYZA 1VCTA 1Q53A 5IM0A 4PWUA 1HYSA 1U49A 1SH2A 5LMUJ 5I3UA 4FDFA 3T1YJ 4OZLA 3CD0A 2IHR1 2COLA 3I0SB 4F50A 3RB4A 4PXDA 2CIMA 1CPZA 3DLKB 3ISNC 4NCGA 3NG8A 4RJVA 2IM0A 5AE2A 4IR9A 3CB4A 2JC0A 2MKKA 4PKDB 4PWWA 1GNKA 3H25A 4OYPA 2V2QA 4NEYA 2UUAJ 1HQ2A 3MEGA 2QSWA 3DDNA 3UW1A 4RBTA 1H7XA 1OQ3A 2RIJA 2G4BA 4CYUA 2AP6A 3IBCB 3CUNA 3K5MA 2RRNA 1FWLA 4NMLA 3ENAA 4DF8A 3Q22A 2W2QP 5D0GA 4RW9B 1T7PA 5C24A 3WBZA 5HVFA 3GQCA 3MHYA 2FVCA 1OWXA 1TVRB 3VAFA 4DR4F 1LW2B 4IDKB 3QFWA 4DV0J 2H9ZA 1VHIA 1XR7A 1WF2A 1K0TA 2WTFA 2PA3A 1QSLA 2FJBB 4A46A 1FKAF 1YSJA 2C28A 5H1SV 3DI6A 2HEKA 4KIAA 2VASA 2RMLA 3R1LA 1KONA 4F2SA 1T94A 4UOFA 3G4SS 4RX6A 3DDIA 4W4MA 2IVYA 2PEBA 4YEAA 1QTNB 2OPPB 2KO1A 5JXSA 1UPMB 3MEDA 1L3VA 2C2NA 3UE2A 2DGXA 1HPZB 3AD9C 3OFGA 2YKQA 1IM6A 1UEUA 4DN0A 4LRAA 5EUHA 2WBRA 2GHPA 5LOQA 4YUDA 4DFPA 2QL7B 1K73T 4ZS6A 2FJVA 5K8MA 2IDLA 3S01A 1T11A 2UU9J 5AXMA 5E7OB 1H3DA 5LMNF 4NOHA 4A48A 3H2VE 3IBFB 1RI7A 4OYOA 3W2WB 1W2IA 5K8NA 3HHEA 1U2CA 1ZM2A 2C2RA 3MUVP 3FQLA 5GMEA 3KDOA 4ED2A 3HT0A 1CJKB 4NLVA 1XN9A 5A6PA 5KOXA 3EDRB 4ANEA 2UXDJ 3ZZOA 3IGNA 3LPYA 3M2VB 2PMZD 1ZS6A 4ZVUB 4DQIA 4WFAQ 4Q5VA 2GVDB 4ZP7A 3FC9A 1URNA 1YKWA 2YKOA 2YQ1A 4CM2A 2E66A 2DNPA 2MQPA 3PW4A 4Y65A 1AZSA 2HURA 3QAUA 3OVAA 2IA6A 4BC7A 5HSPA 4YB5A 2CNKB 4PG7A 2R8JA 3NL0A 1GXLA 3K2YA 4MIAA 5H9FJ 3BJYA 4RR5A 1OQ6A 4CLZA 3C6TA 2QV6A 5IQQA 4ELVA 3CD6S 1WEZA 4USVA 4ETXA 3BEGB 5HBMA 3DRXA 3LF0A 2G1DA 3D5MA 5B09A 3VGTA 2K2PA 3NAHA 4G1IA 4O3PA 5KFSA 1C2PA 3R97A 2QEXS 3H0PA 4UZBA 1FESA 1IKVA 2YWKA 1YTYA 1SL1A 1KVIA 3UFCX 2GX8A 4NXNF 1NJXA 4WK1A 2JEFA 3WIUA 2OAUA 3N5BA 4WPAA 4DPWA 5KT4A 2KM8B 1WHYA 3A12A 4X66F 1FF2A 4IFVA 3V4MA 1KTQA 2QLBB 4NYZA 4MKBA 1S4EA 1W2BR 2ZH5A 4RW4A 3JAMU 3C15A 2FLLA 5DDQC 4E2FB 2PMWA 1UVKA 2E9RX 4PPDA 3RYLA 3ZZZA 4DV3J 3EXYA 3IR5B 1C1CB 3ETMA 4UQTA 3HK2A 2DGVA 2HGLA 2HQDA 3RTVA 2J6UA 2IM1A 2Z2LA 1RAEB 5F8GA 2DD8S 2KRRA 2B51A 2OHDA 4TYBA 4NYPA 3ENWA 2BE2A 4ZPCA 4LQ3A 1UZDA 2C2ZB 2XMWA 3ZZTA 4BBYA 1VQ5S 1S59A 2M3DA 4AXIA 2OP5A 3JS9A 1N0UA 3PVXA 3UQSA 4U6PA 3D28A 2K7JA 3ZTSA 4FBTA 1HNIA 5F9LA 1X4CA 2DNGA 2CQIA 2O01C 3QT8A 4ZLLA 5IQ6A 3KHRA 4USTA 4WXWA 4GKKF 3Q83A 1GEHA 2AF6A 1BD6A 2J76E 4FYYB 5F8JA 2E1RA 2M5YA 2AHOB 3MMJA 1FXLA 2P8IA 4AL7A 1W26A 1FEEA 3EJMA 1VI7A 3MPWA 5GMKa 3IWNC 1VDHA 3OXLA 3K59A 4D3GA 2ZDPA 2UXBF 2YH1A 1FTCA 2V8VA 1YRUA 4JV5F 2NREA 1ZM3A 1RGVA 5DLGA 2QIFA 4ED4A 5L1KA 3DLEB 3EGVA 1RWPB 3M8QA 4DN9A 4WCEQ 2M9KA 2UXCF 5KT7A 1VQOS 1TL3B 1F3FA 3SSQA 4B08A 5HROA 2OD6A 2A18A 4ECWA 2UV8G 4X4VA 3N6LA 3V4IB 3QSYB 1NM2A 1RU1A 3UR0A 1N4LA 4OI2A 1OSCA 4QIGA 2KHCA 4P2XA 5KFGA 1A7GE 1RCXB 2W4CA 4P2SA 3PW2A 3LAMA 3CCQS 4IO9Q 1FRMA 1S0NA 5I42A 4HH0A 1EQ0A 3VWSA 3FVYA 4JI8J 2F8MA 4QR2A 4LF8J 2W01A 3NGDA 1FEHA 5L1JA 3DKDA 1MN7A 2WONB 4ZN1A 3TYTA 1OYEA 3OR1B 1NXIA 3WIVA 1RACB 1HBUB 4KPYA 1IBMJ 1DTTA 1RTZA 1ZAWA 3E51A 5M2UA 2XC9A 2GQQA 2VDHA 3R5CA 3GV7B 4ICLA 3TUZC 3J80Y 4W98A 4QWAA 2W2NP 5DQGA 5L8RC 4AQYJ 3Q2TC 2WOMA 4HDHA 2QMUB 1U24A 4YN3B 5J2NB 2RH3A 1JLGB 2DEIA 4K50A 4YY3F 2BJEA 1U25A 4Q0BA 2ZDOA 3GV8B 1D1UA 5LSOA 4ED8A 2Y0SD 1QAIA 2F4VF 3HFVA 2Z4PA 2M2BA 3TVZA 2FJDB 1WC5A 3HVAA 4U95A 2BOPA 3OSPA 2DNNA 1PAEX 4CO2A 2VONA 1TELA 3GCXP 4DL6A 1UFLA 3L09A 1HW9A 1HBMB 4DL0C 2D74B 2ROGA 3BGRA 2IA0A 3W9HA 3B6BA 4QWBA 4DR2J 1U1QA 1YJ9S 1X4DA 4OV1A 5GAGU 4KO0B 1JKHB 1N33F 2XM3A 3SDEA 1M5KC 4ZVGA 4ZP6A 1GK8A 3BZQA 4EBDA 2HHQA 3M2RB 1FKPB 3PACA 2JH3A 3FFIA 1IUJA 1NSAA 4YMEA 4U7UK 1SJ4P 5BR8J 1OMSA 1R8HA 2AYEA 2Z2ZA 2ZNZA 3VZIA 2BKPA 2DNYA 1RWNB 5D78A 5THWA 2VFSA 1NU4A 4J91A 2KM8C 3EUNA 2B8PA 2LU2A 2W9BB 2C3PA 1T03B 3QWUA 2AEMA 2N7YA 2ZFHA 4O3NA 4KKOB 3CF5Q 4C8YA 4M5MA 5H9FK 3A8JA 4CLKA 1SJRA 2FVRA 2DH9A 2ZHAA 3DU5A 5HAOA 3HHLD 1U0HB 2HMIA 3DHWC 4FKYA 4LR7A 3ADAC 2HZCA 5HVGA 3L4BC 1RT5B 3TAMA 2V9KA 1FRXA 1MU2A 3DOKB 2D7SA 3J81j 3EZOA 2A10A 2B8QA 3F73A 2ZOGA 2O5DA 4TN2A 3HVTB 3QRRA 4J90A 1TZ0A 1V6HA 3KLFA 4C0HA 5KG1A 5K14A 3CGIA 1YX2A 1S1TA 4PUOB 1D0EA 3BH7B 2XB2D 3F44A 1Y00A 2Y0BB 5KFHA 4KHMA 1Q5VA 3M8PB 2JJ4D 3CSKA 4U67Q 2MLXA 2B4OA 4ZP8A 4KRWA 3GYNA 1XEZA 3L9ZA 5EWFA 1EETB 2H5EA 2ZWOA 2GMJA 3CCWA 3KFWX 5AE1A 3T5KA 4Q2LA 4DV2J 3MMBA 2YNIA 1BC6A 4C3LA 4H4MB 3ULHA 3EM1A 4HI1A 4LIWA 3BV8A 2B3TB 4ECRA 4DMZA 3M6VA 4OHWA 4O4GB 1RABB 4I1TA 3D0GE 2FGCA 4KH1B 2ZH1A 3KUHA 1IKWA 2HS0A 2CRLA 1Y5IB 3TX8A 1KHWA 3N0VA 2RVJA 4ITSA 3DN9A 3I55S 4DX7A 2MQOA 2BM1A 3W61A 3PJ9A 4JI4F 1SC6A 2AZ1A 1YLXA 5HI7A 2G2ZA 3THVA 4PG8A 2QSFA 4OQJA 2LXUA 3VVTA 3KLIA 1VK3A 1N8RT 5KOWA 2F1FA 2KFZA 1NK7A 3GONA 4IYQA 2UVVA 2KDOA 2E7XA 4CI0B 3K8VA 2CWXA 1YGYA 2VH7A 3D6HB 1BUXA 3I0SA 2MTLA 3HFKA 1H38A 5G0RA 1T05A 1UEKA 2VA2A 4NLDA 3KNAA 3CULA 1VIXA 2DNKA 3DMJA 4F4ZA 1ZOTA 6AT1B 2R7WA 3LGMA 4TLQA 4E0DA 4YB6A 2OSRA 5C25A 2Y1IA 4CLFA 2H65B 4ZVQB 5A0YB 3HSJA 1X4AA 1SQEA 3MR5A 4DR7J 3I9V9 5RUBA 4QW8A 2MQQA 4V19X 1TMMA 4IOAQ 1WTFA 1V5IB 4Y2IA 1TVRA 4NLRA 1LW2A 4IDKA 3VAIA 5C2CA 2IMWP 3RAXA 4D3HA 4OJHA 3SCJE 2GQCA 2CPZA 2QLWA 4OYIA 1YBTA 2FLOA 3W3SA 1C1BB 1SXLA 4NLGA 3M30B 3VQTA 5GAEI 1WG4A 2HS4A 4X65F 1NB2A 2HFOA 3PRVA 3G6YA 1XC9A 1RHQB 4QIVA 2BXJA 5A8KB 2GGPB 1ZA2B 2L9DA 1ZZFA 4IQXA 4ZPAA 4FP9A 3Q89A 2Z2YB 4B9LA 5FLXY 4KAIA 4PQAA 2L41A 1MROA 4X4RA 4ZVSB 2HBQB 2DRAA 4ED1A 4BCAA 1U1RA 2B4PA 3BYRA 3ZZ0A 2B6AB 1NKCA 4IG3A 1REGX 4OHYA 4OX9J 2MZJA 5IT9Y 4FYDA 3DRSB 3OV7A 3TA0A 2VG7A 4J9VA 4LFAJ 2HVEA 3MM6B 4KGXB 4K4UA 1RAJA 1F0XA 1WI6A 1UWBA 3W2WA 5ETQA 2OD4A 1HNWJ 1PJ6A 3FZ2A 2ZH3A 4LF7F 1HQEA 2E5GA 4ER8A 4O3RA 3RRHA 3SEOA 3ISND 4RWXA 4ZA1A 2C42A 1U7LA 1FDAA 3PV8A 2WVEA 1U0SA 4Y6IA 2XGQA 1RYRA 2C2DA 3KUEA 1M1HA 4HACB 4WWSA 1WC3A 1HBNB 3C3LA 5KG3A 4RW8A 4TY9A 4RW6B 1FDDA 1HHQA 4UOGA 4Q43A 3B82A 3H42A 3MFHA 2V2ZA 3BO2A 4ECYA 2ZZTA 3R7SB 5E3RA 1F9FA 2FD2A 4USHA 3H40A 3TW0A 4GC7A 2HNYA 4N8OA 3PG9A 1S0OA 4KH0B 3BF4A 4L73A 4FYWB 2HZAA 5ETOA 2FY1A 2VG5B 1IJFB 3C19A 3G9CA 2VL1A 1NPPA 2XCAA 4Y2CA 4DOZA 1QY7A 4DV5J 2O66A 3PRBA 4ECVA 1BY9A 1U6FA 1NEEA 5D3GB 2F8EX 3BN7A 4RNHA 2HK2A 2MKHA 2GIFA 2DT9A 5FDLB 1NRKA 2YX4A 3THTA 1H72C 2CXEA 5C42A 4DUYF 4LFBJ 3K7RA 5CZXA 5BYQA 2AGQA 2X1AA 3H5UA 5L1LA 5KFUA 2QZ8A 3Q8RB 2IVMA 4NZ7A 4N47A 1JJ4A 2ZD1B 1S72S 3NAIA 4CLPA 1X31C 1YITS 1MWYA 1DAXA 1AUDA 3QIDA 3VGVA 1EARA 4CDIA 2WSFC 3IWXA 3KK2B 3CD5A 5T14A 2JHEA 1K47A 1N5VA 3OUYB 1FRJA 5DRKA 3BM7A 5CD4A 2FVPA 1NK6A 3KJVA 1C1CA 2QA4S 2K1RA 4GO7X 2MGZA 4RUAA 2B5JB 2RS2A 3GSDA 3I5BA 4ALZA 1HIYA 1NB7A 3MMAA 1BHNA 2FPHX 3ELHA 2CNLB 3JSRA 5FJ4A 1ZA1B 1RBLA 2RT3A 4EZ9A 1U8SA 1M5PC 2W2OP 4DZ6A 3AQPA 1SPBP 1SKSA 4ED5A 3IBWA 2J7UA 1EB0A 4TKTA 3TA2A 4J9UE 4JV0A 2XBPA 1FK9B 1HI0P 5A8WB 2MXYA 3MWBA 1MMNA 2A1BA 4H4OA 3T5LA 4F0HA 1BQXA 5HMXA 3O1LA 5K20B 3GJQB 4B3SF 3TUPA 4M5DB 1QSSA 1EAYC 4I2PA 1P9QC 3KTQA 1OY8A 4FPIA 3HO1A 1O6XA 3OBIA 4HYKA 1S12A 3I96A 3MM8B 1TUGB 1SL0A 2BYCA 4ZVOB 3GTYX 1FX2A 4KJIA 2HQ3A 2DHXA 3AOAA 3NS5A 1QTMA 2Y3YA 2V34A 1RCOB 3FMBA 2HQFA 2ZH8A 4LF4F 1WG5A 3DLEA 3M8RA 2W2PP 1SH3A 3S8SA 2V4QA 1MWQA 2MY7A 5EX0A 3MTKA 1RA7A 2DR7A 3L7OA 2E5LF 2QL5B 2V8PA 1S9GA 1X5SA 3ISZA 2FB0A 4PPZA 1FX4A 4J9LA 3D0IE 3EWGA 1RTDB 3NBPB 2QFIA 1HNVB 4DV4F 4LSZB 1GMVA 4FF2A 1WC4A 1WACA 4DG1B 2WONA 1XK8A 3K89A 3CJRA 2HHHF 3OR1A 1HD0A 2AEJA 1M90T 4DR4J 1Q4RA 4BWJA 1XR5A 4KGKA 4ES1A 2WVCA 4ZIVA 3T3FA 2VG6B 3BS9A 3TEGA 3V5RA 2FIUA 1QVFR 1EQMA 3W5ZA 1W7WA 2MLYA 3EX7B 2ZH2A 3V81A 2BV3A 1NK5A 3C6UB 4C3KA 2EW9A 1RHJB 2DO0A 5DDOC 2FDNA 2JEIA 1ZAXA 3VCDA 3FRZA 1A6LA 2AJ4A 4RNOA 5E33A 5HQLA 4JI3F 4RW7A 1DQ8A 2FQQB 4L3NA 4MKAA 1JXEA 2LA4A 1U1KA 3D54A 4ZHRA 1I1GA 3VAKA 4PQUA 4C8OA 3CJKB 2NZ4A 3BPSP 2F7VA 1KVJA 4IOBA 3DCAA 4EYHB 3GR0A 1K8AT 5KFAA 4KO0A 4FN5A 1GMWD 3O6QA 5LMNJ 3MPVA 2GS8A 3ZTQA 1UEVA 2DGUA 4I56A 4WZMA 1FKPA 4LF5F 2VODA 2HWTA 3SBMA 3SXLA 4CT8A 4O3SA 1S6QA 4KFBB 4LSLA 1CS4A 4WU3A 3LO3A 3Q2SC 3ZC4A 4JP8A 3GIMA 1LNQA 2ZJPQ 4CNYA 4DR1F 2JSXA 1W25A 4JB8B 1Y9OA 2XMMA 2B7BB 1G6BA 1T03A 5F8MA 2PI5A 2FGOA 3R7NB 4WIQA 4DPYA 4EU0A 1CJTA 1U09A 4M5LA 4M5JA 1SC4B 4ECZA 3LPEA 4EYIB 1VQYA 2FVSA 4CO0A 2L9NA 2JFDA 3HSZA 5LM7E 1RT5A 1KRPA 2LXFA 1WOPA 5KFFA 3DOKA 1PYTA 4C8KA 3G86A 3IG1B 5ETMA 2ADCA 3PFEA 1MW7A 4TQRA 1H7WA 2LFVA 5GAGI 3HVTA 5KG4A 6FD1A 1VQKS 5KFQA 3CJSA 4FNHA 4ED3A 4PUOA 1UVJA 2FHOB 2UV8A 4DX6A 4NXNJ 4B9UA 3O5TB 2V8HA 3M8WA 2JX2A 3M8PA 1IN0A 4FBUA 2D3O1 1D9AA 3P4UB 2BACA 2NXNA 4DLEA 2Z57B 3R6LB 1ACMB 4OZNA 4OI3A 4X66J 2NYHA 2OPRA 4QR0A 5B0FA 2AX0A 3ZTPA 1CC7A 1JLFB 3DLHA 4QIFA 2R9LA 1U6ZA 4IH5A 2E5IA 4I67A 4LIRA 1QUPA 4H4MA 4AUKA 2DH8A 4NMXA 3BH6B 2BKOA 4EZ6A 3DRPB 5EN1A 1YBAA 3G2XA 1SUQB 4O4GA 2XS2A 2Y8WA 2UVUA 2I1RA 2CYYA 3GB0A 4ILRA 2OUGA 2XMVA 2VBWA 3KYLA 3K17A 4EBCA 2DB1A 1OIAA 2JDJA 2JEGA 3GE9A 1F1BB 1X4HA 2W9CA 1NDCA 1UVLA 2ZBCA 2AYBA 3I6PA 3R1HA 5M2PA 2W7OA 1KFDA 4UOCA 3DU6A 4R8UB 3MF5A 2R7QA 2YWHA 4BC9A 4GKKJ 1A0OB 1CSJA 2J9EA 5HMWA 3FBCA 3M7VA 4WP9A 4AT1B 3W9JA 3LP2B 5CA5A 2VC1A 1N48A 1Y4ZB 1NJIT 3AQOA 4UW2A 3MR3A 3VGUA 2YWWA 1QAYA 1VQMS 1G1XA 5CD4H 2UXBJ 1SKUB 4B9TA 1RQ0A 4JV5J 2QA4G 4BHQA 1XNRF 2N7CA 4OLOA 1Q8LA 2WHOA 4WFYA 3HJFA 2E1PA 2K8GA 3M4XA 4LSNB 4X64F 3QJPA 3DYAB 4JI6F 2LECA 5L46A 3E8OA 3I5AA 3A3NB 2UXCJ 2FJXA 4O3QA 4WTYA 3AT1B 2RS8A 2BQ3A 4Y34A 5BYSA 2KH9A 3HZEA 4C8ZA 2VICA 1CQNA 1NZAA 3PR4A 1S9EA 5D8HB 4E8UA 3IAM9 1XJWB 4C0BA 3HPOA 3GV5B 3AAWB 5A8KA 2GGPA 5BYRA 3PHTA 4KPCA 1K9MT 1AW0A 1H0HB 2IM2A 3OVBA 2OO4A 3MECA 4LF8F 5IT9U 3A8IA 2KG0A 2FY8A 1NLKL 4F3MA 4AL5A 3HT3A 5HK4A 2R2UA 3GU0A 1IBMF 4URSA 1IBLF 1LW0B 2B6AA 2ALYB 4IG0A 2EC0A 4RUHA 2DISA 2WK4A 1MLAA 1HMVB 1RWUA 4EGLA 4F3QA 2JEJA 4YY3J 4ILMA 2EKYA 1FRHA 3MM6A 4OYWA 4DFJA 1TL4A 2HHTA 4Z7CA 5D15A 1MMLA 1RTJB 1NDLA 2HWHA 2BQRA 3LP1A 4KV8A 4TY8A 2MEWA 1VRQC 3IA0A 3PDNA 4L6V3 2UUTA 3D67A 1FNXH 2LQBA 2BMBA 4HACA 4J5OA 1VBZA 1TKXB 3OHAA 2YQ0A 2V4JB 2E1MC 3UD3P 1S10A 3PRDA 2NLWA 1DFDA 2J0WA 1NZ8A 4DR6J 1O51A 2FLNA 5KFRA 5L9NA 3OXFA 2VBXA 2R2SA 1N33J 2CZ9A 3QLHA 3SQGA 1SB6A 5AJ3F 4GVBA 2EWHA 2XSJB 2AT1B 3B54A 2Q79A 1CC8A 3RB3A 4DPXA 2M0GB 3CCJS 2VKRA 2YNHB 5D0HA 4WK3A 2YNGB 2DRBA 2ZEJA 3P5BP 2DO4A 1JLCB 3PO5A 4EI2A 1R7IA 1U4BA 3OT9A 1R0AB 3HP6A 5A8RA 1RE1B 5KFBA 1CQMA 4LF9F 1WJ9A 1N0VC 4OI4A 2LCWA 3Q23A 4OYXA 4I6WA 2BW2A 4LVNP 3QIPA 2YKMB 2X1GA 1UA0A 1GX6A 4TNOA 1GTHA 4OI0A 3HD2A 2IC3B 5ETKA 4ID5A 2DNMA 4R5PB 2YKAA 3E01A 5JUMA 3NP5A 2XMUA 2IYGA 3MMCB 3QATA 3M2UB 3W1YC 2B5JA 2VFUA 4ILLA 3EVMA 2IJFA 2BE9B 5E3CA 4FVCA 3N79A 1YQHA 2ABYA 1D09B 1RT4B 3KG1A 5HP1B 3W5YA 2FHJA 1QE1B 1RHRB 3PKMA 2HVIA 3W66A 1S97A 4OJGA 4I7FB 2LQ9A 5CYQB 2MQ8A 3LOUA 4PEOA 2ASLA 4NA2A 2KVIA 5ETLA 4DV1F 2MB0B 3UCZP 1FVQA 4PXBA 2B0GA 1YRXA 4P2FA 3IMQJ 3LH2S 4OLPA 4IQMA 1OY6A 1WOOA 4MFBB 5B0AA 2DIUA 3FSXA 5D4LA 3FNNA 1FK9A 3KHGA 1YJWS 3NGRA 3THPA 3P8BB 1LXJA 1X9MA 2VBZA 3W2VA 3DXBA 3RU0A 2RE1A 3R6GB 3JAMY 4M5DA 3K0JA 1YZ6A 2OPSB 2MSTA 4C2MA 4ZPBA 4JI4J 3R5JB 2P2CB 4NA1A 3NOGA 3HF5A 3ET6A 1Y5LB 1NKBA 1S1UA 4M1KA 2V5HG 3CDWA 2ZITA 1XMOF 1T3NA 4FS2A 3NXZA 4EEYA 4MKYA 2XNQA 3JQJA 3IO1A 4ZPVR 1P8GA 3CCZA 3FUYA 1CG2A 4DPTA 2BRLA 2VFRA 4DPUA 2HNDB 3KLEB 1T9TA 3MDFA 3CCTA 4OZ1A 2LEAA 2JNJA 3DLLQ 3TX0A 2CPFA 1DLOB 1QAJA 1WC6A 2YY3A 2ZE2A 3TJ8A 1E6YB 1VFJA 4MJKA 3TOQA 4NASA 4NLOA 3OTCA 3SCLE 1RTDA 3UD5A 2RRAA 3VQSA 1HNVA 3ICLA 4F8RA 4YDXA 4WFXA 4ZCLA 5HQ8A 3IM8A 4YR0A 1VQNS 4TU9A 1YJNS 2V0NA 1KBRA 2GVZB 4F3OA 2VG6A 3D9BA 4DUZF 2L48A 4Y00A 1REVB 3D4JA 2YWGA 1F5BA 2V50A 3KK1A 4NRUA 4X65J 2Z30B 1FT8A 3CMAS 5HMZA 5KT5A 3HULA 3KK3B 1NH7A 3MPYA 1F5AA 1GQEA 4WZQA 3RGIA 3RAQA 4QIWD 4P73A 4NCBA 3D3CJ 1F3VA 2FZCB 2OTJS 2KHDA 4F02A 1BQMB 3DOMB 1ZH5A 1Q95G 4A8SA 2G0JA 4DV7F 2D3OR 4KTQA 2K06A 2RRBA 1TU0B 3MEEA 5F8IA 3RB6A 4Y28C 3SQOP 1JJ2R 3CJKA 4I6YA 3FBFA 4CQ1A 5KFTA 2X1BA 5IFMA 3HSDA 4RPFA 4JI5F 4RKUC 1KOOA 5KFEA 2BM0A 3HKWA 3TP2A 4M5GA 2QT7A 3DLGA 2WW4A 3CEDA 2CPXA 2UUWA 3DOLA 1HI8A 3ZZRA 4U8VA 2IVFB 5B0BA 4LF7J 4F4XA 4LRDA 5KFZA 1JQGA 4KFBA 1FRIA 4CO4A 1S0MA 1NK0A 2J8SA 3D1HA 2HS3A 3G82B 1RTIB 1KQFB 2L9WA 2HRUA 2E9TA 1D3WA 2CPYA 3OW2R 2VQEF 4OV6A 3AY0A 3OD2A 3OFEA 1NHUA 1V5VA 3G87A 1JLBB 4WKRA 4DFKA 1ZPWX 4DU8A 2ZC4A 1VIOA 1VRTA 4LJMA 1Y3KA 3J7YU 4HI2A 5KG5A 2BJ8A 1FKOB 1IQTA 2W7AA 3CDBA 2R8IA 1XQIA 1F5CA 2DY1A 3BGLA 1S4FA 4OHZA 4K4VA 3PHEA 3IG1A 4CLSA 5K8OA 5KFIA 3CPWR 2HAIA 1RDRA 1N6QB 2EFNA 4CLWA 4DUYJ 3PW7A 3NOCA 1QDUB 4JOUA 1M5SA 1L3KA 2HQGA 1GTEA 1Q5YA 2QLFB 2XY7A 4F4KA 2MKCA 1XNQJ 2E7VA 2ZUAA 1M0SA 1JLFA 3QT6A 4AD6A 4B9MA 5GMDA 3IS9A 2CPDA 1TUWA 2R8GA 1X5TA 1R31A 2BRKA 3QO9B 3H59A 4C4WA 2J8AA 2VBYA 2QE5A 1SV5B 4J9KA 1OS5A 2L3MA 1VC0A 1JB0C 1YJ7A 3UVJA 3VAMA 4RNMA 1NHVA 2VUGA 1KS2A 3V6DA 4F4AA 2BOAA 1WC0A 2I5JA 3IWLA 3P96A 3DFEA 4QYRA 4MIWA 1R3NA 2NR0A 1TV6B 2E1CA 3GYXB 4LF2A 2DGQA 4HL9A 1H2VZ 2CDQA 2LQ5A 1KQKA 4PG5A 2EC2A 2PMHA 4NCAA 1TQLA 2PA8D 2WAQD 3AXMA 1N5YB 4TU8A 1EHWA 1AFJA 2ZOFA 4MAKA 2FJAB 4Q44A 1WKKA 1NPKA 3JSMB 3CCES 3QQCD 2V8GA 2EI5A 1SL2A 2IDEA 2CFXA 4B3SJ 7FDRA 3LP2A 4ANDA 2B4VA 3ZTRA 2R7UA 5A2QY 5L39A 5EX3A 5DGBA 3S6EA 4CTAB 5KG7A 3QZ7A 4U7CA 1HNZF 4X4SA 4FXDA 2NS1B 4L74A 5SUHA 4ZVPB 4RBUA 5KFJA 2FHMA 4L72B 1DQ9A 3DYAA 2HLTA 1YIJS 4YFUA 4C0OC 2RSQA 2CZ4A 3BSNA 1Q86T 2OMOA 4JYAF 1S7IA 3M6WA 5DLFA 2IPOB 3UNGC 4RLEA 2E5LJ 5DGAA 3NKYA 3GIKA 4PWDB 1UJ4A 4XIUA 1YI2S 4QU6A 1WNEA 5T7LB 1SIZA 3R9LA 1L3UA 4ZK7M 5F0UA 1L5UA 1F9EB 4DV4J 7AT1B 4DR3F 3CO9A 4PG6A 3RW7A 2Q66A 4M63A 1Y7PA 2HHHJ 1TMJA 4RU2A 3UNYA 3PX4A 1U2FA 4ZLJA 2MZ1A 4IFYA 1SC1B 5IWAF 4FYXB 3NGUA 2P9CA 4Y2MA 3GG1A 1RWOB 4XTTA 1NDPA 4LR8A 3R5GA 1XWLA 3AA8A 2HRYA 1NSKL 4RU9A 2MY8A 3QGPA 2KXNB 2U1AA 2CADA 2WVFA 1G2EA 1X4GA 4KR0B 2HHXA 3UDVA 4ES3A 2DHSA 4DCJB 4X4OA 5F9NA 5LSLA 1RTJA 4JI3J 4LREA 3CCRS 4KSEB 3TWZA 2NSCA 2BDPA 1QM9A 2LP4A 2ZZNA 4F4WA 1H73A 1RHKB 3A3OB 3QPIA 1TP7A 1RHMB 1TKXA 4ZN3A 4WE1A 2V4JA 4LF1A 1ZM9A 2XTJP 2Q43A 3R5AA 3MAAB 1TKTB 2QO3A 2M4MA 3IR7B 1FD2A 4DCOB 2RAQA 2RF2A 2JFKA 4ANCA 5I3PA 2V94A 3LGNA 3V6HA 1T02A 3J81Y 4QBUA 2MKJA 4F0KA 4LF5J 5KFVA 2XSJA 3C14B 3HHLA 1HW8A 2HHWA 5IM0B 2HGNA 1HYSB 2DXEA 2DRDA 2A2CA 5LL6d 3LAKA 2ZKTA 2AYGA 1FNMA 1WDDA 1X5PA 2KL8A 3DM2A 4NZ6A 2YNHA 4DR1J 4GRSA 2EXUA 1N34J 2J7KA 4DX5A 4ZVFA 3JSBA 2I2YA 3B4DA 2ZH7A 1OJ4A 1QLNA 1JLCA 3T6BA 3IP0A 2OFHX 3G96A 1R0AA 2M8DB 4X4NA 1YDLA 1CVJA 2DNZA 4OZJA 1UVIA 3T9ZA 3CMQA 3MZIA 4TVAB 3PYFA 4K4XA 1U1OA 3SYZA 2P9GA 4CYUB 3FQKA 3R2CJ 1OYDA 4FZVA 4MKVA 2MKIA 2WCXA 3M05A 5C24B 2YKNA 5LJ3Y 2MJNA 2KTQA 2W25A 5KT2A 4M5NA 3US5A 3MAQA 4DL4A 2HSEB 4TQSA 2IC3A 3G6VA 4KGMA 4DDFA 1SIWB 2D1CA 1UW4A 2EK1A 2ZM6F 1PG5B 2NUUG 2BBEA 3MMCA 1NNDA 4ED7A 4A8XA 3GFXA 3D66A 2ADBA 1RT4A 3HCXA 3CMES 2DR8A 2KN4A 1QE1A 3KUGA 2VZ9A 1JLQA 2NPIA 2A2DA 3M9MB 3BB5A 1S9FA 3JYTA 5CYQA 4C9DA 5LXYA 1P6TA 2G9OA 4DF4A 3MEDB 4B3RF 1JIHA 1PJ7A 2RQ4A 3L7PA 1WKLA 5CH7B 4WTOB 4F2RA 4V19J 3UN5A 3QAEA 1FJ7A 5J1NA 4R0EA 1FVSA 5KFDA 1NJYA 2HHUA 3F0NA 1PJ5A 4B3MF 4QWCA 4ZVTB 1AB8A 4X4PA 4ZDNA 4USUA 3W5XA 3EDQB 3R5DA 2GJFA 3ZFVA 3PX6A 2IRXA 2OPSA 4C6AA 2MKYA 4U9RA 2JVOA 2YNFA 2LYVA 4IO1A 2J7WA 5JMNA 1V9OA 2XWXA 1KC8T 5IV4A 2BQUA 3HVWA 1N5SA 5GAHU 3ZTOA 3GMGA 2AEFA 3FSYA 2OEKA 1B7FA 2AIRB 2HNDA 2CJXB 1OPIA 4ZVRB 4XPCA 3BGOP 2PN6A 1E6VA 1PKUA 4CLTA 3GSIA 3CXCR 4CIOA 1GT8A 1FERA 2LA6A 3AD7C 1UWAA 2GHWA 2ZC3A 1RWVB 4WP8A 1DLOA 4ZOSA 1RT2A 4H4KC 2VPXB 3WC2A 4I0WA 5D0EA 2QA2A 4I2QB 1E6YA 4CO1A 5L9XA 2ZVIA 3FDSA 1S5ZA 1KLMB 4MK7A 4RZRA 1XNRJ 1VR6A 1N36F 3O3LA 4KGVB 5HMYA 1FNOA 1T95A 2E7WA 4KC5A 4X64J 2ROPA 1FRKA 5SZTA 4OL8A 4JI6J 3LWLA 4X2BA 1RJJA 5F3ZA 3BO4A 2A6OA 1F6TA 2HIYA 2QLJB 3OR2A 4NL5A 4CT9A 2D41A 4G1QB 4NPOA 1JWWA 2BX6A 1IKVB 4M5IA 2CVEA 2W4PA 1REVA 2QN6B 1WSRA 1HA1A 3DHXA 3PO4A 4FF3A 3EXCX 4M5HA 1XMQJ 3EPIA 4HTIA 5J2QB 3VHQA 2LXIA 4HEA9 5E3PA 3KK3A 3GP9A 3EPGA 1S48A 3KG0A 4MYTA 4RW4B 2D9OA 4EO6A 1LFPA 4IH6A 3DOMA 3FCWA 2J0XA 5KFOA 4O0IA 4B3OA 4OX6A 3ILIA 4URGA 5E0OA 3FMWA 2CPHA 3GIIA 4LRBA 1QAXA 4CZCA 1IBLJ 4DQRA 1K1SA 1JLEB 2VB6A 5HANA 3TZXA 1TL5A 2BE7D 1VC5A 1VMBA 2NPFA 2Q6BA 2BE2B 8AT1B 4XDCA 4DXLA 3BQ2A 4OMFG 1YK9A 4ZPDA 1LOUA 2XI2A 5B0GA 3X1LB 2JZ5A 3QRQA 2LDIA 1SJQA 2PFFB 4OHVA 5B0EA 3N5FA 2DR9A 1HNIB 1UZHA 4LVOP 5AXKA 3T5JA 5MAOA 5HLFA 3JXOA 3MM5A 2HLUA 3FBEA 3ZO7A 1RTIA 3LTOA 3MR6A 3W63A 1HKAA 3UD4P 5LT5A 2GW8A 3MOJB 4KHRA 4USJC 4DR6F 1FJGF 5AJ3J 2XMAA 1UW9A 1O0PA 1WSVA 4I6AA 2OPQA 4O44B 1PBAA 4AFFA 3GJSB 3UO0A 1VBKA 3RW6A 3HI9A 4UTGA 3I5CA 3GYGA 1RT1A 2F9DA 2AD9A 2QJ3A 3KNGA 2J6SA 2G1HA 1Q8BA 1X9SA 3P49B 4QZVB 3MOZA 4J9RA 2OH2A 2X3GA 3K8WA 2ERRA 2VA3A 4DX8H 1SVDA 2QYCA 5HROB 2LDYA 1N6QA 2MHNA 4OJ3A 1S6OA 3HHKA 2YKPA 3MXHP 3POTB 1TK5A 3C16A 4LF9J 2IM3A 4YHHF 3N9UC 3MM9A 2MZTA 5U47A 4QYZJ 4NXMJ 3BN4A 2KT5A 1SC3B 2B9EA 3VVUA 1VLYA 1H2UX 5LSRA 3Q8UA 4Z7YA 1HQUB 2J6TA 1DTTB 2FLPA 5DJBA 3P6YC 2Z2MA 5J1EA 3QO9A 1IR2A 1DTQA 4ICLB 2HRTA 3I82A 4OZ0A 2BANB 4ZPTR 4HHUA 4HTJA 4OI1A 1KN6A 2DPIA 3GPAA 3K5PA 1FDBA 5BJRA 2XHCA 1RKJA 3IR6B 3J7YI 2KI2A 1NAQA 4PXEA 3WDOA 5IV3A 2E5HA 2D3UA 3NWGA 2B9XA 4MH8A 3CT9A 1AT1B 4DV1J 4HDGA 4GMKA 2CQCA 4J37A 3RG6A 5DQIA 3HVRA 5A2QU 4MYUA 2VU5A 1N5YA 3JTPA 3Q8YA 2DHGA 4P2MA 2CPJA 3R27A 2EFQA 1R8BA 3LQVA 3WHIA 4K0KF 2M8HA 4KY3A 1HBOA 1CJUA 2MQNA 2HAFA 2XMTA 1BQNA 1RXOB 2PD1A 3KLGA 1JLAA 3R5BA 4G3IA 3BYPA 5H9EJ 3OTDA 2VHGA 5ETTA 3SDEB 4ID8A 3PY8A 3PX0A 1KEKA 5J2PA 2PEHA 3D1OA 2HHPA 5KFMA 2CDRB 1XMOJ 2POKA 1ZETA 2CPIA 4ZITA 4C8MA 4FS1A 1QD1A 5HO4A 1MSWD 2C1EB 4LRCA 1S1VA 2PGCA 1WORA 4QOTA 4B3TF 3K58A 3T1HF 2VV5A 1UP1A 4X4TA 4WFBQ 1MMDA 3VALA 4XPEA 1FXRA 2F3JA 3KOAA 3DLKA 2V2VA 3CW2C 5JVGQ 1HHTP 2WRMA 3LANA 5T7LA 2HMIB 3G6ES 2M88A 2DNOA 3S7RA 1VISA 1PAUB 1B0TA 2CQ4A 3EZUA 1M5VC 3TAMB 1MU2B 1UL3A 2CJQA 2YPYA 3CC2S 1RKIA 4ELUA 1L3TA 4DWIA 4RW9A 2AJ2A 1DURA 1NHKL 2OFGX 5ETVA 3RRGA 1S76D 3OSNA 5K14B 3CCUS 4DUZJ 2IBOA 3TNVA 2XZWA 5F3TA 4A8MP 2HBRB 1S77D 2XO6A 2CQHA 2DNRA 2ZJQQ 3CO0P 3GJRB 4LF6F 1GMWA 1N5QA 4QWEA 3OPKA 4PCQA 5FIIA 3NMAA 2CA9A 1FD8A 5B08A 3AJ1A 4CP5A 2KJVA 3MMBB 2YNIB 2XSFA 5E2QA 3NGSA 3BBBA 2XLIA 1AFIA 1SCJB 2OPPA 2QA1A 1AA1B 4WU2A 2BJ9A 5ETNA 4DV7J 3J7ZT 3CCVS 4PZVA 3W62A 4YOEA 3J81U 1IKWB 1HPZA 2FZKB 5JJBA 2HIQA 1V3RA 4K59A 2Z58B 1N54B 2HYIB 2KU7A 4JI5J 1IQZA 3DRRB 1T9YA 2R3VA 1X4BA 3N01A 2HKEA 1SJFA 1S57A 2AJ1A 1P9YA 5B7WA 1K44A 4EK2A 3M8YA 2R7XA 5GAEU 4A8YA 4G6VB 3IFEA 3KLIB 2LQ8A 2DTJA 1U02A 4HH1A 1PC4A 2DGOA 1RTHB 3MI7X 2WVBA 3KHLA 5D0RA 2C22A 3NNCA 1JXLA 1HHSA 3BKTA 2CKWA 2CJBA 1BWEA 2XHWA 2IAJB 2DXFA 1LEOA 5EWGA 3A3PB 5G0RB 1T05B 1PYOB 2WVDA 1SJ3P 3PJWA 2X1FA 1CJKA 1XR6A 2HHVA 3N28A 3RBDA 2LMIA 1IBKF 3DMJB 1OY9A 2VQEJ 3M2VA 2JLGA 1BXNA 4Y2AA 2DIVA 1NSQA 1RT6B 1Y5NB 4JV1A 1PCAA 2GVDA 2NYIA 5C25B 1I6JA 2ZH4A 1ZTWA 1R0CB 3D1QA 4I68A 2XEXA 4P72A 2Q3PA 3SV4A 1TAUA 4WKYA 4R0JA 4FYVB 3A4TA 4DQSA 2C2KB 2M70A 4ED6A 2ASDA 3KWMA 3PIPQ 2MZSA 4GO5X 2O3DA 4OYBA 5ADZA 3HKZD 4L75A 2DNQA 1RBAA 1R8CA 2P6TA 3TQEA 4K4YA 4DUTA 4J9MA 4N41A 1T9UA 1Q8IA 2R8HA 1B7YB 4K2XA 4QYZK 2HGMA 3A8EA 5DQHA 4B9NA 2XZDB 2AZ3A 4DPOA 1GX5A 2ZKUA 2BKNA 3MEKA 1FFSB 1HWLA 1TR0A 3QSIA 4UUWA 5DG8A 3H4BA 4WJBA 1AXQA 1SBRA 4LBPA 4NI2B 1XNQF 3CCLS 3R7BB 2D69A 5F41A 4HT7A 4C3MA 1X8DA 2EKNA 1R6YA 2QGFB 1MROB 2YPZA 2AKWB 1JK9B 4LRFA 3I32A 4CLLA 2UUCJ 4IRKA 1YVFA 4IG3B 4F36A 3BQ1A 3MR7A 4RL1A 4ZVHA 2VG7B 2G0IA 2MJUA 3QRPA 4QQBA 1R0BG 3MD1A 3D6TB 3QBCA 4P52A 4YB1P 1UWBB 2BA9A 3TAQA 5EWEA 2YWFA 1EX8A 2KFNA 3CWJA 1HQEB 5J1PA 1K1QA 1D9FA 2HVDA 3I4PA 2GJ2A 2C3YA 5HL7Q 1NDKA 2I8EA 2XWYA 2V8DA 1VQ4S 3M9NB 3KLVA 5H9EK 1JNRB 1M1KT 4RW8B 4RNFA 1T9VA 1Q7LB 1H6KX 3TUIC 3RUBL 4XK8C 1VGYA 2PSZA 3EYZA 4S0MA 8RUCA 1TL1B 2FUG9 1ULRA 2Y1JA 2DVIA 2HNYB 2ZHBA 1IJEB 4I2QA 3FRYA 2J9DE 3I0RB 1N56A 4OYMA 1HARA 1U8WA 3G8QA 4ZCKA 3SSRA 1HNZJ 2JWNA 1U1MA 2VFTA 5L1IA 5IT0A 4K5SA 1KLMA 1EIYB 3FSIA 5J2MB 2VC0A 2ZNYA 4NLYA 1T8EA 4PRFA 3A13A 3C46A 3WC0A 1HLWA 1KD1T 2VPWB 3HHNB 3W8PA 3HZGA 1SQGA 1NCLA 4JYAJ 1WG1A 4I64A 4G1QA 3EICA 5C42B 5EHHA 2R2TA 1MWZA 1TL3A 3W7BA 3TANA 1SI9A 2QFJA 1GFWB 4OYZA 3HSGA 4P75A 2CNNB 1RB0A 5CYMB 3V4IA 1WHXA 5GAHI 2OSQA 4AE5A 2IIHA 5J2QA 2XLJA 2EFVA 3O8WA 4DR3J 2ZVSA 3CJ4A 3IN5A 1FWKA 3CE8A 2ZOMA 5CHCB 2PC6A 2CQ0A 4C97A 5AXNA 2ATCB 1ZBTA 3KJVB 4YS2A 1TK0A 4B17A 2VPZB 2DITA 3GIRA 2K1RB 5IWAJ 4OZ3A 2LU1A 2MGZB 2GCFA 2CAJA 1HBUA 2XI3A 1RHUB 4QIEA 4ZJLA 2EFOA 5HN0A 1JLEA 3KJNB 2NQPA 3MMAB 1B64A 2AX1A 1FE4A 2FHKA 4Z37A 2J0SD 2W9AA 1RADB 3SCIE 1HNXF 3I87A 3DNCA 3BQ0A 3ILOA 3H5XA 5J2NA 3MPUB 1JLGA 2FTRA 1Q81T 1NSPA 2VFVA 3QGIA 4LT6A 2GJIA 3AJDA 4NLSA 3OFHA 2OMLA 1RT7B 1VS3A 2PE8A 1UA1A 2P5VA 1F2GA 2NUHA 2BEFA 2EBGA 4CCHA 1ZAVA 2PFDA 2MSSA 3QNWB 3NLCA
chains in the Genus database with same CATH topology
1R31A 2BRKA 4OIXA 1U45A 4IOAQ 3QO9B 1WTFA 3H59A 4C4WA 1J2VA 2J8AA 2VBYA 2XS5A 4Y2IA 3F41A 2QE5A 4RUCA 2DPJA 3OL9A 1TVRA 4H4OB 4NLRA 1LW2A 2E29A 4IDKA 1SV5B 3BDEA 4J9KA 3VAIA 1OS5A 1HBMA 3QJJA 2L3MA 2IMWP 1VC0A 3RAXA 3KLEA 1JB0C 5L38A 2ACYA 4D3HA 4OJHA 2N4CA 3SCJE 2GQCA 2CPZA 3CJ2A 2C3UA 2QLWA 3VAMA 4RNMA 1NHVA 2FLOA 2RD5C 3JTOA 4I2PB 1C1BB 3W3SA 1UAWA 4ECQA 2VUGA 3CDEA 1SXLA 1KS2A 4NLGA 3M30B 3V6DA 1VQ7S 1B0PA 5F8HA 4Q45A 2JOQA 3VQTA 1FDNA 1VOMA 2I5JA 3IWLA 3P96A 1OO0B 1WEYA 5GAEI 4A8OA 5D4PA 5KTQA 1YWXA 1WG4A 2HS4A 3DFEA 4X65F 2HFOA 4ERDA 1KTVA 2XO7A 1JKHA 4QYRA 4MIWA 1R3NA 2NR0A 2IYIA 3G6YA 4GC6A 1XC9A 1KLNA 1TV6B 4O44A 4QIVA 3GYXB 2E1CA 2DGQA 3CC4S 2BXJA 4O23A 2LVWA 5A8KB 1PGZA 4HL9A 5F8NA 4CH7A 2GGPB 5KG0A 1RK8A 1NK4A 4NLWA 2L9DA 1R89A 4OZ5A 1H2VZ 1RISA 2CDQA 2LQ5A 2YKNB 3M2RA 1FJEB 1ZZFA 3JB9k 4IQXA 4ZPAA 2KXHA 2O67A 3QGGA 1KQKA 4DR5F 4FP9A 1XMBA 1VBYA 4PG5A 4YDDB 2PIIA 4B9LA 1IXKA 5FLXY 3C6TB 2PMHA 3P3DA 4NCAA 2IJNA 2FC8A 3N6NA 1TQLA 2DK2A 3U02A 4KAIA 2PA8D 2ASJA 2R8KA 4PQAA 4XO0A 2DGTA 2WAQD 2L41A 1N5YB 1MROA 2R2RA 5HBMB 4TU8A 1KR4A 4X4RA 5E3QA 1AFJA 1HI1A 2ZOFA 4MAKA 3HMJG 2DRAA 2XGPA 4ED1A 1URRA 2FJAB 3FEYB 4BCAA 1RP5A 4Q44A 4DLGA 3JSMB 3CCES 1N34F 1U1RA 1PILA 4UUXA 2V8GA 2EI5A 1SL2A 2B4PA 2M7SA 4ZP9A 3T19A 3ZZ0A 1S9GB 2B6AB 1NKCA 2CFXA 2MKSA 3NS6A 4IG3A 4OHYA 2W9BA 3DDKA 7FDRA 3K5NA 3LP2A 2MZJA 5IT9Y 4FYDA 3ITHA 2C3OA 3POTA 2B4VA 2R7UA 3DRSB 3OV7A 5A2QY 4OX7A 4F26A 5L39A 3OL7A 3CVKA 1JLQB 3DGPA 3JTNA 3TA0A 2VG7A 5EX3A 2IRYA 5K8PA 2OTLS 4KKOA 5DGBA 3JYTB 2O1PA 2AW0A 2RU3A 3S6EA 4CTAB 3GIJA 3MM6B 4K4UA 3QWPA 1N5TA 1RAJA 5KG7A 3QZ7A 1F0XA 4U7CA 4NLTA 1HNZF 2F8HA 3FEZA 1WI6A 4X4SA 3DXSX 4DSLA 1UWBA 4KBIA 4DL7A 1LFWA 4IFVB 4FXDA 2NS1B 3GR1A 1TFYA 3W2WA 3J7Z5 2OD4A 4IH7A 3FZ2A 5SUHA 4RBUA 5KFJA 2ZH3A 4LF7F 1HQEA 1HWIA 2E5GA 4QPXA 2FHMA 2YH0A 3BGUA 1HQUA 4O3RA 3RRHA 3SEOA 3ISND 2NSBA 3AB4B 4L72B 3LUYA 2HFZA 4DV2F 4RWXA 4ZA1A 3NMRA 2C42A 1DQ9A 1LK5A 1BQMA 1FDAA 1U7LA 2HLTA 3DYAA 3N6MA 4FPRA 4EUVA 3PV8A 4YFUA 4C0OC 4P6QA 2RSQA 4Y6IA 2XGQA 1FRLA 2C2DA 1YIJS 1RYRA 4TLRA 1YRTA 4E98A 4X62F 2CZ4A 3BSNA 3NCPA 1HBNB 5KFNA 3TI0A 1Q86T 3C3LA 5KG3A 1TKDA 2OMOA 4JYAF 3M6WA 5DLFA 1C0UA 2V9WA 2BANA 4RW8A 4TY9A 3UNGC 4MK8A 4FF1A 1IKYA 4RW6B 2AYMA 4RLEA 1Y3JA 4JI1F 4YR3A 3V81B 5DGAA 1FDDA 4Q43A 3NKYA 3GIKA 3TVKA 3B82A 3MFHA 3H4DA 4PWDB 1S1WA 1UJ4A 3DLJA 3BO2A 4XIUA 4ECYA 1JMTA 1YI2S 2YNFB 5E3RA 1F9FA 4QU6A 2GFFA 2FD2A 4USHA 3H40A 1WNEA 5T7LB 4J9SA 1SIZA 3ZZYA 3RAMA 3TW0A 4GC7A 4DSFA 1N88A 1MNEA 1V3ZA 2HNYA 4N8OA 4Y2KA 1L3UA 4ZK7M 4MIBA 1S0OA 5F0UA 4ZPWR 3BF4A 1L5UA 2CQDA 2KKHA 4DR3F 1S7HA 3CO9A 3QMQA 4PG6A 1VRUA 3PKYA 3RW7A 3GFHA 4RW7B 5E5NA 2Q66A 1WHWA 3Q8PB 4M63A 2FY1A 1EETA 1Y7PA 2HFNA 1IJFB 2VG5B 2Z0GA 4JUZA 4N56A 1C4CA 1UVNA 3EGNA 3G9CA 2GIQA 1HWUA 2VL1A 3H5YA 2XCAA 4RU2A 4ZHRB 3AA9A 3CTRA 3TA1A 2UUBF 4Y2CA 3PX4A 1U2FA 3S1TA 3ZZPA 4DOZA 4PQUB 1VHFA 2MZ1A 1QY7A 5IS2A 2O66A 3HHDA 4IFYA 1E6VB 3PRBA 1O8BA 5DDRC 5IWAF 1K0VA 3U27A 4ECVA 4DSJA 1BY9A 1U6FA 3IRXB 1NEEA 2P9CA 1X9WA 4Y2MA 4FXWA 5D3GB 2F8EX 2KJWA 2KRBA 4DFMA 3BN7A 3M9OB 4RNHA 3Q24A 2MKHA 1DBDA 4TU7A 2UVWA 2DT9A 5FDLB 1NRKA 2YX4A 3OXGA 1FTRA 1RT2B 3THTA 5C42A 4DUYF 1WF0A 3GG1A 3K7RA 5CZXA 3G8TA 2VQFF 5I3QA 2KT2A 3I9ZA 5BYQA 2X1AA 2AGQA 3H5UA 5L1LA 5KFUA 2RNEA 2HW3A 2QZ8A 3Q8RB 2IVMA 2YWEA 3MD3A 3RR7A 4LFCF 4NZ7A 1XWLA 4N47A 3AA8A 3ONQA 1JJ4A 2HRYA 2R4FA 5ITHA 4RU9A 2MY8A 3QGPA 2KXNB 2ZD1B 2U1AA 1JLBA 1S72S 3NAIA 3H2LA 3OTBA 2PO4A 1G2EA 4K4WA 1X4GA 4KR0B 1YITS 3PEHA 1MWYA 1U2RA 1DAXA 2XMKA 3IC1A 4YQWA 1WELA 1AUDA 3QIDA 3GZ7A 2CQPA 1S6QB 1YG0A 2HHXA 4ES3A 1VC6A 2DHSA 4X4OA 4LSLB 5F9NA 5LSLA 1RTJA 2CG4A 2P9EA 2WSFC 3VAGA 3IWXA 3KK2B 1FKOA 4IKAA 2GMLA 3CCRS 3CD5A 4DR7F 4KSEB 1WF1A 2JHEA 1S6UA 5T14A 1U6BA 2NSCA 4QCLA 2BDPA 2KZZA 1QM9A 1N5VA 3OUYB 1FRJA 3M8QB 5DRKA 2ZZNA 4F4WA 3BM7A 3OR2B 3TVYA 1NK6A 3KJVA 1WHVA 2FVPA 4ECTA 2VOOA 3QPIA 1TP7A 1TKXA 2VPYB 4WE1A 2EPIA 1C1CA 1F60B 2V4JA 2QA4S 2K1RA 2B56A 4GO7X 2MGZA 4K4SA 4RUAA 2B5JB 3WX4A 3CJ3A 4WXOA 1LWCB 1FE0A 4OJ1A 1HFEL 4DEZA 2RS2A 1ZM9A 1FA0A 3GSDA 3I5BA 2CQBA 4O3OA 2RQCA 2OIHA 2Q6CA 3TRGA 2Q43A 4ALZA 4CNZA 3R5AA 1TKTB 1R8AA 2QO3A 2M4MA 2RQKA 3IR7B 1VQSA 1FD2A 2CQ3A 5I4MA 2RF2A 3MMAA 1NB7A 2JFKA 1Y0HA 1KSPA 2ZUGA 1PO6A 2FPHX 5I3PA 2XLKA 2V94A 3LGNA 3OTEA 1G3OA 3JSRA 3V6HA 1T02A 5FJ4A 4ZCIA 3J81Y 4QBUA 2V4RA 2I9SA 4HKQA 2MKJA 3HM9A 5KFVA 2XSJA 4RNNA 5K9FA 3HHLA 3M8SA 1HW8A 1P1LA 2RT3A 4EZ9A 4ZCMA 5IM0B 2HHWA 3BSCA 5I42B 1FXDA 5A0YA 1S6PA 1U8SA 4CO3A 2HGNA 1M5PC 1HYSB 2AU0A 3AQPA 2A2CA 4DQPA 1XTZA 3MGJA 5LL6d 2AJ0A 3GWCA 2BVZA 4P7VA 1SKSA 3LAKA 3X3UA 2KB2A 5KG2A 4ED5A 2EVZA 2ZKTA