2LEBA

Solution structure of human srsf2 (sc35) rrm in complex with 5'-uccagu-3'
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords Serine/arginine-rich splicing factor 2
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lebA00
2M8HA 4TU9A 1OPIA 5IM0A 1HD1A 3D2WA 1W2BR 1Q81T 1WI6A 2YKAA 3DXBA 2DGQA 1YWXA 2DHGA 5IFMA 3TO8A 2DB1A 2U2FA 2XNQA 2MZ1A 2ZJQQ 3BO4A 4OZ1A 3THTA 2HYIB 2LQ5A 5GAGU 3Q2SC 2DH7A 3OW2R 5H1SV 3G71S 5D77A 2DGOA 2LXUA 5DDQC 1R8PA 1U6FA 4ZKAA 5DETA 4CH1A 2L9WA 4TU7A 3MURP 3UD4P 2MQLA 1SJ4P 1JJ2R 1K8AT 4UQTA 2MKIA 1X4EA 2Q79A 3BO2A 3LQVA 2M0GB 2CQCA 1SJRA 2DITA 1B7FA 1X4DA 2MHNA 2MY7A 1PGZA 4W90B 2MQPA 3NS5A 2KRRA 2DIVA 2GHPA 5DM7Q 3P6YC 2LMIA 2RRBA 1WF0A 3PIOQ 5DM6Q 2MMYA 2AYEA 2DNQA 2M9KA 2M88A 2DH9A 2DH8A 3U1MA 1WHYA 2F9JA 2N7CA 2HZCA 1X4GA 3VAJA 1VBYA 3S7RA 4UY8T 2DNRA 4FXWA 2KH9A 3P3DA 1UFWA 2OSRA 3CC2S 1JJHA 1A9NB 2XSFA 2VONA 5LJ5Y 4LIRA 4EGLA 2PEHA 1PO6A 2AYBA 2KN4A 2YH0A 3ZZZA 2FC8A 4F26A 4IUFA 2MKSA 1A7GE 2E5JA 2UP1A 1WF2A 3J7YU 1VQLS 3VAFA 2XS5A 2X1AA 1P27B 2AYMA 3H2UB 2MKJA 3P49B 2CPFA 1X5OA 2KRBA 2LECA 1FJCA 1P1TA 1QM9A 2CQIA 4V19X 1M1KT 5D78A 2AYGA 3J7ZT 2E44A 2KM8C 1L3KA 4F25A 1H2TZ 3UCZP 1WEXA 3MOJB 3PIPQ 2V94A 1NU4A 3B4DA 1SJQA 2RQ4A 1SXLA 2JVOA 2N3OA 2CQPA 1SJFA 1HL6A 2MJNA 3FEXB 2QFJA 5BJRA 2DNYA 2FPHX 2DNZA 5GMKa 2M52A 1U1PA 1JMTA 2DHSA 3TP2A 3VAHA 2XS2A 2F9DA 1D8ZA 3UCUP 1KOOA 1FO1A 2HVZA 3CC7S 2L08A 4QU6A 1H6KX 2ZJRQ 3HHNB 4IO9Q 2DNPA 3JB9k 1YTYA 1R8HA 4YUDA 4W92B 2M70A 5GAEU 3CCJS 2DGUA 2MB0B 1Q82T 1N8RT 2FY1A 3S8SA 4A8XA 4WF9Q 3P5TL 2LKZA 5MLCV 2CJKA 2KI2A 1WEZA 2U1AA 2M4MA 1YITS 1X5SA 2DGXA 5LXYA 1YJ9S 2M2BA 1VC0A 1WHWA 1N52B 2DHAA 3SDEB 2D3OR 1VQNS 2DHXA 2LA4A 3G8SA 5FJ4A 4IOAQ 2OTLS 1ZZNA 2JVRA 2CQHA 3BEGB 2EK6A 3G6ES 1VQ6S 3MUMP 1N54B 3SXLA 5IM0B 3CMAS 5IQQA 1VC6A 2J0SD 3ULHA 2XS7A 4Y00A 3EGZA 1YI2S 1WG5A 5CA5A 4PR6A 2MGZB 2M8DB 4LMZA 1U2FA 2DGWA 2CPHA 4ERDA 2KXHA 1KQSR 1S79A 4J5OA 2M7SA 3MD3A 2MZTA 3CCQS 1ZH5A 1G2EA 2X1GA 2D9OA 2DGSA 2QA4S 1OWXA 1VQ5S 2ADCA 3NS6A 2X1BA 2YTCA 2PE8A 1X4BA 3EX7B 1WTBA 5CYJA 3G96A 1M5KC 2CPJA 2E5IA 1UP1A 1U1OA 1NJIT 2MQQA 2HGLA 2JRSA 4ED5A 1H2VZ 1XN9A 3UE2A 2DNLA 4C4WA 2XB2D 1HD0A 2GO9A 4WFNQ 2RU3A 2FC9A 1HA1A 1NO8A 3MD1A 4C7QA 5HL7Q 4WFAQ 2DIUA 1WF1A 2CQ3A 3CCLS 1FXLA 1O0PA 4Y0FA 2CPDA 1U1MA 2MZRA 4CH0S 4PKDB 3TYTA 2CPYA 2HGMA 1WG1A 2A3JA 3MDFA 1WI8A 1VQOS 3MI7X 2KYXA 3G8TA 3CCUS 1QVGR 3VF0B 3CCES 1WHXA 2DNHA 2CQ1A 3US5A 1WG4A 2RQCA 2FHOB 5EN1A 2RS8A 3VAGA 1VQPS 2LA6A 3Q2TC 2E5GA 2KT5A 2MKKA 2JWNA 2O3DA 2CQDA 2MZJA 1X4FA 3CF5Q 1YJWS 1RKJA 2DISA 2OIHA 3SMZA 1WEYA 5GAHU 1WWHA 2N3LA 2KG0A 2VOPA 2OTJS 3G4SS 1VQKS 2I2YA 1IQTA 2CPZA 3MXHP 2CQ0A 1RK8A 2B0GA 1KOHA 3RW6A 1UAWA 3S6EA 2CQGA 1X4CA 1YIJS 4CQ1A 3CMES 1FHTA 1K9MT 2LEBA 1VQ9S 2DNKA 1N88A 1WHVA 3U1LA 2J0QD 3FEYB 3H2VE 2XNRA 2NZ4A 2LXIA 2DNMA 2MXYA 2DGVA 1DHMA 3LPYA 2MJUA 3CUNA 1D9AA 2VODA 4TU8A 2D9PA 1U1QA 2CPIA 2L41A 1U1KA 5DDRC 2KU7A 3MUTP 2SXLA 3NNCA 5JVGQ 4PRFA 3EGNA 2KG1A 1F9FA 1QVFR 2J76E 4WKRA 2LEAA 1BY9A 1OIAA 3I55S 2JX2A 1X4AA 1VBZA 2WBRA 1UW4A 1M5OC 2LCWA 2K3KA 1JJ4A 5GVQA 4YB1P 1FJ7A 2MPUA 3NNHA 2NLWA 3MUVP 2EVZA 2F3JA 5LSOA 5JVHQ 2DO4A 1VQ8S 2CQBA 2KVIA 2MQMA 3R1HA 3VAMA 1URNA 1U1LA 1U6BA 1VQMS 1CVJA 3NMRA 2DNOA 5GADU 2CQ2A 5LSLA 2YWKA 1SJ3P 2RNEA 3B4MA 5HO4A 1X0FA 2I38A 5ITHA 2RRAA 2LYVA 2G4BA 2EK1A 5CXTA 1YHQS 3IWNC 4Z2XA 2CPEA 2KM8B 3ZZYA 1VQ7S 4WFBQ 2ERRA 3K0JA 2BZ2A 2KXNB 1VBXA 1M5VC 2X1FA 4M5DB 3N9UC 3HI9A 1K73T 3DLLQ 3NNAA 4P6QA 4F02A 2CPXA 3CPWR 5DDPC 1OO0B 2MQNA 3THPA 4QQBA 3UD3P 2DNNA 3RW7A 2MSSA 3CC4S 1X5TA 1DZ5A 3CCSS 3IRWP 4U67Q 2OJ3A 4YOEA 1VQ4S 2KXFA 5DDOC 4C0OC 4RU2A 2ZJPQ 3BS9A 1Q7YT 3CULA 2ADBA 3I56S 1Q86T 1KD1T 1U1RA 1KC8T 4FXVA 2MSTA 5LJ3Y 4WCEQ 2KFYA 3R1LA 2KHCA 2DO0A 3CCRS 2MQOA 2RS2A 3CCVS 2RUGA 1X4HA 3G9CA 4WIIA 3V4MA 1DBDA 2CQ4A 3CXCR 1FJEB 2E5HA 2YH1A 2G0CA 3S01A 2MKHA 2RVJA 2MGZA 1M5PC 1YJNS 3UWTA 3CCMS 2N82B 1H2UX 2DNGA 3CD6S 3VAKA 2BOPA 4QU7A 1X5PA 1FNXH 2QEXS 4TLQA 3VAIA 2MYFA 1FT8A 1ZZFA 2K8GA 4BS2A 2RT3A 1M90T 1AUDA 3SDEA 1S72S 4CIOA 2MY8A 2DK2A 3BO3A 1DRZA 3CTRA 4LJMA 4QPTA 2VOOA 2MZQA 4IOCQ 4OZ0A 2HGNA 5LXRA 3UCGA 2G1DA 2J8AA 3VALA 2AD9A 1VC5A 2DGTA 1U1NA 2OSQA 3R27A 2MZSA 3L3CA 1WELA 2MKCA
chains in the Genus database with same CATH superfamily
2M8HA 1OPIA 2QSFA 1FESA 3FZ2A 4UZBA 4ELTA 1R0CB 3W2WA 2BA9A 1U26A 1FRIA 2I5JA 1E6VA 2M3DA 2MQ8A 3CSKA 3DLEA 3NCQA 1HW9A 1BQMB 3SQOP 4IFVB 3SBMA 4ZDNA 3MECA 4MK8A 4KHPJ 1RHQB 1U2RA 1J5OB 4B17A 3LWLA 2ZJQQ 1SCJB 1S1XB 2C2KB 2Z2LA 4CYUB 3P8BB 1QUPA 1TVRB 2LQ5A 3MECB 2XYPB 2ZBIA 3EZUA 4PG4A 3VGTA 1MN7A 5HMWA 5IV3A 1Y11A 2IPOB 5H1SV 5D77A 1UTAA 4RNHA 1RCXB 1YG0A 1LWCB 3MPDA 3SZ2A 1EZZB 5KG0A 1VS3A 4CH1A 3FRZA 3Q8YA 1RHMB 1WD6A 3X1LB 3BSNA 3SCIE 2MQLA 1SJ4P 4OHVA 4UQTA 2CJ9A 2OMLA 3GTYX 4LF9J 1RWNB 3DRSB 6FD1A 1N36J 4IRDA 3GYNA 3RJMB 4CLSA 1N32F 2OKQA 3UNGC 4NRTA 4C3MA 3BO2A 2ZFHA 1UVIA 1AZSA 3R7NB 3EJMA 4UW2A 2WONB 5I42A 2RDDA 4BDPA 2DITA 3H5UA 4DPYA 2XZWA 3GWCA 4OI6A 1H38A 4K4ZA 4OLPA 3B8HA 4RBUA 3KK3B 1PGZA 2UUCF 1B0PA 3B54A 4QCLA 4W90B 3AA9A 1HNXF 3MM9B 2E1PA 3FEZA 3Q8SB 3PVXA 4JI0J 3B78A 1P9QC 4JI5F 5T7LA 3D1QA 2LMIA 3EE3A 2RRBA 2AP6A 1OQ6A 1C0UB 3B6BA 3RB0A 4ZPCA 3KUHA 3T5LA 5ETKA 3M2UB 3PZPA 2MMYA 3UN2A 1JKHB 3CWJA 3HHEA 3MWBA 2DNQA 5IT9U 1WKKA 4CLZA 1NKBA 1WHYA 4ZP9A 4U95A 4WE1A 4CLLA 3VAJA 2EW9A 1W2IA 1T9WA 3DOMB 2KJVA 1Z2ZA 2B9XA 4UT4A 1MSWD 2V4JB 3S7RA 4MK9A 5T7LB 5JUMA 2PGCA 1JNRB 2EWHA 3P3DA 4EYHB 5G0RA 4ZHRB 3NP5A 1D9FA 1XNQF 3E01B 3MR3A 2VDIA 3CJ5A 1YRXA 2YKNB 3CC2S 4ZPTR 3CVKA 2F8MA 1SIZA 1A9NB 4R5PA 4UOFA 2VONA 1O5JA 2AQ4A 2Z4PA 4EGLA 4AE5A 1WTFA 2CAJA 4NYPA 4ZCLA 1LNQA 3KLFA 1RISA 2ZOFA 4LSNB 4LR8A 3W2VB 2ROEA 4H4MA 5HSPA 5LSRA 3R5JB 2DPJA 1VJWA 4JI6J 4O3SA 2MKSA 3M8RA 3FK4A 2VG7B 1WF2A 2UP1A 3IAM9 4DG1A 5L9XA 1F6TA 4DV0F 4ES3A 1JLBA 3FBFA 2GQ2A 3UQSA 2HQDA 2YBVA 4ZPAA 5FDLB 4A8QA 1M5HA 1TKTB 1P27B 1DLOB 1FXRA 3SV3A 4DS4A 1S0VA 2GJFA 3H2UB 1VRUB 3FSXA 4ECRA 3W5YA 1MN9A 2CPFA 4UUXA 1X5OA 2B4OA 2ZE2A 4WYLA 1PYOB 2DY1A 4KGVB 2PO4A 1RTIB 1Q78A 3HVTB 1B7YB 2CQIA 1IBLF 2QE5A 4OYBA 2VASA 2B9WA 1S1WB 5IXUA 1L3KA 3CD5A 4FYYB 1J5OA 2YNIA 2AJFE 1NMEB 5C25A 3CB4A 4B3OA 2AMCB 2V94A 1HQEA 1WOPA 4K2JA 5CABA 4X4TA 2RQ4A 3GIIA 1F0XA 4EZ9A 4F04B 2F4FA 5KFZA 1L3SA 5KFWA 1EAYC 1B70B 1S1VB 3FEXB 3MM7B 4M5KA 3I5AA 3K89A 2P2CB 4MIAA 4X62F 1LEOA 4DV7F 2DHSA 3TP2A 4BLGA 4CNYA 3VAHA 2VG5A 2UUAF 4JI3J 3UCUP 3TA2A 4TQSA 1B99A 3DGPB 1QSYA 4ID8A 2OHDA 4I64A 3MM6B 2WBMA 3UI3A 4C0BA 1I6JA 1XJWB 1M5SA 4H4KA 2HVZA 4NLOA 4K4YA 3CC7S 3O6QA 2HFSA 2YVSA 4I7FA 1S6UA 2PMWA 4X4PA 1H6KX 2QLWA 3R5DA 4A8YA 2PMHA 1LK5A 2RH3A 3N6NA 4CO2A 3FSIA 3FDSA 4J9SA 2L9DA 2RUSA 3TVYA 1DFDA 4YUDA 2FQQB 4O4GA 2HQCA 4WJBA 1D0EA 1NHKL 2BM0A 3H5XA 3FMWA 5E3RA 5CD4A 5H9EJ 1HFEL 3W60A 3QSYB 1YJRA 3M32B 3O8WA 3KK1B 4LF6F 5HI7A 2HAFA 3I0RB 2UZAA 5B0BA 1JB0C 4DV5F 1N5TA 1NLKL 4CRJA 1F2GA 3RB4A 1WC5A 2GVZA 4X62J 5B0AA 2GS8A 1V3RA 3MF5A 4OYMA 1DTQA 1FXDA 5D6GA 2YPYA 3KLIB 4A8OA 1T3NA 3UDCA 3HHLA 2R3VA 3ELHA 1EKRA 1FRJA 2NREA 2R7VA 4FYDA 1RQ0A 1T05A 1RT7B 1FX2A 1RU1A 2VPXB 3P5TL 3KLEB 2R7SA 1PBAA 3R6GB 5IC6B 4YP3A 1TV6B 2XGQA 2KO1A 5A8RA 4JI3F 1UZDA 3PW7A 1QE1B 1U0HA 5LXYA 4ICLA 1TVRA 1RLCL 1U47A 3I87A 2V9WA 5J2MA 5HMYA 1GQEA 1VQNS 5KT4A 2CIMA 5FJ4A 1BQXA 4NLYA 2Y1JA 4JI8J 4IOAQ 3GG1A 2XWXA 2EK6A 3G6ES 1F5AA 4RUHA 1SQFA 4ZLNA 1IBMJ 2VJUA 2J6TA 2NPIA 3GCXP 5A8WB 1RSCA 3GV7B 1FERA 2RRNA 2RE1A 2ZBQA 3LALA 3W2WB 5F8LA 5EWFA 3KMSA 3CMAS 4F50A 1VC6A 2XS7A 2O67A 2JEJA 4Y00A 4DN9A 2EFOA 4GVLA 2VHGA 2Y8YA 2M8DB 3AD7C 4LMZA 1WDTA 3PR4A 3I96A 2CPHA 3DRYA 3MTKA 5ETLA 3FQKA 3CJKA 4ZVRB 3RB3A 1AW0A 4J5OA 4PPDA 3RGIA 2E1MC 4X64F 3QJJA 3MD3A 3NAIA 3CCQS 2AJ0A 1G2EA 1AB8A 2WW4A 4KGKA 2X1GA 1SC1B 1NSPA 1XBWA 2IIHA 4PWUA 4Z7YA 4OI1A 2QA4S 4DR3J 3BGRB 5DQIA 4UOGA 1DTTA 2PDAA 2FJWA 4LFBF 2GVDA 1Q4RA 4TN2A 3VZHA 4ANCA 4B3RJ 3L9ZA 3TUIC 4NCGB 1HQUB 2DEIA 2QLXA 1WC3A 2IJFA 3K5NA 3DM2B 5AXLA 5IT0A 4O0IA 2DBBA 1B3TA 1Y5IB 2ZZTA 3VQSA 2R2RA 4JBCA 2ZOMA 2JNJA 1TMMA 1U1OA 4R0JA 2CXEA 3K59A 2HZAA 4NEYA 4NYOA 1XIQA 3W1YC 4ENOA 1IM6A 2MQQA 1N56A 5EGYA 2AGOA 1Y0HA 2YNFA 1XN9A 2PSZA 3OQ2A 2LU2A 1RADB 2DNLA 2NXJA 4UF4A 3ZNUA 4R8UB 3LF0A 2Z2MA 1LWFB 3IRXA 3QIPB 2CWKA 3C16A 1TV6A 2FC9A 2QJ3A 3O44A 1HPZA 1D9DA 3J7A1 3CJSA 4MFBB 4AFFA 2DIUA 2CQ3A 4ECWA 1TAUA 1FXLA 4Y0FA 3SQGB 2R7WA 2OAUA 4FYXB 2R2TA 2YNGB 2ZVSA 4DWIA 1KQGB 2P6TA 3JTPA 1QDUB 4HLBA 2CPYA 3WZ0A 4CO4A 3UR3C 2XCPA 3LWMA 3GU0A 4WFXA 2J7KA 4NA1A 4F4AA 3MMAB 3J80Y 2BQUA 3Q22A 1UWBB 4ZP6A 3KTQA 5I3PA 2ZZNA 4DR2J 2KL8A 3PRDA 2HVIA 3PG9A 3AJDA 2DNHA 3Q89A 5BYRA 4A48A 4MKYA 1WG4A 1RCOB 2J9DA 4KIAA 3TJ8A 3J7AN 4ZP8A 4KR0B 2Q66A 1CQMA 1PCAA 1VIXA 1KNZA 2CADA 3I5BA 4LF4J 3QATA 3VCDA 4DZ6A 3H25A 2OP5A 2E9RX 2LVWA 1DY3A 3POTB 1FA0A 2QMUB 3C6UB 2XC9A 2XTJP 2CUYA 5L1JA 2C3UA 1JXEA 2LU1A 3D6TB 4IG3B 3DXSX 4J90A 4I2QA 2ZEJA 4ECTA 3SMZA 5GAHU 4ED7A 4MTPA 2N3LA 2ZH9A 1HIYA 2WB1D 5MAOA 5IQ6A 1U2CA 1VR6A 4DF4A 2I2YA 1UWAA 3NCRA 2ASLA 4MH8A 1C1BB 3EPGA 3TQ1A 1REVB 2ZD1B 4F4KA 4QYZJ 1KOHA 4DHVA 1UAWA 1SKWA 1YIJS 4L6V3 1VMBA 1WKLA 3C15A 3ENWA 3G82B 3F41A 5HK4A 1FHTA 1Q8KA 4Y2KA 1K9MT 3OHAA 2NCKL 1ZPVA 3IR7B 4OZLA 5CCMA 3H4BA 3U1LA 1A6LA 3MCNA 3OD2A 3VZIA 2J0QD 3GB0A 4CDIA 3GSDA 3RRGA 3VWSA 3H2VE 4J7CA 2QMWA 3C66A 4C11A 1FD2A 4DI6A 3HHDA 2HAIA 1CJKB 2OPPB 3D6FB 4ZJQA 4F67A 2MXYA 3GJTB 1MLAA 2OPRB 4USHA 1AFJA 3H20A 4ZJOA 3BGFA 5KFXA 3CUNA 4OFZA 2C28A 1T0TV 3HSZA 2OIHA 2GHWA 4X2BA 3LUYA 1QJHA 3HKZD 2E5LF 5LM7E 3JS9A 5J2QA 3I0RA 5F8HA 3Q24A 1FI4A 3GIKA 2DCUB 2F7VA 1TL4A 4RW8A 4NMXA 1S6QB 4ZCIA 4H4MB 3W5XA 2M5YA 4QYZK 4LSNA 3I82A 1YZ7A 3KG1A 2LEAA 5LL6d 1FTRA 4BC7A 1KLNA 3N0VA 3Q8VA 2HW3A 1VBZA 3JSBA 2WBRA 3G6XA 1UW4A 4KKOA 1JLQB 1S6PB 2LEPA 2CZ4A 2K3KA 2P6SA 4GC7A 3OHBA 2YKNA 4FBTA 3QJLA 5HMXA 4AXIA 4CO5A 4ANEA 1FDAA 2NLWA 4X4RA 3KWMA 3TNVA 2F3JA 1MWYA 2HK3A 3F44A 4LRFA 1E6YB 1CJKA 1HWLA 3R5CA 3OVSA 3VAMA 1RI7A 1LW2B 3UO0A 2ZH6A 1LWFA 1F9EB 4MMOA 1FFSB 3V2UC 2Y9HA 3HD2A 4YR3A 2QA2A 3LW5C 4NLDA 2A6OA 3TUPA 4OI0A 2QSWA 2CNNB 2HNYB 1OMSA 2YWKA 4X65F 1PYSB 4YDXA 3HD1A 3B4MA 3A3PB 5HO4A 3SSRA 4XTTA 4ZVHA 3G6VA 2I38A 2LYVA 3GG0A 4RO0A 4FVCA 2Y1RI 1KR4A 3SIPB 4B3MJ 4IR9A 3KJQB 3J81U 2IA0A 3J81j 5L1KA 2XCAA 2G0JA 2ZVIA 1HR0J 1DURA 2CPEA 3ZZYA 2FVRA 2XMVA 4LF8J 5J2NA 1REVA 2H3EB 2ZD1A 2R8KA 4F8RA 4NXNF 4U96A 1XWLA 2ERRA 3K0JA 1HNVB 3QZ7A 2AEJA 3C6TB 3C3LA 4ED6A 3CO9A 4ZVGA 2KXNB 1S6OA 4OJGA 3ZZPA 3W3SA 3NNAA 4P6QA 5KFMA 1PJ7A 1T9XA 2HNYA 2CPXA 2OH2A 3CPWR 2B6AB 2HHUA 2FTRA 2D1CA 1NK8A 4RNMA 5EX0A 2MQNA 1K44A 3I32A 1ZYQA 3THPA 4WKYA 1AXQA 3D0HE 2PI4A 3AD8C 1YJ7A 3FNNA 4P7TA 3IC1A 4EMDA 3CC4S 3FBEA 3GR1A 2HQ3A 3DMJB 5KFLA 3IRWP 4TY9A 1R3NA 5DDOC 1FWLA 5F8GA 1TELA 3KLFB 1JLGB 2C2MB 3QAUA 1Q82T 2A2DA 3A8KA 1S99A 2ZC4A 1S6PA 2DTJA 1KC8T 4HH1A 3K5LA 4S0MA 4K5SA 5E7OB 2MSTA 2CDRB 5LJ3Y 4NXNJ 1MMDA 3SEOA 4WCEQ 2RJZA 2CVEA 4ICLB 3ZFVA 5BR8F 3CCRS 4ANDA 2K1RA 2MQOA 3OLAA 1SL2A 3ZTPA 4OV1A 3BBFA 2I5JB 3DDIA 3D3BJ 1NKCA 1NDKA 1TL3A 3DI6A 2EFGA 3IRXB 2WSCC 4O23A 2R2SA 1FJEB 1RUSA 2Z30B 2BXJA 4X64J 1PAUB 3PY8A 5CH7B 4J9UE 4KQZA 2W8KA 2ZUAA 4DX8H 3CDBA 5IS2A 2HS3A 3AFGA 2F40A 2KJWA 3KLIA 2R42A 3MM5A 4OJ3A 4PG5A 3SSQA 2HRYA 3JXOA 1K1QA 1NK6A 2AX0A 2HNDB 2RHQB 3QWUA 4FZVA 2QLFB 1YJNS 1EARA 2VG6B 4I69A 5BXIA 4YY3F 3I4PA 4C11B 1HLWA 1NSAA 1H2UX 2VQEF 5KAKA 3VAKA 1RTDB 3PM9A 3D3CJ 4OYAA 4PXEA 1CJUA 1T9UA 3NBPB 4IKAA 5KG2A 5KFEA 5F8JA 1HBMA 1FT8A 1ZZFA 2IVYA 2RT3A 4JI8F 2R8GA 2JLEA 3SDEA 1AUDA 2QL5B 2WONA 4RW7B 2MY8A 4B3SJ 5EHHA 2W9CA 4E8UA 3ILLA 5K8MA 2MZQA 4H4OB 4B3MF 4FKYA 4OZ0A 3DLKB 4U7UD 4IFYB 3BH7B 3OL6A 3JTOA 1Y10A 2G1DA 1TL5A 1LV5A 2V69A 4XPCA 4P75A 2OEMA 3OL9A 1S0NA 1WC4A 2AD9A 2I9SA 2FJVA 4O3RA 2OSQA 5E3CA 1TR0A 4CM2A 5C24B 1TP7A 3R7BB 4DQPA 5HAOA 3L3CA 3MEEA 4DV6F 2UVUA 3H42A 4HI1A 3HT0A 4CLKA 4G1QA 1YBUA 3ILIA 3OTCA 4MIWA 4O0NA 1CVJA 1I5OB 2Y3YA 4X4QA 5J2PA 1RYSA 2PFFB 2CJQA 2DPIA 1N5VA 4FF1A 3DXBA 3EVOA 3QIDA 2F65A 5K9FA 3DKDA 1YWXA 2DHGA 3BN4A 2R7XA 2DB1A 2XNQA 2VZ9A 3V6HA 3THTA 4DLGA 3OJSA 2ALYB 3E8OA 4Q2MA 2OLWA 2ZH4A 2NQPA 1S1WA 3WQPA 4DCPB 5GAGU 1IJEB 1NCLA 5A6WA 4B3TJ 3ADAC 2CDQA 4CLPA 3OW2R 2GCFA 4M5NA 1GX6A 3G71S 1E6VB 2GFFA 4C48A 2B5JB 2LXUA 2Q1LA 2VG6A 3X3UA 5DZ7A 4JYAF 2AKWB 1IR2A 4FPRA 3WBZA 1ITPA 2Q3PA 4ZKAA 2RU9A 4OJHA 3THVA 3ICLA 1RT5B 2ASJA 1R43A 2L9WA 2O5DA 3LP2B 4I0WA 3RBXA 4TU7A 1Q8IA 1KTQA 3FZBA 1CS4B 3V4IB 2IBKA 4NX9A 3AB2B 4WP8A 3K5OA 1X4EA 2QL7B 3CDAA 2XYGB 2NPFA 5KFKA 3MCOA 1WORA 5KFIA 3VGVA 4LF7F 5CD4H 4ILMA 2E1AA 2Y1LB 2BRKA 3IR6B 3KKFA 1TFWA 4KFBA 2VPWB 2CQCA 1X4DA 4DJBA 2MY7A 4PUOA 3DOKB 3O1LA 4Q0BA 5B0FA 2DR6A 4DZDA 2FJXA 2V63A 2HQFA 3D66A 5C2CA 5ETTA 1CJTA 1DQ8A 2DIVA 3AOCA 4M5LA 2WHOA 3ZXWA 3BGLA 3P6YC 2R2UA 4KRWA 2W9BA 4OI3A 4ECVA 5ETOA 1PIEA 3BQ0A 2XWYA 4DV3J 2QC3A 3MM7A 4Q2LA 1Y4ZB 4X84A 2AYEA 1SIWB 1ZBTA 2BJ8A 2W7AA 3WHIA 4K8RA 1Y3KA 2E5LJ 2HWHA 2N7CA 2JC0A 3ENAA 4PWDA 2ZC3A 1KVKA 4M5DA 2G0IA 3WC0A 2FVSA 4DX6A 1VBYA 3IS9A 5A6PA 1HQEB 3IG1A 4IDKB 5DQGA 2Z58B 3C6TA 3IWXA 2C1EB 3TRGA 3M8PB 1I1GA 2EG1A 1Q7LB 2KH9A 5A2QY 4RUBA 1RWPB 4M94A 1YK9A 1NM2A 1YLXA 2OSRA 1VI7A 1GK8A 2ZITA 2IAJA 2ACMA 2EPIA 5A0YB 1JJHA 2FHJD 4WXOA 5LJ5Y 3MCSA 2EFVA 4JI0F 1P9YA 3UFCX 2BE2B 2Z56B 3U02A 1PO6A 4ZK7M 3RYLA 1D09B 3W61A 3ZZZA 3ZZTA 5KG7A 1JK9B 5FLXU 4F26A 1AZSB 2BJ1A 1HMVB 1ROFA 3IG1B 3MMJA 2NYHA 2J6UA 2GJIA 3IMQJ 2RHSB 4G6VB 4J9VA 4JI4J 4TYBA 1R8BA 2PC6A 2NUUG 2XS5A 2X1AA 4IR1A 1UA1A 1EQ0A 1LW2A 2OELA 4DPOA 3HT3A 2PMZD 4GKJJ 3GONA 2Q6CA 3I31A 4GRSA 2UUAJ 3PCOB 2E7WA 2R4FA 4LFAJ 3OJUA 4DV2J 1R0AA 2KDOA 5D8HB 1TFYA 3HHLB 4HHHA 4E98A 2MKYA 1P1TA 2MHEA 5C42A 4RJVA 3OR1B 3QNWB 4JP8A 1TL1A 2CZ9A 2NYIA 1RXOB 2QT7A 3L95X 3N28A 5KFRA 2XY5A 2GAHC 3J7ZT 3DCAA 1JLFB 2PT0A 3OVBA 3ZTQA 2KM8C 3UCZP 2GQCA 1WEXA 1MW7A 2YWHA 2GJ2A 2K7JA 4HYKA 1GT8A 1NPPA 1TL7A 2RKIB 3PEJA 4X66F 2W2MP 3B4DA 1EETA 3D2WA 1S12A 4DV5J 3Q83A 2UVVA 3NGSA 3AQOA 1NK7A 1AUSL 2B3TB 2EFPA 1S9GB 2CQPA 4QJVA 2LDIA 4QR2A 4ALZA 3TAQA 1ZTTA 1NJZA 1J27A 1SJFA 1OY6A 1FWPA 3DU6A 1XK8A 4HVZA 2ZHBA 3H5YA 2PI5A 4OYPA 2M52A 4EO8A 7FD1A 5GMKa 4NI2B 4GMKA 4N47A 3RBZA 4NCAA 3OFFA 1VRTB 5DQHA 4DL2A 4PZVA 4RBTA 5J1EB 2F9DA 1Q5VA 2OFHX 1KOOA 3M8ZA 4A8FA 3SFUA 2W2OP 1CJVA 2OEKA 2UXDJ 2POKA 5T14A 5KFYA 1TUVA 3FSYA 1S9GA 4USIA 1O8BA 3SCLE 3RAQA 1RHJB 2GIQA 1N33F 4G1IA 4CO1A 1EP4A 2F8EX 3R8YA 1RWOB 4YN3B 1RZMA 3IN5A 2XMUA 1KFDA 3OXGA 4Q8EA 1XQIA 3JSYA 3V5RA 1YTYA 2EG2A 4GVBA 4NLXA 3K57A 3K5MA 4U6PA 5LMUF 2VPZB 3BREA 4V19J 1KKHA 3N6LA 1H72C 4LF1A 2DGUA 5CHCB 2R8IA 3GFZA 1M0SA 5FIIA 4X66J 2F1FA 2J6SA 2JZ5A 3IP0A 5AXMA 2Y1IA 2HMIA 4NLPA 2WOMB 3F56A 5L46A 4ED8A 2HHSA 5D4PA 3M05A 4RW4A 1N8RT 3O2IA 3QWPA 4W4MA 3OL8A 1JX4A 2FY1A 3S8SA 1NDPA 2VU5A 3K2YA 3T9ZA 4A8XA 1SPBP 2JH3A 2RQKA 4IG3A 1SL1A 3GV5B 2VIHA 3T1YJ 4IRCA 1TKZB 3HP6A 2LKZA 5MLCV 1IKVB 2BABA 3ILJA 1Q8LA 3BPSP 3POTA 1N5YA 2KI2A 3M30A 2X3DA 1TTHB 1YITS 1BHNA 1SC4B 3ISNC 2ZH2A 1MMLA 3NWGA 4LIWA 3W8GA 2DGXA 2P9EA 5HP1A 4ZIVA 1VLYA 1LFWA 1RB0A 3KG0A 3CCTA 4AXJA 1U02A 4FKXA 3M9MB 1WHWA 1YJ9S 4DR6J 2DHAA 3W9IA 2LXFA 4XPEA 1LK7A 4M5MA 4ED4A 2LA4A 4PABA 4QWEA 1ZZNA 5L1LA 4C3KA 2D41A 4NLRA 2UXBF 3GZ7A 3QGGA 3IA0A 2V8VA 4IFVA 3N5FA 5KFTA 4C6AA 4F36A 5AE1A 3MUMP 1HKAA 2B4VA 3QRRA 2XY6A 1BWEA 2K06A 4ECQA 5IQQA 3NMAA 3BSCA 3ULHA 1NH8A 5CCLA 5JXSA 3QRPA 2V2VA 4RZRA 3KJVA 3ZTSA 4M5GA 4NZ0A 1SVDA 5ETPA 5AT1B 3PW0A 2LQ8A 4ITSA 3EZ5A 3M1VA 3MM5B 1OPZA 1U2FA 2KHDA 1NRKA 3IS9B 3VVTA 4ERDA 2G13A 1YJUA 1F5CA 2GIFA 3M8SA 1SUQB 1PSDA 3CW2C 3OT9A 1M1HA 1S1UA 3IFEA 4I2PB 2IRUA 2ZBCA 4OX9F 4D3GA 3DLJA 4AQYJ 1RYRA 2MZTA 1RT1A 1IKWA 5KFSA 3Q8PB 4ED0A 4LF9F 3P5BP 2Z2ZA 5KOXA 2D9OA 2DGSA 1OWXA 2V8DA 3QO9A 3H40A 2ADCA 4DUTA 2GMJA 1HBOB 3CNQP 1VQSA 4IQXA 2X1BA 2BACA 2HNZB 4Y2MA 4B9VA 3QFWA 5D0EA 1G4CA 4P9SA 2GA7A 4TVAB 1RAJA 4ZPDA 2GX8A 3EX7B 4DXLA 1WTBA 1M5KC 4DR5J 2OPQB 1R89A 2GGPA 5I3QA 4NLWA 4NLGA 1SH3A 4K4SA 2E5IA 3L7PA 1FVSA 4JI2J 1CBKA 3UDVA 2P5VA 3MAQA 4WP9A 1CG2A 1NJIT 2BE9B 3BSAA 2FJAB 1NPRA 1ZM2A 2VBXA 2HGLA 3MCMA 3M2VA 2JRSA 1SB6A 4N8NA 1K0TA 1IKWB 1K47A 1UFKA 5EUHA 4G1PA 3KHRA 2C2EA 5GAEI 4WFNQ 3T41A 1S0MA 2HLUA 2WVDA 4GC6A 1IBKF 1BUXA 3MD1A 3CJKB 2C22A 1HWJA 3KOAA 3EGVA 3CCLS 2UVRA 3M1VB 3UVJA 2RMLA 1AROP 1U1MA 1VCTA 4K5RA 4DV1F 2Z57B 5EWEA 4CH0S 2BE2A 1RWVB 3TR5A 3TYTA 2B51A 3MAHA 4CT8A 4DF8A 3AY0A 4B9TA 1WG1A 5IWAJ 3VHQA 2VJVA 2W8LA 4C9DA 3SCKE 4OYWA 3KLGA 1C2PA 2BJ7A 3VF0B 1FFWB 1B64A 4B02A 4DDFA 3AOAA 4KV8B 2CQ1A 4WP3A 1M1GA 2C3MA 1JXLA 4UTGA 2N7YA 4WK1A 3UDLA 1NSQA 1HHTP 1FNMA 1NJWA 4FXDA 4M5IA 1UJ5A 4R25A 3H4DA 2FUG9 5J2PB 4EFAC 1J5EF 3E51A 2O3DA 3LP0A 4ELVA 1S9EB 4MJKA 1PILA 3QLHA 2WSEC 4M1KA 2MLXA 4QIVA 3CF5Q 4UUWA 1RKJA 1T94A 4ZVPB 3V6KA 1XMBA 4DR1F 2J7WA 3GIJA 1E6YA 1EKSA 3TQEA 5KFGA 2FD2A 3MR6A 2CA9A 4I6WA 4F0KA 4L75A 3KK2B 4ZVQB 2CPZA 1H7XA 3MXHP 4CLUA 2IYGA 1VOMA 1RACB 1OYDA 3QSIA 4RNFA 2CQGA 3LGNA 1FX4A 2XBPA 4CQ1A 2IVFB 1OYEA 3CMES 5E3PA 4GVBB 4FF3A 2ZM6F 3DC2A 5B0GA 2XZTB 3NGUA 3HCXA 2YPZA 2P9CA 4QPXA 1MU2B 4PQAA 2H5EA 1YQHA 4RW8B 1OSCA 3QJPA 1JLEB 1CJUB 1WHVA 2VC1A 3BYPA 4YB5A 4Y34A 4WYWA 4K0KJ 3OVAA 2VUGA 4NA2A 3W66A 4HI2A 2APOA 3D0IE 3AT1B 4W98A 3V4IA 4WTOB 2WSFC 5J1EA 2DNMA 1R6VA 3BN7A 4JV5F 2DGVA 3CGIA 4DV7J 4O3PA 3FGVA 3LPYA 2OPPA 4FYVB 1F9HA 4QWBA 3RU0A 1NJYA 2QFIA 4YHHJ 1D9AA 2VODA 4LSLB 4PEOA 4X4SA 2HHWA 4DV6J 4ETXA 1U1QA 2ZKTA 2L41A 1TKXB 4DUZJ 3LAMA 1LWEB 4AL7A 5DDRC 2KU7A 2BQRA 4C0HA 1XMQJ 1PAEX 3QMQA 1N34F 2YXLA 3EGNA 4OQJA 2Y8WA 1SJ1A 4K50A 3JSMB 2DVIA 4ELUA 1QVFR 3M8WA 3DDKA 1TL7B 1KLMA 2J76E 3G2XA 5C25B 1BD6A 2MLZA 5DG7A 3OR2A 4ID5B 3GFXA 3HSDA 2B7CB 4F7VA 2C3YA 1X4AA 3OSNA 4J37A 1PJ6A 1HNIA 3FCWA 3LTOA 1GMUA 3VVUA 1JJ4A 1HBUB 3FBCA 2KT2A 2BKPA 1RWWB 4OJ1A 3LO3A 3NNHA 3KDNA 2YNHB 4O4RA 2VH7A 2EVZA 5M2PA 1ZTWA 4OIXA 4P72A 2LFVA 5B0DA 3OTOJ 5IC4B 2CQBA 4I2QB 2IC3B 2MQMA 3R1HA 2DY9A 1XR7A 4CCHA 1SH0A 2R7OA 1RT4A 3NMRA 4YQWA 5LMNF 5GADU 4KPCA 1UCNA 4AQYF 3AXKA 3LP0B 4NLSA 2HBZB 2XMAA 5IT9Y 1R7IA 1CQNA 3UW1A 4OYIA 1NSKL 3UN5A 1PYTA 1NDLA 2PIIA 1HMVA 4NL5A 2YX4A 1JLCA 3VAGA 4DLEA 1R27B 1RWUA 2VFVA 4K7QA 1S1TB 3PO4A 2C3PA 2WB4A 4ZLJA 3IWNC 2YKMA 1Y3JA 3N4WA 3C8YA 1RBOB 4KO0A 1AT1B 1HARA 1LQ9A 4OI2A 1HBNB 2OGUA 2KFZA 4LREA 1HR0F 2ZDOA 4YR0A 3HMJG 3Q2TC 3BKTA 5KFNA 5A76A 1MG7A 3MTJA 4DR2F 4KC5A 1UW9A 4DSKA 2VF3A 1VLOA 2BZ2A 3AODA 4P73A 3NEKA 3JAMU 4PG6A 3UVJB 4M5DB 4Y3CA 3Q8QB 1UKUA 3EDRB 4I67A 4PWDB 2V34A 2YQ1A 5KFOA 4DV3F 4F02A 3P96A 1RT3A 4Y65A 5DGBA 4N5SA 1KSPA 1OO0B 1T9VA 3ISZA 5F3TA 3A8EA 2BJ3A 4DS5A 4HT5A 4QQBA 2XMJA 5D15A 1FKOB 4R8UA 2HK2A 3VV2B 1C0UA 5SZTA 3M2VB 3JSRA 4EBDA 4N8OA 1U45A 1D8YA 1X5TA 4YY3J 2V8HA 4NEZA 1DZ5A 1FFGB 2CJXB 2E1RA 3K17A 4PYAA 4CLTA 4U67Q 2P8IA 4WZMA 4QIGA 4RU2A 3MM9A 4C0OC 1QAJA 5DLFA 8ATCB 1GAOA 2AZ1A 1P6TA 3DYAA 3BS9A 1Z2LA 2VKRA 2AYBA 2HZVA 4LT6A 4MK7A 2IRXA 2ADBA 3I56S 1S4FA 1KD1T 3CULA 1U1RA 4J9NA 3NGTA 3NS7B 1KQKA 1S0OA 9RUBA 2Q43A 3R1LA 2KFYA 1BWVA 2XHCA 3MEGB 3CMQA 3UDEA 5BR8J 1Q8BA 3QFHA 3QO9B 2UU9J 1S76D 4BWMA 2B8QA 4QOTA 1YDLA 2RUGA 3DRPA 1LW0B 2E9TA 1HI0P 2CQ4A 2N4CA 1ZAVA 3CT9A 1FD8A 1FE0A 3DRSA 3FUYA 3CXCR 2FVQA 1IVZA 4ED1A 2DXFA 4B9MA 1X9WA 2E5HA 2XI2A 2YH1A 1X0PA 3EXCX 1Q53A 2G0CA 3S01A 1RT5A 2MKHA 2OPRA 2RVJA 3A8IA 2XLIA 1NKEA 1FKPA 3OSPA 2V5HG 2EFQA 3UWTA 2AV5A 5EX3A 1LFPA 5KT7A 1FF2A 2B8PA 1BMQB 1FRKA 4HHUA 5ETMA 5J2NB 3KLHB 3CCMS 1QSSA 1N0UA 1SBRA 1TQLA 2DNGA 3NG8A 2JLGA 1N48A 2V4QA 1KVIA 1X5PA 2QEXS 1CULB 2BEFA 2ATCB 4UOHA 1Y7PA 2JEIA 1XMOF 3VAIA 2MYFA 4P2XA 1VRQC 3NOCA 3T1HJ 4BS2A 3MFIA 1M90T 3HM9A 1IM4A 3TWZA 2DJWA 2QV6A 5J2MB 3C14A 3DRRB 1RDRA 2EKYA 3G82A 1GH8A 2BJDA 4K0KF 3CTRA 3W9HA 1VIOA 4IOCQ 3N79A 3W65A 3EDQB 1JNZB 1GEHA 2RSQA 1WC6A 3TA0A 5LXRA 4G3IA 3UCGA 2W4CA 1IR1A 4U8YA 2J8AA 1IKXB 1RWKB 1RT7A 1VC5A 3D54A 2DGTA 3KJNB 3L7UA 2B43A 3IM9A 3PYFA 3R27A 4HL9A 1U1NA 3GILA 2MZSA 1WELA 3EMTA 4TU9A 4YR2A 1IBLJ 3PYEA 3FMBA 5JJBA 4LF7J 4JV2A 3DOLA 3DLGB 3LP1A 3CDEA 3JQKA 4DN0A 2UV8G 4O44B 1D3WA 1WI6A 4PCQA 3TUJC 3GIMA 1W2BR 1BQNB 3TANA 4KPYA 3ITHB 2ATLA 2BKOA 3ET6B 3OR2B 3TO8A 4PXDA 3BO4A 2JDJA 5I3UA 4CM0A 4ZIWA 2K7KA 3MPVA 4Q43A 4UZCA 4X4OA 3J7YI 1GMWD 2NSCA 3KHGA 2HYIB 2E7VA 3A3NB 3ET6A 3I6PA 5DS7A 4DPTA 1RHUB 3HPOA 2DH7A 1XERA 3PJXA 5F41A 3OXFA 3GV8B 4LFCJ 1AA1B 4A46A 1F60B 2DGOA 3TEHB 4LSLA 1RGVA 2DT9A 3BH6B 1U6ZA 1KHVA 4ZPWR 4KT0C 4J9MA 3RAMA 2OEJA 2VV5A 3DGVA 4NYZA 3MURP 3IWLA 1UFLA 5KG3A 3DNCA 1JJ2R 4MFBA 3WX4A 4USJC 1RJJA 3G6YA 1GXTA 2J0WA 1TL3B 3EZOA 2MKIA 2XLKA 4NPOA 1KRPA 1ZM4A 1UVJA 3D4JA 4MKBA 4C8MA 2WTFA 2K1RB 5ADZA 1S4EA 2XHWA 3LQVA 5CZVA 4K4VA 4DPXA 3MAAB 2IM0A 3H5SA 2M0GB 2UXDF 5DO2A 3ENQA 1TMJA 2AWZA 5CYMA 4EO6A 3C15B 4PQUA 1KN6A 4ECSA 4ES2A 3Q86A 2BANA 1DAXA 4HACB 2NXNA 3DM2A 4EEYA 2UUCJ 3TZXA 1R8CA 1C1BA 4H54A 1TK5A 1CULA 4JV1A 1Y5LB 2HLTA 2KRRA 4CP5A 5E3AA 1HYSA 1RTIA 2JFDA 2KT3A 1T11A 5DM7Q 4DQIA 4LVNP 5HJYA 4DR7F 3QT8A 4GKKJ 2DYAA 1RT2B 1FK9A 1WF0A 3JQJA 4LSZB 4PG7A 5B0EA 4Q45A 5HROA 2GW8A 4JI1J 5C2GA 4OHXA 2I6WA 1H7WA 1SL0A 4OMFG 3PIOQ 4NCBA 1W7WA 5DM6Q 2GZOA 3QQCD 4WU3A 4GKJF 2M9KA 2M88A 1HNWJ 4P10A 3U1MA 4RWXA 1X4GA 1LW0A 2X3GA 2WVCA 3BGUA 3CCWA 4OX6A 3HJFA 1URRA 3C2PA 4UY8T 1FDNA 2DNRA 2BYCA 4FXWA 2FJBB 3CD0A 3U7JA 5GMDA 5AE2A 4DPWA 1UFWA 4KGZB 1UVMA 3PR5B 3AHPA 3IBCB 3NLCA 2HPUA 1CEZA 3OLBA 2IAJB 5A0YA 2XSFA 4O3NA 5M2UA 2IBOA 2QG9B 4LIRA 2PEHA 2VFSA 3PW2A 2YWWA 2IJRA 2KN4A 2YH0A 2NXCA 2W2QP 5F9NA 2FC8A 4OX7A 4XAKA 2F5GA 4ES1A 4ZP7A 4MAKA 1KLMB 5K14A 3MR2A 3PX6A 1PC4A 4I4BA 8RUCA 3JSMA 4HTJA 4LR7A 5JMNA 1FWKA 1LXNA 1S7IA 3IXQA 1KFSA 3J7YU 3PO5A 2KZMA 4U7UK 1VQLS 3VAFA 1FKOA 1XR6A 1FKAF 1TKXA 5HVHA 3PJWA 2DD8S 3M8QA 1B0VA 5C5JA 4NLTA 2AYMA 1TUWA 1RT3B 2PD1A 4MT1A 3FFIA 4M5HA 2UUBF 4Z7CA 3JYTA 4XIUA 4DFJA 1C1CB 1FJCA 4DR1J 3L09A 4V19X 5E0OA 2FY8A 1M1KT 4FNHA 4P2FA 5HLFB 3OBIA 2AYGA 5K20B 2E44A 1QTMA 1MWQA 4CO3A 4TKTA 3KK3A 1H2TZ 1UPMB 3DOKA 1YSJA 4QW8A 3S1TA 3BBCA 4Q0BB 2GNKA 1RA7A 2IMOA 2VFTA 4G65A 3W5ZA 4A8WA 4TQRA 3UD5A 2FGCA 4FNIA 5I42B 3BSOA 2VPYB 4O44A 1CLFA 2UVWA 3MR7A 2VBWA 5H9EK 4KJIA 1RT6B 3FBBA 3BGOP 2ROPA 2JVOA 3GPAA 1BC6A 3CJ4A 1NBEB 4B9SA 2N3OA 2VFRA 3OUYB 4IYQA 2V0NA 2BVZA 2HHQA 4O3OA 2MTLA 1HL6A 4TLRA 1NAQA 5BJRA 4USKA 2DNYA 3RBEA 1U1PA 4U7CA 1RT4B 4ZVFA 1JMTA 3TEGA 3ZNJ1 1L5UA 1FK9B 1RT2A 2D3ZA 3HFVA 4DQSA 2BQ3A 3M9OB 2UUBJ 3BPDA 2CG4A 3ZZRA 1QSLA 2NR0A 4FN5A 1ZA2B 2B9YA 2F8HA 4EUVA 1N32J 2GO8A 4UOCA 3H7HB 5D3GA 1RTHA 2HHPA 1N34J 2GAGC 2G1HA 3HF5A 4IO9Q 3HHNB 5CYMB 1S1XA 2HBYB 4KV8A 3VQTA 5DJBA 3MAAA 2HWIA 3CO0P 4HTIA 4F4YA 3OFGA 3OTBA 4OYZA 4N76A 4OL8A 1TKDA 2HIYA 2A2CA 3H90A 3KLHA 2GMHA 1NZAA 2C3OA 2IMWP 3QRQA 5D4NA 4LRCA 2UXCJ 4CLWA 3HVTA 3UR0A 2AHOB 1LXJA 5AXNA 5CQGA 2C2RA 3CJQA 3HSGA 3HJVA 2Q6BA 2UV8A 1NPKA 2IM3A 3L4BC 4WF9Q 1ULRA 2LDYA 2WVBA 2ZH7A 3EICA 4Q7AA 3GQCA 1Q16B 2IRYA 4RW4B 2EC0A 2ASYA 2C2NA 1P1LA 1XMQF 1C4AA 2CJKA 1HHSA 1U8SA 1WEZA 1HQ2A 2M4MA 4ZLLA 5B09A 4DSJA 4NA3A 4NLVA 1GMWA 3MM8A 3R2CJ 2MEWA 5KTQA 2NZCA 1V3SA 5AXKA 1VC0A 1JQGA 3PXGa 3SDEB 4URSA 4DL3A 4H4KC 3R2DJ 4QW9A 2OTLS 3ITHA 2QYGA 5J1NA 3PX0A 2GGPB 2J5AA 2JVRA 2IY5B 2OPQA 4USWA 1Q5YA 3FQLA 3BB5A 5KOWA 5H9FJ 3SXLA 4ZCMA 3TUZC 4J9QA 2DRDA 5IM0B 3DGPA 5DRKA 3AH6A 3T3FA 1HI8A 2H9ZA 5G0RB 4ZHRA 1HW8A 1VRTA 4C8NA 4C2MA 3EGZA 1YI2S 4M5JA 4NI2A 1XNRJ 1SH2A 2J9DE 2DGWA 3IGVA 2PA3A 1RHKB 4LQ9A 5G4DA 2FZCB 4JI4F 4JB8B 1FJGJ 2KXHA 4C8KA 4N41A 1S79A 3PNIA 4WFZA 4NE9C 2H54B 2HHTA 2JLFA 1OY9A 1S9EA 2YNFB 2EI5A 5HATA 3M2UA 4RW9A 2CG8A 4DR3F 1VQ5S 3TZYA 2CWXA 3QT5A 4DSIA 2L48A 3NS6A 2YTCA 2CFXA 1YBTA 2PE8A 4CTAB 2IDLA 4L74A 2HVEA 1X4BA 4CNZA 4KGXB 2YX7A 3EWGA 3IAS9 3MPYA 2CVIA 5CYJA 3KLGB 3G96A 2IVMA 2J0XA 1XMOJ 4C8ZA 1GXLA 1FRXA 1WKJA 3PFEA 5HJXA 4C8OA 1JLGA 4JI5J 2OMOA 2YX1A 2CPJA 5B08A 3FRYA 2V8GA 1NJXA 1I51B 1GX5A 2QZ8A 3ISND 1UP1A 2V6AA 4A8KA 4ECYA 3BQ1A 4A4JA 3MM8B 1QAXA 2C42A 3K8WA 1FJGF 4F3MA 2A18A 1NB2A 3BF4A 4MKAA 3UE2A 2RF2A 4QIWD 1TKTA 4ED3A 3BR8A 2GO9A 2XB2D 4C4WA 2WK4A 1N5YB 2B6AA 1HA1A 1NO8A 1VK3A 2OPSB 3M4XA 4IH7A 3TJAA 4C7QA 4DG1B 4YFUA 2VG7A 1WF1A 2J9CA 2RF2B 3BR9A 5KFUA 5DZ6A 1O0PA 3W7BA 2AGQA 1NEEA 5H9FK 4URGA 2LQBA 2CPDA 2CRLA 2XSJA 1ZM9A 1VK8A 2L3MA 3IBFB 1V9OA 4B9UA 1WNEA 4GO7X 2HGMA 3MMCA 2PFDA 2XYHB 3MZIA 3HFKA 1NZ8A 5K8OA 1BXNA 2A3JA 3G86A 3GE9A 2V9KA 5IV4A 1S9FA 1YRUA 2VQEJ 1H98A 2EC2A 3A13A 4FDFA 2KYXA 3E01A 5D0GA 4F0MA 3AA8A 1B4SA 2HVHA 6FDRA 1UMJA 2IHR1 2RDIA 2YKPA 3CCES 5DG8A 2FVCA 1HNZJ 2DR9A 1C4CA 2FHOB 2V4JA 4CTAA 1WACA 4RU9A 4DSFA 4IH5A 2RS8A 1MNEA 1RTHB 3T1HF 2CNKB 5EN1A 2QYCA 1QAYA 2AIRB 1LWEA 1UVKA 2LA6A 2KT5A 3EGWB 4YMEA 3DLEB 2MKKA 2EBEA 1DQ9A 2JWNA 1J5EJ 2CZVC 3Q23A 2Z0GA 1IWAA 1X4FA 2GV1A 2IM2A 2YKOA 3CCZA 1RTJB 1RWXB 3DHXA 3KNGA 1BE4A 3I9V9 3QPIA 5SUHA 4ZN3A 1T05B 3KMQA 4HDGA 2I0XA 1WEYA 5T41A 3D5MA 4V1Ak 2YQ3A 4J9KA 4DV2F 4LFAF 2VOPA 2BV3A 4URQU 3WIVA 4LQ3A 1W26A 1KBRA 2GVZB 2VKZG 6AT1B 2W9AA 2OTJS 5B0CA 2J8SA 4BHQA 3NCPA 1RK8A 2B0GA 2UUTA 4K2XA 4N7TA 1G7CB 3RW6A 4EBCA 1LOUA 3KK1A 3KFWX 1NK5A 1X4CA 1RT6A 2AF6A 1ACMB 2YQ0A 5E3QA 4ZPVR 2QLJB 4AL5A 3HDSA 4F4WA 3HULA 3TAPA 1IUJA 1S1TA 5KFDA 2D74B 1VQ9S 4ILLA 5D0HA 2W24A 4EI2A 4UQGA 3QYYA 1S6QA 1N88A 1W25A 4L72B 3D67A 3I5CA 2B9EA 3K8VA 4B3OB 7FDRA 5HP1B 2ASDA 4JYAJ 2D3UA 3FEYB 3MM6A 3M9NB 1IKYB 4KH1B 4J9LA 3PW4A 4USUA 1RAOA 1N4LA 3M2RA 2XNRA 2R8JA 2VG5B 4GO5X 2LXIA 2BW7A 1R0AB 2V68A 1TAQA 2G2YA 2AJ4A 1RTJA 4BWJA 4JUZA 2ZBPA 1TZ0A 2CKWA 3KXDA 5B7WA 1R0BG 2MJUA 2NUHA 1RTZA 4XDDA 4TXSA 4YHHF 3EPIA 1GTHA 4R0EA 1F2HA 2D9PA 1KONA 2BUNA 1U1KA 3NNCA 3M8YA 3CJ0A 5JVGQ 4DV4J 2Z2YB 2KG1A 4DSEA 2VQFF 3EUNA 3TA1A 1MROB 1N33J 4I56A 4AYBD 4DR4J 2B4PA 2HG4A 4JI7J 2HRUA 3KJFB 4LUBA 4WKRA 1BY9A 1OIAA 4OYOA 2QA4G 5A8KB 2JX2A 5J1PA 3QBCA 5LMUJ 4YB7A 1Z1ZA 3CJ3A 4CT9A 2R7TA 4ZJLA 1M5OC 3R9LA 1EP4B 3CD7A 2RIJA 1WSRA 4CH7A 3A3OB 4YB1P 2MPUA 2NSBA 3W9JA 4CZCA 4JI2F 4NXMJ 1UEKA 5JVHQ 1CC7A 4ETZA 1ZAWA 2OD4A 1NDCA 1VQ8S 3N6MA 2KVIA 1FRLA 3MHYA 5LOQA 1URNA 2VC0A 2ROGA 3T1YF 1U1LA 1X60A 1FRMA 4D3HA 4U9RA 4DCOB 1VQMS 1T7PA 4L3KA 3RRKA 3MR5A 1IKYA 2K2PA 3U27A 3RBDA 1T03B 2CQ2A 2RB7A 5KG1A 2C2DA 5LSLA 3L7OA 4J9PA 2KVQE 2XM3A 3HVWA 1GXUA 2FGOA 5GMEA 2QO3A 4PXBA 2QN6B 5KFBA 1HWUA 2W9BB 2R7RA 2A10A 1L3UA 2DRBA 4QR1A 5ITHA 4KHPF 3UN3A 5CXTA 4B08A 4ILRA 4Z2XA 4N56A 1IBMF 3AB4B 2A6MA 1UWBA 2KM8B 1FCAA 3Q8UA 3KG4A 5CZXA 1VQ7S 4NRUA 5L8RC 4JOUA 2HNZA 4F2RA 2DEJA 2ZWOA 4QIEA 3KK2A 2EXUA 2ZH3A 1G1XA 1JJCB 5F8NA 5C42B 4C98A 4K4XA 1B0TA 3HVAA 2X1FA 1V3ZA 1U25A 3HI9A 3R97A 4CI0B 1K73T 4NASA 1PJ5A 3VGUA 3DI6B 4MKVA 4I6AA 3SI8A 1PC5A 2ZBRA 3C16B 4EU0A 2D3O1 3BDEA 2X7IA 5HMZA 1S10A 3EYZA 2ZDPA 3MMBA 2HFZA 4ZVEA 2CNLB 3RW7A 2F63A 2MSSA 2VA2A 2FHMA 1KHWA 5F8MA 3CCSS 3R3TA 5E33A 1JXVA 1VQ4S 2W2PP 1KEKA 3HHLC 2HBQB 2ZJPQ 3ZTOA 1S59A 3D6MB 2JSXA 4ZCKA 4TYAA 4NCGA 3DHWC 4P2MA 2OFGX 2QRRA 4C97A 1UEVA 2V50A 2VDHA 3CIZA 4DOZA 1VBKA 3G87A 1L3TA 2DO0A 3BGRA 2AU0A 3TX0A 3NL0A 1KQFB 2RS2A 2KTQA 3WDOA 4KE5A 3CCVS 1X4HA 3SV4A 3G9CA 3BKUA 1H74A 4WIIA 3V4MA 4DL7A 1N5QA 4HT7A 3PX4A 2KZZA 4DBQA 2HHXA 1CSJA 4KSEB 2XMKA 1XR5A 1GFWB 1WC1A 3HZEA 4AT1B 4Z37A 1VQPS 2RAQA 1T8EA 1NK9A 2QMXA 4Y2AA 2DR5A 2MGZA 2XLJA 2AW0A 2DXDA 1HNVA 2W1BA 4RNNA 3I9ZA 2BR0A 1MMNA 1RAFB 2WOMA 2ZUGA 3M2RB 4DFPA 7AT1B 2N82B 1QD1A 2BDPA 2G2ZA 3GFYA 3QT7A 1KS2A 3RB6A 1FNXH 1FDBA 3IR5B 5FD1A 3DRRA 3ETOA 4K4UA 4TLQA 3TZWA 3QZ8A 1QUVA 4QYRA 2N4DA 3HFZB 4HACA 1NNDA 3JTNA 2A0FB 3OTDA 2K8GA 1SKRA 1HBOA 3F73A 1VGYA 4PQUB 2IYIA 3TVZA 4IO1A 3KHHA 2ZHOA 2W25A 2DK2A 3NWRA 3BO3A 4DUYF 1U0HB 1FEHA 1RAGB 1RT1B 1D1UA 1IBCB 2HGNA 4OLOA 1KDNA 4F4XA 4PG8A 2HFUA 3ZO7A 2W01A 1RAHB 3LGHA 3P4UB 4DX7A 2UXCF 3V6JA 2V2ZA 3T19A 5C7PA 2EKNA 3M6VA 4LBIA 3GR0A 4OX8A 4ZVUB 3GCWP 5F0WA 3BBBA 2JEFA 5E5NA 3M6WA 4IG0A 1Y00A 5IM0A 3OV7A 1YKWA 2A1BA 4HHJA 1ICEB 1L3VA 2B5JA 3GFHA 1HD1A 1EETB 1OSDA 3HHKA 3KUEA 1ZA1B 3M6XA 3O3LA 3NOGA 2RKIA 4KKOB 5ETRA 2YKAA 3M32A 2DGQA 4LBHA 4DU7A 2ALZA 1Q81T 1H73A 3C19A 1FEEA 3MEGA 3TOQA 4C3LA 5IFMA 4OHWA 2U2FA 2ZWPA 2MZ1A 2O66A 2E9ZA 4OZ1A 4RKUC 4OHYA 4RLEA 5I3UB 4A8MP 3H8YA 4ZN1A 2BRLA 5HLFA 2LLZA 1BQNA 3Q2SC 3ZZ0A 4DL4A 3WX8A 3UNYA 4WBFA 3T5HA 2AJ2A 3OR1A 3DOLB 1SI9A 4FP9A 1UEUA 4P2SA 5DDQC 4CO0A 3MMCB 4Q44A 1R8PA 4JV5J 1IKVA 3MPWA 3TJ9A 1IR0A 1U6FA 1RABB 5DETA 3HXMA 3CEDA 4RW6B 1EHWA 2WVEA 4ZVOB 5I4MA 1U48A 2VD3A 2XSJB 3OXLA 1FVQA 3JQMA 3QGIA 1X8DA 3UD4P 1XTZA 1HNWF 3CIMA 1IKXA 4P71A 1K8AT 2HS0A 5EDWA 3NXZA 1S77D 1N36F 4Y6IA 2ILZA 2ZNYA 4IFYA 4B9LA 1U7LA 3PKYA 4FF4A 8AT1B 1XEZA 1V5IB 2Q79A 2HS4A 2JJ4D 3IO1A 1FRHA 4LRDA 5HQ8A 3GMGA 2W9CB 2G2OA 4Y2CA 2YWFA 3C14B 5HQMA 2VICA 1SJRA 1B7FA 2UUWA 3GYXB 2MHNA 3AD9C 4IRKA 1NXIA 3N5BA 1AFIA 1YZ6A 2I8EA 3CJ8A 2MQPA 1YX2A 3NS5A 4WIQA 1J2VA 4KHMA 3QGPA 1RTDA 1CJVB 3HLUA 2YKMB 4KO0B 2NXEA 2GHPA 4IQMA 3JAMY 1HI1A 1JLCB 4WXWA 3EM1A 5GADI 1EQMA 1S7HA 1VDHA 1UL3A 2AJQA 4RW9B 1SKSA 2G9OA 5KFHA 2FLOA 5KFQA 4P74A 3KNAA 1RBLA 1DQAA 2DH8A 2DH9A 2FHKA 5IOLA 2F9JA 3PHTA 2HZCA 5HQLA 2FZGB 3PTWA 1JLBB 5HROB 1RBAA 3BDPA 4FS1A 1IQZA 2VQFJ 2HWTA 1UJ6A 1YBAA 2ABYA 3KUGA 1MWZA 3LGMA 4QR0A 4DR4F 4X4VA 4DPUA 4I1TA 4AD6A 1NK0A 2IDEA 4WK3A 2ZH5A 3A1YG 3GJSB 2BJEA 1HBUA 1HWKA 3WIUA 4R5PB 1SC3B 2HEKA 3LH2S 3NGDA 4WPAA 3T1AA 4PUOB 2HBRB 3HHLD 1HNIB 4HDHA 1TL1B 3U1NA 1KTVA 3BZQA 2QIFA 3MEDA 4HKQA 5KFFA 2COLA 3ETMA 2EEYA 1OY8A 1VHFA 3SQGA 3PV8A 3RAXA 3MGJA 1X9SA 4IUFA 1C1CA 3NKYA 9ATCB 4JI6F 1VISA 4FF2A 4UY85 1A7GE 1N0VC 2E5JA 4EK2A 3V81B 2JOQA 3TW0A 3CJTA 3FFIB 1HPZB 2FIUA 3CJRA 3LA0A 2DR7A 4WE1B 5D0RA 4NZ7A 4TY8A 2F4VF 1JKHA 1SQEA 2XEXA 4KBIA 4MIBA 2MKJA 1U49A 2D7SA 3P49B 4RNOA 1WJ9A 3TARA 1RE1B 2AZ3A 1HHQA 4USTA 4ZVTB 2KRBA 4RUAA 2LECA 2HHHF 2V4RA 1FE4A 4ECXA 1QM9A 1OJ4A 3OPKA 4K59A 3RG6A 3T6BA 1X31C 4DUYJ 2W7PA 1HNXJ 5HVFA 1AYEA 5D78A 4RX6A 2FYXA 3QT6A 1H3DA 2GC8A 3DRXA 4F25A 1EJ7L 2DHHA 1MU2A 4JI7F 1NK4A 3MOJB 1APSA 1DTTB 2CJBA 1YJTA 3M8PA 4PYDA 1KVJA 2HURA 3PIPQ 3TAMA 4KGMA 1HNZF 1S49A 1NU4A 2V8PA 5K5MA 1SJQA 2BBEA 3H2LA 4NLQA 3ZZUA 1V6HA 5KT3A 4HEA9 2V2KA 1SXLA 5L9NA 4LF6J 5KFVA 3MEEB 4DX5A 3ONQA 4NXMF 2FLLA 1RWMB 2MJNA 2FZKB 2H4YB 2QFJA 1RAIB 2FPHX 2DNZA 5ETVA 1JLAA 3RRHA 3D68A 2W2NP 2H65B 5AJ3F 1REGX 1R6YA 3KDOA 4OZNA 2XS2A 2XULA 2FLPA 1D8ZA 4OHZA 3DLKA 1UETA 2ZKUA 4DL0C 2X51A 3RTVA 3A4TA 2XY7A 1HYSB 4Q5VA 1FO1A 4FYWB 4EWTA 3T9NA 1TK8A 1FNOA 5IWAF 2L08A 3OUYA 2AEMA 4RW7A 4QU6A 4KAIA 4LRAA 4YS2A 5ETSA 2I1RA 2ZJRQ 4DV4F 4FBUA 1VHIA 4NMLA 5L39A 2BKNA 2DNPA 1Q1KA 3T5KA 1R8HA 3SSSA 3JB9k 3NBPA 3EXYA 5GAHI 2JEGA 4B3SF 2E1CA 4W92B 2M70A 2BX6A 5GAEU 3CCJS 2MB0B 1Z4UA 3QAEA 1VQYA 3MMAA 3TI0A 4LF4F 1U4BA 3SCJE 5J2QB 1QY7A 1UA0A 2WVFA 2VL1A 3SFGA 4DMZA 2DR8A 2FJDB 2ILYA 3C46A 3V6DA 1Y5NB 3LANA 2BW2A 3NAHA 3NY0A 2J7UA 3LP2A 4GKKF 3JYTB 3KYLA 2YWGA 5KT5A 3V6DB 1ELOA 1F1BB 1VYAA 3FCVA 3QGHA 2BJ9A 4KYZA 3R7SB 3W64A 3OTOF 2YY3A 1XC9A 1WOOA 4OZ3A 4F3QA 1RAEB 3LPEA 3HVRA 3DRPB 1UPPA 2U1AA 1RU2A 2VBZA 3M8QB 4YEAA 1X5SA 2O1PA 4FVMA 4ZVSB 5LMNJ 4X4NA 2CJAA 2DXEA 1T95A 1N5SA 1ZAXA 3EVMA 2M2BA 1G3OA 2RQMA 3K58A 3H98A 1N52B 3I0SA 5K8NA 2D3OR 4Y28C 2FB0A 2DHXA 2BMBA 3G8SA 2RDJA 3N01A 1K0VA 1IJFB 3M6UA 1Q95G 2ZH1A 2CQHA 1HQUA 1ZS6A 3BEGB 1VQ6S 4ZMMA 3GJQB 1LWXA 1N54B 1NUEA 2W4DA 1KP6A 4Q8FA 2LP4A 5F9LA 4NOHA 4G1QB 4XDCA 2J0SD 1YVFA 4LFCF 2ZHAA 3DMJA 3DDNA 4OYXA 1C0TB 2CJYB 2HFOA 2O01C 4IH6A 5C24A 1WG5A 2IFXA 5CA5A 2R7UA 4OZ5A 4PR6A 3HKWA 2MGZB 1F3VA 2E66A 5KFPA 3MFHA 3W8PA 2WW8A 2JFKA 2OPSA 3UPFA 2AGPA 3DFEA 4FPIA 1KWMA 4K4TA 1KQSR 4OI4A 3M7VA 3HX9A 4DUZF 2DRAA 1JIHA 2B7BB 2M7SA 3C6UA 3H0PA 5CAAA 3GP9A 2QA1A 4DFMA 1TK0A 1ZH5A 4PXCA 4U8VA 4J91A 3ZC4A 1T3OA 2B4UA 5AE3A 2Y0BB 4WFYA 2XI3A 4L76A 4ER8A 4ED2A 2HHHJ 5KG6A 3DLHA 4EZ6A 3OL7A 3RR8A 1XNQJ 2XMMA 2BE7D 3FKBA 1A0OB 1HBNA 4RR5A 2QLBB 4A8SA 3D28A 3T5JA 2BM1A 3H59A 1S5ZA 3CJ2A 2NXUA 1RLDA 2KKHA 2HNDA 1GTEA 1FKPB 3GIRA 5CYQA 1OQ3A 5KG5A 2UU9F 4DSLA 4C8LA 2YNGA 3BYRA 5IZHA 2XGPA 3R5BA 4LRBA 2PN6A 3MMBB 4AUKA 3CE8A 1H2VZ 4NZ6A 4JI1F 4C8YA 1JWWA 1HD0A 1FDDA 2DKOB 3PHEA 4TY8B 2WZ1A 5A8RB 1YRTA 5E41A 2RU3A 2FVPA 2OI2A 1GMVA 3QIPA 5M2RA 4MYTA 5HL7Q 3PJ9A 4X65J 4WFAQ 1O51A 1GNKA 2GIRA 4LBPA 4QIFA 5D4LA 3V81A 5DGAA 3D6HB 1T9YA 5IT4A 3J80U 1S57A 2HRTA 2WCXA 2R9LA 3W2VA 2JL9A 3SYZA 2MZRA 2R8HA 4RW6A 3OFHA 3HK2A 4PKDB 2MLYA 3MEDB 3OTEA 3PRVA 3CDWA 3FC9A 3O5TB 1VJQA 3DU5A 1JLQA 3GJRB 3ILOA 2QTWA 1WI8A 3MDFA 3PW5A 2GMLA 2H5JB 3DYAB 3MI7X 5DG9A 3G8TA 3FCHA 3BQ2A 3CCUS 1VQOS 4LF5J 1QVGR 3MOZA 1WHXA 4QBUA 2ACYA 5THWA 4FS2A 3I0SB 3US5A 2ZOGA 2RQCA 2GVDB 2Y0SD 1T02A 2KB2A 5KG4A 4CWBA 2CNOB 2HFVA 2RD5C 4I68A 4L73A 1WOSA 3IM8A 1Q0NA 2PEBA 2E5GA 3EVWA 4I7FB 5A2QU 3OFEA 1O6XA 1CC8A 3DLGA 3LP1B 4XO0A 4AL6A 1SV5B 3NRBA 3PRBA 2CQDA 3IBWA 3J81Y 2P9GA 4IG0B 1U8WA 2HVDA 2MZJA 1S1UB 3PYGA 3D1OA 1YJWS 1Q79A 2DISA 2QL9B 2XG8A 1NHVA 2VA3A 4M8LA 3NGKA 3K7RA 3PACA 4PAAA 4RBVA 3TX8A 2KG0A 1CPZA 1WC0A 1EIYB 3AXMA 5HANA 1S1VA 4A47A 3G4SS 1SQGA 3HZGA 2H48B 4IOBA 1VQKS 1IQTA 5DLGA 4ZOSA 1U0SA 1P8GA 2CQ0A 4X4UA 3AAWB 3S6EA 1TU0B 2OD6A 5ETQA 5A8WA 2VBYA 4DR6F 5BYQA 4K4WA 4E2FB 2IJNA 2WAQD 2ZM6J 5A8KA 2WRMA 4F4ZA 4DU8A 2NS1B 4M63A 4ATNA 2LEBA 1EB0A 2DNKA 4DEZA 1S97A 5D3GB 2JC1A 2AT1B 2XZDB 2W4PA 1MROA 2B56A 4OZ2A 4KH0B 4BC9A 4B3TF 3HO1A 4DV0J 1S48A 3MEKA 2RILA 2HSEB 3A12A 1FTCA 3P45B 1V5VA 2NZ4A 2OUGA 2AEFA 1R31A 2ZE2B 1XNRF 1K1SA 1X7VA 1JLAB 1DHMA 1WSVA 3ENVA 1TKZA 1F3FA 1NHUA 2Z8QA 1ZM3A 1LWCA 1VRUA 4DQQA 2YNHA 3GLJA 3TVKA 5KT6A 2AX1A 4WU2A 4DFKA 4TU8A 2E29A 2ZNZA 4YB6A 2V2QA 2CPIA 3D1HA 2HFNA 3R6LB 4I6YA 5FDLA 4ZLPA 3MUTP 1PKUA 2SXLA 2XMTA 3ZZOA 2ZH8A 2QX0A 4PRFA 4CYUA 2HMIB 1SKUB 1F9FA 4USVA 5L38A 2W7OA 4J9RA 3DLBA 4EBEA 1RP5A 4N77A 3TAMB 1DJ0A 4QWCA 2C2OB 5BYSA 3I55S 2GQQA 3W63A 2LCWA 4ED5A 3PYDA 4E0DA 3R5AA 2IM1A 4RPFA 2VFUA 2FHJA 1QLNA 2KFNA 4LF8F 5GVQA 2D69A 2J9EA 1FJ7A 5HBMA 3Q8RB 4DR7J 4ZS6A 3MUVP 3FJ2A 4PPZA 5LSOA 1QAIA 4ECUA 2DO4A 3DN9A 5D4OA 3RUBL 2FLNA 2HHVA 2XMWA 4KY3A 1HWIA 1UZHA 4MYUA 1U6BA 2DCLA 1TUGB 2HQGA 2MDAA 2YWEA 2DNOA 5K8PA 1SV5A 4QWAA 2H4WB 3E2EA 5U47A 3BV8A 1T9TA 1QTNB 1JLEA 5L1IA 2FDNA 2RNEA 3W62A 1SJ3P 4RL1A 3PKMA 3PEHA 2H51B 3NGRA 5K14B 3IGNA 5KFJA 2RRAA 1X0FA 2G4BA 2EK1A 4KHRA 4KTQA 1YHQS 2FJEB 4QWDA 1DARA 1BGXT 4OZJA 4USMA 3RR7A 1CJTB 3F0NA 3G8QA 5RUBA 1RKIA 2EBGA 2YNIB 3PFOA 3Q0AA 4DL5A 2UXBJ 3MPUB 4L3NA 3T6JA 1X9MA 1JLFA 4WFBQ 3TZZA 1N6QB 4F3OA 2VB6A 1IWGA 4DCJB 5FLXY 2V67A 2HQIA 2BOAA 4LR9A 1ZPWX 4BBYA 5LT5A 3B82A 3RZAA 1VBXA 1M5VC 3WC2A 2XO7A 1OS5A 3N9UC 2OO4A 4OX9J 3DLLQ 3QLHB 4HH0A 2ZZMA 1SUQA 4I2PA 1RHRB 5F8IA 2H5IB 1SC6A 3FVYA 1DLOA 3D9BA 5DDPC 3R5GA 3AQPA 3ZTRA 2XO6A 4ECZA 1IXKA 5F3ZA 3GSIA 2DNNA 3K5PA 4RWWA 3UD3P 3PDNA 5AJ3J 4J9OA 4ZA1A 2IC3A 5KFCA 3KJVB 2R7QA 1RA6A 3GYGA 1I94F 4TNOA 1VFJA 4WWSA 5ETNA 5CYQB 3BJYA 4YOEA 2OJ3A 4DQRA 2HKEA 2KXFA 2JHEA 3LAKA 3HSJA 2E7XA 1F5BA 3D7SB 4P52A 2HIQA 1Q7YT 4M95A 4XK8C 2K3IA 2BANB 3VTIA 1Q86T 2KYZA 4LF5F 1H0HB 4JV0A 4DR5F 1NH7A 2PA8D 3J7Z5 4FXVA 4OV6A 1WDDA 4Y2IA 4ID5A 2KHCA 1WUUA 4KB7A 4IDKA 1QE1A 1BQMA 1LKZA 2IA6A 4NLUA 3BM7A 4P7VA 3M30B 2C2ZB 3DOMA 1DBDA 1UJ4A 4WTYA 3A8JA 2L9NA 5EWGA 2F4VJ 1UVLA 1PBUA 2LQ9A 3KLEA 4WZQA 2CYYA 1IBKJ 3I4HX 4ZITA 2EFNA 3D0GE 4DV1J 4O3QA 1DTQB 1IN0A 3VGSA 2XQCA 1BLUA 1M5PC 1N6QA 4LFBJ 1C0TA 1UVNA 1I94J 1ZETA 3AJ2A 3AJ1A 4H4OA 1I3OB 4PWWA 5HVGA 3CD6S 4EYIB 2BOPA 4CLYA 1YGYA 1NB7A 3AOBA 4ZPBA 4QU7A 4O4GB 1U24A 4F2SA 1EX8A 1U09A 5KT2A 4HR2A 5GAGI 3KLVA 3KHLA 4CLFA 4DL6A 1RAAB 1Y9OA 1HBMB 1G6BA 2H1YA 4YDDB 4B9NA 4F0HA 3VR1A 1S72S 4KFBB 4CIOA 1ZOTA 5F0UA 3CDUA 1R8AA 4RUCA 5KFAA 4LVOP 1DRZA 4LJMA 2QGFB 2AJ1A 4QPTA 2VOOA 4BCAA 4B3RF 1T03A 2GHVC 2LQJA 1PG5B 4NWBA 2YKQA 3E3XA 3LOUA 4LF2A 5E2QA 1CS4A 3VALA 1YJVA 3BKFA 4QZVB 5HN0A 1WWHA 5HBMB 2MKCA
chains in the Genus database with same CATH topology
2M8HA 1OPIA 2QSFA 1FESA 3FZ2A 4ELTA 3W2WA 2BA9A 1U26A 1FRIA 2I5JA 1E6VA 2M3DA 3CSKA 3NCQA 3DLEA 4URGA 1HW9A 1BQMB 4Q44A 4IFVB 4ZDNA 3MECA 4MK8A 1U2RA 1J5OB 2ZJQQ 3LWLA 1S1XB 2Z2LA 1QUPA 1TVRB 2LQ5A 3MECB 3EZUA 2ZBIA 4PG4A 5HMWA 5H1SV 5D77A 4RNHA 1YG0A 1LWCB 3SZ2A 5KG0A 1VS3A 4CH1A 3FRZA 1WD6A 3X1LB 3BSNA 3SCIE 2MQLA 1SJ4P 4OHVA 4UQTA 2CJ9A 2OMLA 3DRSB 6FD1A 4IRDA 3GYNA 1N32F 2OKQA 3UNGC 4NRTA 4C3MA 3BO2A 2ZFHA 1UVIA 4UW2A 2WONB 5I42A 4BDPA 2DITA 3H5UA 2XZWA 3GWCA 4OI6A 1H38A 4K4ZA 4OLPA 3B8HA 4RBUA 3KK3B 1PGZA 2UUCF 1B0PA 4QCLA 4W90B 3AA9A 1HNXF 3MM9B 3FEZA 3Q8SB 3PVXA 3B78A 1P9QC 4JI5F 5T7LA 3D1QA 2LMIA 2RRBA 2AP6A 1OQ6A 1C0UB 3RB0A 4ZPCA 3T5LA 3PZPA 3M2UB 2MMYA 1JKHB 3CWJA 3HHEA 3MWBA 2DNQA 1NKBA 1WHYA 4ZP9A 4WE1A 3VAJA 2EW9A 1W2IA 2KJVA 1Z2ZA 2B9XA 1MSWD 2V4JB 3S7RA 4MK9A 5T7LB 5JUMA 2PGCA 1JNRB 2EWHA 3P3DA 4EYHB 5G0RA 4ZHRB 3NP5A 1D9FA 1XNQF 3E01B 3MR3A 3CJ5A 1YRXA 2YKNB 3CC2S 4ZPTR 3CVKA 2F8MA 1SIZA 1A9NB 4R5PA 2VONA 1O5JA 2AQ4A 2Z4PA 4EGLA 4AE5A 1WTFA 4NYPA 4ZCLA 3KLFA 1RISA 2ZOFA 4LSNB 3W2VB 4O3SA 2ROEA 4H4MA 2DPJA 5LSRA 1VJWA 2MKSA 3M8RA 2VG7B 1WF2A 2UP1A 3IAM9 4DG1A 5L9XA 4DV0F 4ES3A 1JLBA 2GQ2A 3UQSA 4ZPAA 5FDLB 4A8QA 1M5HA 1TKTB 1P27B 1DLOB 1FXRA 3SV3A 4DS4A 1S0VA 3H2UB 1VRUB 3FSXA 4ECRA 2CPFA 4UUXA 1X5OA 2B4OA 2ZE2A 4WYLA 2PO4A 1RTIB 1Q78A 3HVTB 2CQIA 1IBLF 2QE5A 2VASA 2B9WA 1S1WB 5IXUA 1L3KA 3CD5A 1J5OA 2YNIA 2AJFE 5C25A 3CB4A 2V94A 1HQEA 4X4TA 3GIIA 2RQ4A 1F0XA 4EZ9A 5KFZA 1L3SA 5KFWA 1S1VB 4MIAA 3MM7B 3FEXB 4Y65A 4X62F 3I5AA 4DV7F 2DHSA 3TP2A 4CNYA 3VAHA 2VG5A 2UUAF 3UCUP 3TA2A 4TQSA 1QSYA 4ID8A 4I64A 3MM6B 2WBMA 3UI3A 4C0BA 1I6JA 1M5SA 4H4KA 2HVZA 4NLOA 4K4YA 3CC7S 3O6QA 2YVSA 4I7FA 1S6UA 4X4PA 1H6KX 2QLWA 3R5DA 4A8YA 2PMHA 1LK5A 2RH3A 3N6NA 4CO2A 3FSIA 3FDSA 4J9SA 2L9DA 1DFDA 3TVYA 4YUDA 4O4GA 4WJBA 1D0EA 2BM0A 3FMWA 5E3RA 5H9EJ 1HFEL 1YJRA 3M32B 3O8WA 3KK1B 4LF6F 5HI7A 3I0RB 2UZAA 5B0BA 1JB0C 4DV5F 1N5TA 1F2GA 3RB4A 5B0AA 1V3RA 3MF5A 5D6GA 1DTQA 1FXDA 3KLIB 4A8OA 1T3NA 3UDCA 3HHLA 2NREA 1FRJA 2R7VA 4FYDA 1RQ0A 1T05A 1RT7B 2VPXB 3P5TL 3KLEB 2R7SA 4YP3A 1TV6B 2XGQA 2KO1A 5A8RA 4JI3F 3PW7A 1QE1B 5LXYA 4ICLA 1TVRA 1U47A 3I87A 2V9WA 5J2MA 5HMYA 1GQEA 1VQNS 5KT4A 2CIMA 5FJ4A 1BQXA 4NLYA 2Y1JA 4IOAQ 3GG1A 2XWXA 2EK6A 3G6ES 1F5AA 4RUHA 4B3RF 2NPIA 3GV7B 5A8WB 1FERA 2RRNA 2RE1A 3LALA 3W2WB 5F8LA 5EWFA 3KMSA 3CMAS 4F50A 1VC6A 2XS7A 2O67A 2JEJA 4Y00A 4DN9A 2EFOA 4LMZA 2M8DB 3PR4A 3I96A 2CPHA 3DRYA 3MTKA 3FQKA 3CJKA 3RB3A 1AW0A 4J5OA 4PPDA 2E1MC 4X64F 3QJJA 3MD3A 3NAIA 3CCQS 2AJ0A 1G2EA 4KGKA 2X1GA 2QA4S 1XBWA 4PWUA 4OI1A 3BGRB 5DQIA 4LFBF 1DTTA 2PDAA 2FJWA 1Q4RA 4TN2A 3VZHA 3TUIC 4NCGB 1HQUB 2QLXA 2IJFA 3K5NA 3DM2B 5AXLA 5IT0A 4O0IA 2DBBA 1Y5IB 3VQSA 2R2RA 4JBCA 2ZOMA 1U1OA 4R0JA 3K59A 2MQQA 4NYOA 5EGYA 2AGOA 2YNFA 1Y0HA 1XN9A 2PSZA 3OQ2A 2LU2A 4R8UB 2DNLA 4ED5A 3LF0A 2Z2MA 1LWFB 3IRXA 3QIPB 3J7A1 1TV6A 2FC9A 3O44A 1HPZA 4MFBB 4AFFA 2DIUA 2CQ3A 4ECWA 1TAUA 1FXLA 4Y0FA 3SQGB 2R7WA 2OAUA 2R2TA 2YNGB 2ZVSA 4DWIA 1KQGB 2P6TA 3JTPA 4HLBA 2CPYA 3WZ0A 4CO4A 3UR3C 2XCPA 3LWMA 4WFXA 2J7KA 4NA1A 3MMAB 3J80Y 3Q22A 1UWBB 4ZP6A 3KTQA 5I3PA 2ZZNA 3PRDA 2HVIA 2DNHA 5BYRA 4A48A 4MKYA 1WG4A 4KIAA 2J9DA 4ZP8A 4KR0B 2Q66A 1CQMA 1VIXA 1KNZA 3I5BA 3VCDA 3H25A 2OP5A 2E9RX 2LVWA 3POTB 1FA0A 3C6UB 2XC9A 5L1JA 2C3UA 1JXEA 2LU1A 4IG3B 2BQUA 3DXSX 4ECTA 4I2QA 4ED7A 2OIHA 3SMZA 5GAHU 4MTPA 2N3LA 2ZH9A 5MAOA 2WB1D 5IQ6A 4DF4A 2I2YA 3NCRA 2ASLA 4MH8A 1C1BB 3EPGA 3TQ1A 2ZD1B 1REVB 4F4KA 4QYZJ 1KOHA 4DHVA 1UAWA 1SKWA 1YIJS 4L6V3 1VMBA 3ENWA 3F41A 1FHTA 4Y2KA 1K9MT 3OHAA 1ZPVA 3IR7B 4OZLA 5CCMA 3H4BA 3U1LA 1A6LA 3VZIA 2J0QD 3GB0A 3GSDA 3RRGA 3VWSA 3H2VE 2QMWA 3C66A 4C11A 1FD2A 3HHDA 2HAIA 2MXYA 2OPPB 4F67A 1AFJA 4USHA 2OPRB 3H20A 3BGFA 5KFXA 3CUNA 4OFZA 2C28A 2GHWA 4X2BA 3LUYA 1QJHA 3HKZD 2E5LF 5J2QA 3I0RA 5F8HA 3Q24A 3GIKA 2DCUB 2F7VA 1TL4A 4RW8A 4ZCIA 1S6QB 4H4MB 2M5YA 4LSNA 3I82A 3KG1A 5LL6d 2LEAA 1KLNA 1FTRA 4BC7A 3N0VA 2HW3A 1VBZA 3JSBA 2WBRA 3G6XA 1UW4A 4KKOA 1JLQB 1S6PB 2LEPA 2CZ4A 2K3KA 2P6SA 4GC7A 3OHBA 2YKNA 4FBTA 3QJLA 5HMXA 4AXIA 4CO5A 1FDAA 2NLWA 4X4RA 3KWMA 3TNVA 2F3JA 1MWYA 3F44A 1E6YB 1HWLA 3R5CA 3OVSA 3VAMA 1RI7A 1LW2B 2ZH6A 1LWFA 4MMOA 3V2UC 4YR3A 2QA2A 3LW5C 4NLDA 4OI0A 2QSWA 2HNYB 2YWKA 4X65F 4YDXA 3B4MA 5HO4A 3SSRA 4ZVHA 3G6VA 2I38A 2LYVA 3GG0A 4FVCA 2Y1RI 1KR4A 4IR9A 5L1KA 2IA0A 2XCAA 1DURA 2CPEA 3ZZYA 2FVRA 2XMVA 5J2NA 1REVA 2ZD1A 2R8KA 4F8RA 4NXNF 1XWLA 2ERRA 3K0JA 1HNVB 3QZ7A 3C6TB 3C3LA 4ED6A 3CO9A 4ZVGA 2KXNB 1S6OA 4OJGA 3ZZPA 3W3SA 3NNAA 4P6QA 5KFMA 2HNYA 2OH2A 2CPXA 3CPWR 2B6AB 2HHUA 2FTRA 2D1CA 1NK8A 4RNMA 5EX0A 2MQNA 3I32A 1ZYQA 3THPA 4WKYA 1AXQA 3D0HE 2PI4A 3FNNA