2LEPA

Solution structure of n-terminal cytosolic domain of rhomboid intramembrane protease from escherichia coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activity-Based Protein Profiling of the Escherichia coli GlpG Rhomboid Protein Delineates the Catalytic Core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Rhomboid protease glpG 1
total genus 18
structure length 63
sequence length 63
ec nomenclature ec 3.4.21.105: Rhomboid protease.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lepA00
2LEPA
chains in the Genus database with same CATH superfamily
4DL0C 2DJWA 1NSPA 2XZTB 4ZPAA 3DOKA 1HR0J 1NH8A 4OYIA 4C48A 3TARA 4IUFA 4EO6A 2OFGX 2MKIA 1X4HA 3W64A 2J9CA 3I31A 1TL1A 1RHUB 2F4FA 1Y3JA 4FVCA 3K5LA 2CWKA 3R5DA 1RA7A 1F0XA 1GNKA 1A0OB 2AJ0A 2N3LA 3CTRA 3JQKA 4MAKA 2ZH6A 4WU3A 2H65B 3KK1B 1WDTA 1M5SA 1NO8A 3D1QA 1HNIA 3J81U 3G9CA 1FJ7A 1VISA 1HBUB 3MPUB 2K7KA 4N8NA 1FDNA 2DO0A 3K5MA 4U67Q 4RJVA 3DYAA 4MKVA 1PYOB 1X5OA 1AZSB 4FVMA 5C7PA 1PO6A 1U02A 1D9FA 2FYXA 1TMJA 1S49A 1ICEB 3L7PA 1KLNA 3C66A 3G82B 2XB2D 4UY8T 3IWXA 1LWEA 4KFBB 3W2VB 4P2XA 5A8KA 4J7CA 4IFVB 1FFWB 2BKPA 5DG7A 3TJ8A 2BKNA 2ZWPA 4DX6A 4MKYA 2ZE2B 4DQRA 5ITHA 5ETVA 3KHRA 1YZ7A 2VQFF 1H7WA 2XS7A 2Z30B 2WBRA 2BJ7A 2OPRB 8RUCA 4DR4F 3KLEA 2UXDJ 3FBFA 1QSLA 2DRDA 1S1XA 1URRA 2XS5A 2AT1B 2AGPA 5C2CA 2YNGA 1HQEB 2XY7A 2RE1A 4DPXA 4RWXA 1U25A 2VA2A 4E98A 3O1LA 4G6VB 1DLOB 1N5TA 1WEYA 2L3MA 1NDCA 4NOHA 4I6YA 4PYDA 3LA0A 2A6OA 3QRPA 2RRBA 4ED3A 2UXDF 1BHNA 3CJ2A 3HSJA 3GB0A 4RR5A 1K1SA 3S7RA 1KVJA 3NS5A 4DSKA 5KFDA 1ZM9A 2DXEA 4HACB 4F3QA 1ZH5A 2WHOA 3IG1A 1DQ9A 2ZH7A 2HNZB 3GIMA 2I8EA 1XEZA 5ETRA 1ZM2A 2R7UA 3VZIA 2GFFA 2RHQB 5F8HA 2MY7A 1X0FA 3MEKA 1TTHB 1T9UA 1RTIB 2Z58B 2ZHBA 3H59A 4HI1A 1N0VC 2QLBB 5LM7E 3UWTA 2XMKA 2N7YA 4CNZA 4LF4F 2HHSA 2P5VA 2FC9A 3NKYA 4NLOA 3JSBA 4EBEA 2OEKA 4PR6A 2K3KA 4ANDA 2E9TA 3MAQA 2CPXA 4CCHA 4JI8J 2B6AA 3MEDA 2HAIA 2DH9A 3HHEA 2JEFA 5G0RB 4RU9A 4DU8A 4FYYB 1U09A 3CD7A 4RW9A 3KK3B 3T1HJ 3FBBA 4NEYA 5D78A 2ZUGA 2XMUA 3DRRA 2NCKL 3ISZA 3MZIA 4N8OA 3O2IA 3TZZA 2CJBA 3CUNA 5EN1A 1FK9A 3BM7A 1D9AA 1N52B 3ZTOA 4C0HA 4CT8A 2FQQB 2LEAA 2B9YA 1F5CA 3J7YU 2CPFA 5IT9U 2G9OA 4EO8A 3CMQA 1W2BR 2M8DB 3LP2B 1HWLA 4ANCA 4X4TA 1KWMA 2HFNA 1QLNA 3G6XA 2PFDA 3OUYB 2D3O1 1LWFA 4MFBB 1G4CA 1GT8A 2JNJA 2J0XA 3EZOA 3GCWP 2HIQA 4TLQA 4EMDA 5DQIA 1X8DA 4CO4A 4OI4A 1S1TB 5HVGA 5D3GB 4WU2A 2LFVA 1NEEA 3VALA 1S1VB 4ZITA 2R7WA 3RRHA 3D6TB 3QWUA 3SFUA 4ED4A 4C8LA 2IC3B 2B56A 4MIWA 1RWXB 4URGA 4M5GA 4QW8A 3DI6B 4LSLA 4NRUA 3WX8A 2ZOGA 2PMZD 2WCXA 1SPBP 1RKIA 1ZPVA 3JTOA 2GHVC 4O0IA 4JV0A 3CJSA 3N79A 2W1BA 2E7WA 3WHIA 2V68A 4TU9A 1TL4A 2XCAA 4DN0A 1GMVA 3QATA 2BANA 2V4JB 4ZJQA 2MSTA 3K0JA 5CZXA 1SB6A 5C42A 2GQCA 2XSJA 3MM9B 2CPJA 2KYZA 2ZNZA 2OSRA 3BKFA 4J9UE 4WBFA 5BYQA 4ES2A 4X4OA 2JVRA 1V9OA 4LF9F 4KKOB 3PY8A 2A2DA 3H90A 4L73A 3HCXA 1FKOB 2IVMA 1CPZA 4ZJLA 5HQMA 2E5LF 3HM9A 5AT1B 1BC6A 3C6TB 1NK0A 1QUPA 4LBHA 2KFZA 1WACA 2HBRB 4M63A 1X31C 1REGX 5EWEA 2YPYA 5KFGA 1HWIA 3CCTA 4JI0F 4LFAF 1MLAA 2VC0A 5LMUF 3FCWA 2BQUA 4ITSA 3T1YF 3SIPB 3QJPA 4CH1A 3OW2R 4ED1A 3HJFA 2ZM6F 1NSAA 1NU4A 1WI6A 4ILRA 4OYPA 4F0MA 4DX5A 3FSIA 2DRBA 3J81j 5CYMA 5HJXA 4XO0A 5L1JA 4L76A 2H4WB 5A8RB 2X1AA 1UW9A 4PUOB 4DJBA 1RAHB 1JK9B 2AKWB 3ENAA 3RAMA 4KC5A 4DX8H 4MK9A 2OEJA 2YX1A 4MIAA 1AXQA 1FNMA 4PG7A 1NJXA 3ITHA 2VG6B 2BOPA 3FGVA 4KHRA 1FFGB 1MNEA 4NCGA 2UP1A 1VYAA 3G87A 4OZ3A 3PW7A 1RAIB 2DD8S 3H5UA 1Y5LB 2F65A 3C16B 5B0GA 4WKYA 4NX9A 2V4QA 3PFOA 2Y1JA 3DLGB 5D0RA 4OI1A 2ASLA 1S0VA 2BXJA 2CPDA 2D3OR 3T6JA 4RX6A 1F6TA 1F9FA 3HFVA 3HHNB 2MZQA 3M9NB 3VHQA 4CYUA 4LFAJ 3EICA 1SIWB 3SMZA 5J1PA 4IQMA 3Q8SB 1TL7A 4FKXA 1H7XA 3BGUA 3OFGA 2YKMA 2DO4A 2GO9A 2QX0A 3TZYA 1S97A 4LSZB 3LP1A 2AEJA 5KFIA 1RT5B 4CRJA 5LXYA 2Z0GA 1WC6A 1D0EA 3PIPQ 3H4BA 2XI2A 3PYDA 4LUBA 4ZVRB 2RIJA 5KG3A 5J2PB 3BGLA 3M8QA 4ZPTR 4EK2A 1CULA 2GIFA 1Q7YT 1HIYA 3NGUA 1L3SA 3NMAA 2DGXA 2C2OB 1M1HA 2C3YA 4RNHA 4GO5X 5GVQA 4Z37A 1KFDA 2E66A 2ZZMA 4K0KF 3IP0A 4XK8C 4YR2A 1NLKL 3MEEA 1N36J 4B9SA 3FEYB 2YKNA 3ZTPA 2LU2A 4B08A 2CPEA 4DSIA 4PWDA 2HBZB 3D28A 1FNOA 2ZVIA 4ECVA 1RWNB 1FRIA 3SSSA 1N5YB 3TA2A 3Q8VA 3DDKA 1W26A 4F26A 2BQRA 4EUVA 1I5OB 4ZVSB 3EMTA 4NXNF 2PN6A 2LECA 3PHTA 2LDIA 1VBXA 2B8PA 1SI9A 3AOAA 2RDDA 4ED6A 5J2QB 1EHWA 1FKPA 5KG4A 1S0OA 4M95A 2YWKA 4TQSA 4I0WA 3BSCA 4KY3A 2QFJA 2R2SA 4X4NA 3K89A 4R0JA 3UN3A 2VOPA 3TAMB 3ZTRA 3SCIE 3MFHA 4FPRA 4E0DA 2C28A 2CYYA 3EUNA 4DPOA 1KC8T 2ZZNA 1TP7A 4EYIB 3L3CA 5H9FK 1ZAXA 2HZCA 3JQMA 4EGLA 1N6QA 3SSQA 2VG5B 1X0PA 3SDEB 4K4UA 4AQYJ 5A6PA 2YNHA 3NS6A 3BQ2A 1NK7A 1HNVB 1SKUB 3TWZA 2BR0A 2QT7A 3OV7A 3M7VA 4C8OA 4P9SA 2IMOA 3I9ZA 4EBCA 4NXMJ 2IIHA 3ET6B 1CC7A 1XMQF 1U2FA 4OYZA 3BB5A 2HG4A 3M6VA 2Q6BA 4V19X 4GKKF 1GFWB 3QFHA 3R5BA 3MCNA 4O3OA 1LEOA 2DGQA 5KFNA 4YB5A 1SH0A 1UMJA 1Q7LB 1WELA 1VI7A 2C1EB 2OAUA 1U2RA 2FUG9 2VPZB 1UFLA 2X7IA 3EZUA 3TX8A 3MURP 1QAIA 3CIZA 4ILLA 3F56A 4R8UA 2WONB 3U27A 3WIVA 4TXSA 5KFPA 1JLAB 1R7IA 2HWIA 3CCQS 3NCPA 3MFIA 2GVZA 4KO0B 1A6LA 2E1AA 4HVZA 1RCXB 4I68A 4ZOSA 4K4VA 3I5AA 4DF4A 1F5BA 1WHVA 1RBLA 1HW8A 1RXOB 2EBEA 3POTB 3QGHA 2LQBA 3S6EA 1S6QB 2DB1A 4H4KC 4USKA 1JXEA 5KFYA 2EWHA 2MQPA 2AJQA 1VRUB 1SUQA 2JHEA 2MTLA 1VBYA 4JI4F 3VAJA 1UEKA 3KHGA 1S6QA 3P5TL 1WKKA 5KFBA 3MUVP 4LFCF 3DHXA 4DWIA 4ZHRA 1OY9A 3IS9A 3TJAA 3DMJA 4BC9A 2GVZB 3TNVA 5DDRC 3RJMB 4UF4A 3TUZC 2CQDA 3LWMA 5C2GA 2R9LA 4KHPJ 2XULA 2EI5A 1QAXA 3ZFVA 2CJQA 4DQQA 1X9SA 5J2QA 2B4UA 5DETA 3RB0A 4OJ1A 2WRMA 1CJUB 1VQ7S 1IR1A 1HBOA 2CNOB 2Z56B 4P75A 3DOMA 5HLFB 2J0WA 4USVA 2VU5A 4CO3A 5CAAA 4A8YA 2PEBA 1B7YB 3CNQP 1F3VA 3R2CJ 1FVSA 2HBYB 3VQSA 3M2UB 1HNXF 4JI7F 4HKQA 2E1CA 1DBDA 1HBMA 1FXLA 3P45B 3RAXA 1B7FA 3R6LB 4R5PB 1APSA 1R0AB 5KFUA 1P1LA 2CPHA 1IJEB 1YQHA 1IBLJ 3OL8A 2HHXA 3HJVA 3C14B 4OI3A 1VQ6S 2B51A 3EE3A 4PG5A 1RE1B 2GHWA 4ZP6A 3TI0A 2GIRA 4CH7A 4NE9C 2VQEJ 3OFEA 4WFZA 2FJWA 2JC1A 2XMAA 4C3MA 4F50A 3ETOA 1F9EB 1XNRJ 1IN0A 3TUIC 3FEXB 3CIMA 3GIKA 2W7PA 1FE4A 2ATLA 5CH7B 4HEA9 3IO1A 4DU7A 1R8HA 2CNLB 1VIXA 4A8QA 4LF7F 1KNZA 2K3IA 3VAKA 1IQZA 1HFEL 5A8WB 4DG1B 2MLZA 3W5ZA 2E29A 5LJ5Y 3DLHA 2B8QA 4JBCA 4F36A 1UETA 3AD7C 1IKWA 4DR5F 4XPCA 1IWGA 2D9PA 2DY1A 4LSNA 1RT6B 3UR0A 1SJQA 2XO7A 2FJXA 1TKXA 4YB1P 2Y8YA 2RHSB 2KO1A 2ACYA 2C3PA 3RR8A 3H5XA 2J0SD 2QN6B 2EVZA 2F9JA 2JWNA 3VGSA 3BQ0A 2YH1A 2VV5A 3MI7X 4B9MA 2C3OA 1T8EA 3C15B 5AXNA 2JL9A 2V9KA 4G1PA 3UD5A 1RHJB 5B0EA 1JLQA 5KFOA 5DS7A 1N34J 3FCHA 1X4FA 5A8RA 3W8PA 1GXUA 3NXZA 4NLVA 1SC6A 4LR7A 4OX8A 1VJQA 2PEHA 1BQMA 1CG2A 1U1MA 5KG6A 4DL5A 3CW2C 3Q24A 2FPHX 1T3OA 2CZVC 2QA2A 3FMBA 3NWRA 1XERA 4ZVOB 1P1TA 1F1BB 2E1MC 4TVAB 1FF2A 4CLZA 2XEXA 3HPOA 1FKOA 2OI2A 5HLFA 2VPWB 4QPTA 2NLWA 1VBZA 1TZ0A 5B0CA 4QU6A 3EWGA 2IYIA 4DN9A 1Q8KA 2CA9A 1NDKA 1N0UA 1X4DA 3H42A 4CLFA 4OX6A 1RT3B 2RU9A 3MM7A 1HQUA 3HVAA 3OXGA 3R6GB 4IDKA 4OZ0A 4FXDA 2BW7A 1HD0A 1T9YA 3F0NA 1U6ZA 3FEZA 2UVRA 3PVXA 2EFQA 5HMZA 1ZZNA 1KKHA 3OSNA 1CEZA 1OO0B 1W25A 3R7SB 3S1TA 1FRHA 1S1WB 2QMUB 2RMLA 3Q8YA 2IPOB 3DOMB 1NPKA 4P7VA 1IBCB 2V69A 3R7BB 2DH7A 2HS4A 3UVJA 3TRGA 1JLCB 3KLIA 5A0YB 1CJTA 4RPFA 4DV5J 3QIPB 3WBZA 4QCLA 5FLXU 5HBMA 2MB0B 3KDOA 3ZC4A 1OPZA 9RUBA 5HVFA 3BJYA 1TK5A 1WORA 3AD9C 4FYWB 3CGIA 2ILYA 2PI4A 3HT0A 3RB6A 3OFHA 2FVPA 2BE7D 4B9VA 3M2RA 2OIHA 2K8GA 1FKPB 1B4SA 3JTNA 1YK9A 4ZHRB 1RYSA 4TY8B 3KUEA 2E1PA 4TYAA 4B17A 3DLKB 1RUSA 1OYEA 1XMOF 4JB8B 1O51A 3KG1A 3MDFA 4O3RA 3QJJA 1WHXA 4A8KA 2ROPA 3DLEB 1FJGF 2MYFA 2BOAA 3AH6A 4J9RA 2ROEA 4KQZA 4DLGA 2DXDA 2HGNA 2HW3A 1I94F 4RNNA 1RAOA 1AROP 3CD0A 2B6AB 5HAOA 4ZKAA 3B54A 4JV5F 2NYHA 3Q2SC 1KN6A 3GPAA 2R2TA 5CD4A 2NXEA 2F3JA 3R5CA 1DY3A 2RDJA 4QIEA 1KONA 2CG4A 2H5JB 2CPIA 2PA3A 2R42A 3AD8C 3M8PB 3KHHA 3Q0AA 2XMTA 1N34F 4X65F 3AQOA 2NPFA 4J9MA 1CVJA 1NZ8A 3MGJA 3CCVS 1G6BA 2VHGA 2U2FA 4Y65A 1RAAB 2DHGA 1R8CA 5SZTA 5IM0A 2MQLA 2D3UA 3MR6A 1PJ5A 1PCAA 1LKZA 3CDAA 1CQNA 3FC9A 3MMCB 4UTGA 5HQLA 2M52A 3IR5B 1XTZA 3BBCA 1IWAA 2V34A 4USTA 1JJCB 2CQGA 4ANEA 4C8ZA 5AXMA 4OX9J 4L75A 5KFZA 2RJZA 2OGUA 1OYDA 2HVZA 3BR8A 4K59A 2XGPA 1YRUA 4ILMA 1JNZB 2X3GA 3LWLA 3FMWA 1RYRA 1FWPA 3ENVA 1YX2A 1LOUA 4Y3CA 4BWJA 1YJTA 2D9OA 2FJDB 2ZBQA 2XMVA 4NPOA 4S0MA 4TN2A 1M90T 2MKKA 2QEXS 3OTOJ 4HDHA 3EGVA 1IVZA 2DR6A 2I38A 2B9XA 4IH5A 2D74B 2BQ3A 1S1UA 1QAJA 2PT0A 4KH1B 3V6DA 2RKIB 3AT1B 3EXCX 3J7YI 2IM0A 3TA0A 2JJ4D 2HZAA 2CPYA 1LWEB 4K8RA 1U24A 2GJ2A 4KFBA 2Q79A 4NLTA 3W2VA 4PUOA 1QVFR 3WDOA 4DV2J 4ELVA 2CZ4A 4IH6A 5CYMB 1R43A 3CC2S 4RL1A 4N77A 4FKYA 1NK9A 1U45A 1YBAA 4OHXA 2BW2A 4HI2A 3MMAA 4QIVA 5B08A 2UUCJ 3NNAA 3OQ2A 3BKTA 3H8YA 3DLJA 2VDHA 3KKFA 3MMBB 2C3UA 1M5HA 2W2PP 2OKQA 2YNIB 1NK8A 2W2QP 2R7OA 4GC7A 8ATCB 4ELTA 1H2UX 2PD1A 2VPXB 3DLGA 4RW6B 1VIOA 4ZMMA 1V3SA 4QYRA 5L46A 3O8WA 3V6HA 2EFGA 5KT7A 2BDPA 1HYSB 2SXLA 1WNEA 1K0VA 3KK2B 2V8GA 1S1XB 1WD6A 4UOFA 5KFJA 1HWUA 3NL0A 2MKYA 3HKWA 5KFTA 4QWEA 2V2QA 4ZPCA 4DFPA 3C6UB 3ZXWA 4DCOB 2B43A 2FJBB 1WUUA 1DQAA 4DX7A 3OJUA 4IFVA 2V4JA 4WIQA 1JB0C 1JKHA 3CXCR 1NJZA 2XYHB 1B3TA 4MJKA 1FJGJ 1PG5B 3OTOF 3SV4A 3GJTB 3BPSP 2A3JA 3AAWB 4YDDB 3GG0A 5AE3A 1KTVA 3HD1A 1MU2A 2DNGA 1XMOJ 2LQ9A 2YKOA 3DI6A 3HX9A 4LSLB 1WTFA 2DIUA 4H4MB 2QO3A 2XM3A 2L41A 4ECXA 4MIBA 2VBZA 4ZVEA 3RTVA 3QAUA 4NCAA 3PKYA 4NCGB 4QJVA 1URNA 5A6WA 4DUYJ 1N5QA 2WAQD 4KRWA 1RZMA 3IAS9 3IMQJ 4DCPB 3MPVA 5KOXA 3WC2A 2R7TA 2QZ8A 3UCUP 4DOZA 4LMZA 4DR3F 3W3SA 5GAEU 2R2RA 2KL8A 3OUYA 1RADB 3N01A 1TK8A 1Q78A 3J80Y 3ILOA 2WVCA 2OTLS 2UUCF 2M7SA 1IQTA 1IBMJ 4LR8A 4L3KA 4MMOA 2V5HG 3A3PB 3CVKA 1X7VA 2R8KA 1E6YB 3HULA 2R7VA 2ZHOA 3QT6A 3AHPA 4DV2F 2NR0A 5F8IA 3I0RB 2AV5A 4PYAA 5CABA 5I3QA 4ED5A 1O8BA 1FXDA 1Y5NB 2WSCC 5HP1B 1XIQA 3ICLA 2KM8B 3CF5Q 4ECYA 5KFLA 4DSEA 3CB4A 5HMWA 3OSPA 1DTQB 3I87A 2W24A 4NCBA 1G2EA 1FT8A 5E3PA 3BBFA 1DAXA 1RWWB 1TR0A 2LEBA 1NKEA 4LFBF 2WVFA 4WFNQ 4HT5A 2QLWA 3BO2A 2N3OA 2AMCB 2HFVA 4RWWA 3W2WB 4P7TA 3T19A 2WW4A 3K8VA 1HNZJ 3CJ0A 4IO9Q 1P8GA 1IBKF 2AYBA 2W2OP 1SH2A 3BREA 3GWCA 3EX7B 2EW9A 4HYKA 2HNYB 3MM8A 2VFRA 4Y2MA 2FJVA 4WP8A 3FSYA 1LXNA 1BXNA 1WHWA 3RW7A 3UCGA 3W1YC 4YFUA 4OL8A 4NA1A 5KFHA 1FDAA 2HNZA 4YR3A 3MM5A 2EG2A 4JV1A 1QY7A 2F9DA 3KXDA 1RI7A 1JWWA 2HWHA 3GR1A 4X62J 3G71S 1G1XA 1UVKA 3OT9A 4EFAC 4K5SA 3TQ1A 2JLEA 1VQLS 2FLPA 2UUAJ 4Q0BA 2LA4A 3TO8A 3M8ZA 2EG1A 2IRXA 3ZZZA 1SQEA 1UKUA 3GYGA 2AWZA 3TR5A 1L5UA 2PO4A 3ZTSA 2ZWOA 5DG9A 1C1BB 3HDSA 3LP2A 3IM8A 4X4UA 3UCZP 3V81A 2HFUA 3KJNB 1RT1A 4ID5A 2B4PA 4I2PA 4L72B 1Q82T 3OLBA 5ETQA 4A8SA 1UJ6A 5IS2A 3FZBA 2CADA 1NJIT 2MMYA 1KEKA 2XBPA 4H4KA 4I4BA 1R8BA 1BY9A 4YUDA 5IZHA 3PNIA 1F9HA 1HI0P 1RAEB 5HATA 4KGKA 2UUBJ 2V67A 2V8VA 2O1PA 3THPA 4CLYA 2XWYA 4OYBA 4ECQA 2RRNA 3ADAC 3AXKA 5AJ3F 3QSYB 2KVQE 1H2TZ 2YBVA 3CD6S 2W9BA 1AZSA 4ZLNA 5JMNA 1NB7A 4DV3F 2JEJA 1CS4A 2Y1RI 2RAQA 4K4SA 1VQSA 1YBTA 2XYGB 3TVKA 5F8JA 2DY9A 2Q3PA 1OSDA 5GMKa 1NKBA 1EKRA 4F02A 2F5GA 4HHUA 4NYZA 3KK3A 5GMDA 4LF8F 4IOAQ 5KT6A 1EETA 2MLYA 4FNIA 3J80U 1PAUB 4F4XA 4I67A 1JLGB 1M1GA 1QE1B 4F4WA 4ECZA 4JYAF 3TANA 1DURA 1FXRA 1VC5A 2QTWA 1TKTB 3N28A 3ZZUA 4DCJB 4IO1A 4F2RA 2G4BA 1REVA 3MM5B 3T9NA 4AD6A 2B4OA 4ZCMA 3MPYA 4D3GA 3S8SA 4WKRA 2Z2LA 2AJFE 3GFYA 4HACA 4RUCA 4K2JA 2VASA 4KYZA 3CEDA 1TUWA 2X51A 2ZDOA 3TQEA 4DV7F 1I1GA 3M8PA 3D67A 4C97A 1EKSA 3EGWB 4ZLLA 1NUEA 4ID8A 1X5TA 3E3XA 1OMSA 2V94A 4CO2A 2I6WA 5IWAJ 2LKZA 3U1NA 5IFMA 4DSFA 4C4WA 4ZPWR 2W9BB 2DNYA 2PMHA 3HZEA 3N6MA 3TA1A 4CLKA 1R89A 2HVDA 4OLOA 3NBPA 3N6LA 2ZE2A 2C2DA 3SZ2A 3RBDA 3RRKA 3HI9A 4U7UK 3X1LB 4O4RA 3KK1A 2H54B 3FQLA 1Q16B 2JC0A 1SJ1A 2VKZG 4J9VA 3E01B 5D77A 2GMLA 2WTFA 2MQ8A 2IYGA 4DPYA 2HGLA 2VBXA 3MECA 2EEYA 2ZH1A 1C1CB 3PJXA 1YJRA 1TL1B 1JQGA 1Z4UA 2I1RA 1AW0A 3M2RB 3QGIA 1VLOA 1C4AA 3F41A 1O0PA 4ZPBA 1H6KX 4DV1J 3EVWA 3IM9A 4KPCA 3LALA 3DYAB 3CJKA 1C1BA 2HS3A 4LRDA 5AE2A 3RBEA 3DXSX 2ZBRA 1DTTA 1Q79A 5T7LB 5FIIA 1MROB 1SH3A 2HRYA 3O6QA 2X3DA 3BYRA 3GE9A 2R4FA 1HNIB 2HFZA 1FJEB 4PG8A 2OSQA 4M5LA 4ECTA 3UVJB 5D4LA 3I0RA 1LK5A 2MSSA 3GJRB 4ZVUB 4YP3A 4DS5A 3PW0A 2QRRA 2ADBA 3KG0A 3P3DA 3RW6A 4AXIA 3QLHA 3A8IA 3MR5A 2ZVSA 4DV0J 1UL3A 1SV5B 1VLYA 5CD4H 1VQOS 3BDPA 3K59A 3K2YA 3A4TA 5HP1A 1AB8A 1RT7B 1RAGB 2IRUA 3HKZD 1RWOB 4X64F 5AJ3J 1S72S 1U48A 2L9WA 3DHWC 1JKHB 2UV8G 1E6VA 1HW9A 1E6YA 1FEHA 2HWTA 3MM7B 2AU0A 3IGVA 2E5IA 3AA9A 1RACB 3GLJA 4WYWA 5IQQA 2DR8A 1JLBA 1OSCA 1RAFB 1TL3B 2BYCA 3QLHB 4IG3B 4RBUA 2FIUA 3UDEA 4PPZA 1PJ7A 4Q2LA 5C25B 2KXNB 4PQUA 4P73A 2KVIA 3GIRA 1NH7A 1SJRA 3PM9A 5F8NA 4F25A 3OFFA 4IG0A 5E41A 3J7AN 1YI2S 1PC5A 1X4GA 4ZS6A 3MAAB 3W65A 2EFVA 3TZWA 2HHVA 3UPFA 4RUAA 1RTDA 1HBNB 1MMLA 1TUGB 2KT3A 2Q6CA 4PXCA 4J91A 3VWSA 5EGYA 3G96A 2VF3A 3PRDA 4C11A 2FHKA 3QT5A 4NI2B 2NUUG 2OLWA 1N5VA 4WYLA 3DU6A 2OMOA 3JAMU 2W9AA 4WF9Q 1LWCB 1IKXB 1OPIA 1P27B 4FN5A 3PO5A 5GAHU 3A1YG 2KB2A 1RSCA 2CQ4A 2K06A 4P52A 5K8OA 2RRAA 2J6SA 2CKWA 1NBEB 3N5BA 3NY0A 2C2KB 2CVIA 4X66F 4DUYF 2NQPA 1HHTP 2ZKUA 3KG4A 1B0VA 3PFEA 3AB4B 4KTQA 4ZPDA 2R8IA 4X4RA 1S1UB 2G2ZA 2B5JB 2RUSA 3BDEA 3D54A 3QSIA 2HLUA 2W7AA 4K4WA 4YN3B 1PBAA 4ETZA 4DV4F 3TEHB 1B0PA 1UA1A 2FLOA 5KFMA 1WEZA 4ZLJA 1YJUA 2DEIA 2X1FA 1Y11A 5E3AA 4ZN1A 1MU2B 2MZJA 2NYIA 3ENQA 1V5VA 4M5HA 4ZK7M 4LRFA 2ADCA 2BE2B 4AE5A 4H4OA 1WC5A 4O0NA 1FRMA 1XNQJ 1RTHB 3N5FA 1CJKA 4JI4J 2W01A 3NOCA 4K4TA 4K2XA 3DDIA 2GMHA 4ZVFA 3GQCA 2LU1A 4DV6F 3UNGC 2ZJQQ 3H25A 1RCOB 3BF4A 1U47A 5FDLA 1NPPA 3BN7A 5CQGA 3W66A 3SFGA 2RUGA 3W7BA 1EJ7L 5ETSA 2HHHF 3RYLA 2RF2B 3IN5A 4DEZA 1S12A 1UFWA 3GSDA 1ZA1B 2VG7A 4ZVHA 2O66A 3AXMA 1HMVB 3TUPA 1C0TA 2GO8A 2A0FB 2H5IB 1KS2A 2IAJA 5J1EB 3PW4A 1AT1B 1UVNA 4YHHF 3EVOA 3NEKA 2YY3A 5CCMA 5E0OA 3VZHA 4AYBD 1NZAA 2IM3A 4QW9A 4F3OA 4RUBA 2RSQA 1FEEA 1V3ZA 1X60A 5F0WA 4BCAA 4DZDA 4N76A 3OXLA 2RDIA 2CNKB 1VK8A 2BJ8A 4OJHA 4WK1A 5THWA 3WC0A 2W9CB 4B3RF 1LQ9A 3R5AA 3CJTA 4Z7YA 2M5YA 3M1VB 2AEFA 1T0TV 1Y4ZB 2RKIA 2BJ1A 3W60A 4RNFA 5BR8F 3SEOA 3TUJC 1XR5A 3DGPB 1AYEA 4KAIA 3DRPA 4HDGA 5M2UA 4N41A 2MDAA 2V2KA 2N7CA 5J2NA 2RT3A 2DGWA 5CXTA 4G3IA 2X1BA 3E8OA 1BUXA 3IAM9 3NAHA 2F4VF 4B3OA 4WE1B 2M3DA 1Q4RA 2ZC4A 2RILA 2ZBPA 2MZTA 2AEMA 3MR7A 4P6QA 2HKEA 4JI5J 3FKBA 1XNRF 1WJ9A 1LFPA 1R0CB 2HRTA 2HQ3A 4I2QA 1U0HA 2FC8A 1HPZA 1NHKL 4F0KA 2ZOMA 1M1KT 4MH8A 1FERA 2OD4A 3NGKA 4DQPA 4C7QA 2XO6A 1T03B 2M88A 2KXFA 1HHSA 2CQ2A 2MJNA 3QQCD 1PJ6A 2JRSA 3QO9A 4C8NA 4Q8EA 3LGMA 4PAAA 1R27B 4L74A 4URSA 4LQ9A 2W7OA 1JLAA 1Q95G 5DJBA 2OH2A 1CJVA 4WFYA 4QIFA 1FKAF 5E3QA 4DSJA 1TQLA 4D3HA 2AZ1A 2MKCA 5B0DA 2QSFA 2AF6A 2VPYB 1KVIA 2QA1A 4CI0B 1T11A 2HS0A 3FQKA 4FXWA 2DGOA 3OTBA 2QMXA 5DRKA 1ZTTA 2KG0A 2NXCA 1TU0B 1D9DA 1S9GA 4DR5J 4V19J 4CT9A 2V2ZA 1D3WA 2BJDA 3LAKA 1UPMB 2J7KA 3K8WA 2MJUA 1N88A 2MKHA 4WCEQ 1WF1A 2H9ZA 2ZOFA 3PDNA 4KT0C 4KGZB 4B3TJ 4B3TF 1RP5A 1RDRA 3CO9A 3DOLB 3PW2A 4LFBJ 1VC0A 2LQJA 3DLKA 2RQ4A 1NK6A 2VD3A 3IR7B 4USHA 3MXHP 5CA5A 5HQ8A 3VAHA 3I5BA 3MF5A 1JXLA 2KFNA 4QR1A 3MR3A 5HMYA 1RLCL 4DS4A 4P71A 2LVWA 4NLUA 2AD9A 2YWGA 1JIHA 1KOOA 4LT6A 1IM4A 4M5NA 5ETMA 4X4PA 2PE8A 3LH2S 4DV5F 3PYFA 1IR2A 4ECWA 1BWEA 1H0HB 3LP0B 3TX0A 3MOJB 1U1OA 1NSKL 3PR4A 1WOSA 1KR4A 1VS3A 4B3SJ 1YSJA 4RW7B 3EPGA 4CLLA 2CJAA 3GYXB 4M5KA 5CZVA 5HANA 3P49B 1TKXB 1WKLA 5KT3A 2CIMA 1U2CA 1V3RA 1CC8A 2JLFA 2QJ3A 1TFWA 5LOQA 3PIOQ 2OELA 3HHLA 3UN5A 4JV2A 4H4MA 5JJBA 1RWPB 3PHEA 4HHHA 4CQ1A 2XZWA 3I56S 2ASYA 4RW8A 4RW4B 5B09A 1YVFA 1AFIA 3AB2B 4KV8B 4GKJJ 3MEEB 4XDDA 1LFWA 1N54B 2IJFA 3CDEA 4DUTA 1BQNB 1J2VA 1VOMA 2CVEA 2ZITA 3PEJA 2BJ9A 1WF2A 3MPWA 4CP5A 1PBUA 2KHDA 4YDXA 5IWAF 3JYTA 4NASA 1H74A 1D09B 5B0BA 2Y0SD 4C8YA 2HEKA 4GKJF 5I42A 1A7GE 4LIRA 4BC7A 3M6UA 4PKDB 4C98A 4KPYA 4QYZK 3WZ0A 3T1HF 4NWBA 4DR4J 2YNIA 3IBFB 1YLXA 5ETKA 4CYUB 1RQ0A 3PW5A 3Q22A 5F3ZA 3NCRA 1M5OC 4LQ3A 2Q66A 2KJVA 4LSNB 1PKUA 4FXVA 4B9TA 1FFSB 3B4DA 1SXLA 2C42A 2XMJA 4PXBA 2DR5A 4DDFA 3KMQA 3PXGa 5GADU 1WOOA 5ETNA 3HHDA 5I42B 2B9EA 4YMEA 1ZA2B 3ONQA 3P96A 3JYTB 2V0NA 4RW7A 2GVDA 3JB9k 4J9PA 1BQNA 4JI1F 3LP0A 1Q81T 4U7UD 2ZM6J 5B0FA 1WC4A 2B4VA 2GVDB 3I6PA 3G6VA 2QA4S 1N33F 1NK5A 3DXBA 3OBIA 3DCAA 3QRRA 4L3NA 2ZZTA 3EXYA 2UU9F 1KBRA 1U1PA 1PSDA 2YQ0A 4GVBB 1IKWB 1BWVA 5D4NA 4ER8A 4ECSA 1UZDA 4CIOA 3GILA 1EX8A 2VFTA 4KGXB 4TKTA 5HN0A 1KQSR 2VA3A 4P2FA 4LF7J 2DKOB 2XCPA 2UVVA 2AYEA 1NKCA 1JJHA 1VRUA 1FX2A 2DH8A 3BS9A 3M2VA 4K50A 1I6JA 4NYPA 5D4OA 3M4XA 1I51B 4NA2A 5U47A 3BGRB 4Y2CA 3SQGA 4MKBA 5DQHA 4ED2A 3MMCA 2DXFA 5BYRA 3QZ8A 2GGPB 5KT5A 1MN9A 2HGMA 2QA4G 2YH0A 3N4WA 3DGVA 2LA6A 4W90B 2RS8A 4AFFA 3ILLA 3QAEA 4Q7AA 3L95X 1HKAA 5GAGU 4CLUA 1K1QA 3TZXA 3RG6A 4B9NA 3GCXP 4OYOA 4YHHJ 1RT4B 3DKDA 2XSJB 3G8TA 4JI1J 1FDDA 2IJRA 2MKSA 3CCUS 4B3MJ 2E9ZA 3NMRA 3HSGA 2IBKA 4LF5J 2HMIB 2F8HA 1YGYA 3KNGA 2P6TA 1IKYB 3MTKA 1PIEA 3OHAA 3I55S 2BBEA 3I0SB 3JTPA 5J2MA 1LV5A 5A2QY 1EZZB 4LIWA 1S7IA 3HHLB 5L9XA 4ZCIA 4FDFA 3CCZA 3T41A 3U7JA 1VCTA 2BMBA 2ZNYA 3D6FB 3SQOP 4BHQA 1Q53A 4KGMA 4CWBA 4MYTA 2IMWP 2Z2MA 2WB1D 4C2MA 5HROB 2N4DA 3GYNA 5DDPC 1NDPA 2KT2A 2VG5A 3B4MA 2RQCA 2VJUA 1I94J 3VF0B 1LWFB 4MFBA 5A76A 1AUDA 2CQBA 1S9EA 4QIWD 1OWXA 4WP9A 2ZBIA 4HH1A 1H72C 5GMEA 2YVSA 3GONA 2D7SA 5BR8J 4TU7A 1OY6A 4J9SA 4CO1A 3MD1A 4B3OB 3CMES 3GIIA 4WJBA 4U8VA 5EDWA 3IS9B 4HR2A 4NLGA 2J9DE 3C19A 2RU3A 2A10A 1GX6A 2Y3YA 5FD1A 1SUQB 3T5LA 3AOCA 2VIHA 3DRRB 2OFHX 3M32B 1QTNB 2ACMA 1QD1A 2AJ4A 2WB4A 4HTJA 2ZDPA 3K7RA 4DLEA 2IY5B 1FVQA 4NXNJ 2KZZA 1T05A 1XC9A 3C3LA 2BX6A 3D9BA 3W5YA 3G4SS 2BE9B 5F9NA 4QYZJ 4UOCA 4FPIA 3T9ZA 3M8SA 1HI1A 1UWBB 2M4MA 2XYPB 3TAMA 2HHHJ 4R8UB 5KG5A 5J2NB 2MZSA 1GAOA 2Z2YB 4UQTA 2ASDA 2UXCF 4DL4A 1RTZA 5D4PA 4LR9A 3MR2A 3CCSS 3QJLA 2OJ3A 3RGIA 2KG1A 2ZH4A 1CULB 2YKPA 1CJVB 2ALZA 2W9CA 2ERRA 2HBQB 1U8WA 2MQQA 2ZUAA 3RB4A 4AXJA 2GV1A 4CNYA 2QL7B 4KR0B 2NXUA 2HRUA 3CDUA 2OP5A 4CM2A 5F8MA 2F40A 4A4JA 5KFKA 1LWXA 2D3ZA 4CLTA 2R3VA 1N48A 1HWKA 2YNHB 4DV4J 2IDEA 1RHKB 2BABA 3CSKA 4KH0B 3QZ7A 1VRQC 2QL5B 5J1EA 3P6YC 4I2QB 4JI3F 4B3RJ 1VK3A 2LP4A 3D0IE 1SKWA 1O6XA 1QTMA 3GG1A 4QR0A 3O44A 2IVFB 1VQ4S 2XLKA 1IXKA 3BGFA 1JLQB 3C8YA 1F5AA 1RHMB 2J8SA 2YX7A 1KDNA 3C15A 3K17A 4LRBA 5LL6d 3PX6A 3CULA 3CD5A 3M1VA 4RNMA 1BGXT 3W9IA 1TELA 1TL7B 3I5CA 4OHWA 3I82A 1VC6A 4X65J 4BBYA 2ZD1A 2DHAA 2E5GA 4I6AA 2OD6A 5KFXA 3ZNUA 3GV7B 2UUAF 4CTAB 3G82A 1MN7A 5ETLA 4J9NA 3UD4P 4I64A 3FK4A 4JYAJ 4GVLA 6AT1B 1UA0A 1Q1KA 2DCUB 1RHRB 2XNRA 1UP1A 3LANA 2C2EA 4EZ9A 4QBUA 3NCQA 4Y28C 5D0GA 3G2XA 3O5TB 5KFQA 1J5EF 2B5JA 4F2SA 3KNAA 2HVHA 3DNCA 4ZPVR 4URQU 4PCQA 1N32J 3LOUA 4DR6J 4ZVGA 4ZP8A 2VUGA 2FJEB 3HFZB 3ZZPA 2C2ZB 4QIGA 3HHKA 3M8QB 3R7NB 3VVTA 4EWTA 4NEZA 3IWLA 2B0GA 5IT9Y 5LSLA 2DPJA 3OL9A 1ZAVA 1X4CA 1JLBB 2FHOB 5D0EA 4RNOA 4PPDA 4X64J 1OIAA 1FESA 1WSVA 2MQOA 3X3UA 4MK7A 4OHVA 4WIIA 1K8AT 3N6NA 1RTDB 3D3BJ 4PWWA 3FDSA 2E5JA 1VRTB 1X4EA 5KAKA 2DRAA 1Y0HA 3SXLA 1EB0A 4RW4A 5KG1A 3UE2A 2FGCA 1NDLA 5DGBA 3MCOA 4WXWA 4DFKA 5DDOC 1VQ8S 2Y0BB 2CQ3A 4OHZA 2IA0A 4LF2A 5I3UB 1KOHA 4Q43A 3VAFA 3JXOA 2PMWA 2CQCA 2CWXA 2CPZA 2P9GA 5IXUA 4QWBA 3RRGA 2IM1A 4A8FA 3W61A 5MLCV 1M5VC 4IRDA 4J90A 1FTCA 1VQPS 2RNEA 1D1UA 3MM9A 5J1NA 1Q8BA 2P2CB 4QWCA 4IR9A 4LF4J 4ZP9A 1LK7A 4JV5J 1VQYA 4X4VA 4LF8J 1MROA 3CCLS 4BLGA 2DNHA 2F1FA 3PYGA 3E2EA 3NNCA 3IRXB 1RT7A 2LXFA 3SSRA 4YB7A 5L8RC 1XBWA 3THTA 1PAEX 4CLWA 3PACA 1R31A 2KXHA 1HA1A 1AFJA 1BMQB 4NLSA 1SCJB 3PJWA 3LW5C 1BLUA 1F60B 1X5PA 3D4JA 1GMWA 1QVGR 2FVQA 1XNQF 3FNNA 4ZN3A 3MEGA 3ULHA 4RKUC 5B0AA 2YWWA 3DOLA 4YS2A 5CYQA 2LMIA 1U0HB 3HVRA 3M6XA 3POTA 3ETMA 3Q2TC 2XTJP 4C3LA 1ZS6A 4QQBA 1T9XA 2WVBA 3THVA 2VONA 2WW8A 3H2LA 2BVZA 4KO0A 4O3PA 4CLPA 1SJ3P 1ELOA 3HP6A 2W4CA 5LJ3Y 4DV7J 1HHQA 2YWEA 4WZMA 5LMNF 3DRSB 4OHYA 3JSYA 1U1QA 3DRPB 4A47A 1K47A 1NM2A 4B9LA 4Q44A 4EU0A 1FK9B 1E6VB 1WC1A 3ILJA 2F8MA 4N7TA 5F0UA 4LBPA 2DR7A 2NSBA 2CJ9A 2CJKA 2G13A 1RTIA 3IBWA 3OL6A 2JSXA 3OL7A 2FVRA 2R7XA 1K0TA 3FBCA 3CC7S 3W8GA 2F63A 5K9FA 1VQNS 2IC3A 3TAQA 3ZZTA 5C24A 3ZO7A 5G0RA 4K4ZA 2H4YB 3GFZA 1S1VA 4OYMA 1HD1A 3FUYA 2ZJRQ 4CM0A 1TL5A 2MHNA 2AQ4A 2OPPB 1S1TA 5LT5A 4J9LA 2ZFHA 4ENOA 4QU7A 2I5JB 1EETB 2HYIB 2AYMA 2DHXA 2HFSA 1YKWA 3CWJA 4EZ6A 2F4VJ 2ZH9A 1T9TA 3GP9A 2BRKA 3RB3A 1GX5A 5IC4B 2O67A 3EDQB 4CO0A 2V4RA 3MWBA 3SBMA 3D5MA 4F67A 4O3SA 4AQYF 2V8HA 3PV8A 4DMZA 3V6KA 1TAQA 1TKZB 4LF1A 5I4MA 2N82B 2XY5A 4AL6A 1SL0A 2HQCA 5HVHA 3LO3A 2VODA 1TKTA 1IKVA 3MMJA 3Q8UA 3ZZOA 1D8YA 4M94A 1JLGA 1QE1A 1T02A 3HVWA 2UU9J 4I56A 3HFKA 2BE2A 2KT5A 4N56A 2QV6A 5E7OB 4NA3A 5KFWA 3BPDA 3K58A 1FRXA 2JOQA 2M2BA 4ELUA 5L1IA 1SKRA 2H3EB 2ZEJA 3UW1A 4Q2MA 1RT1B 3V6JA 1CS4B 2CDRB 3LTOA 3BQ1A 2NXJA 3RAQA 1NJYA 2VOOA 3AY0A 3TW0A 3AJDA 3BGOP 1JJ2R 2OEMA 2Z2ZA 4OX7A 2IFXA 3GV5B 3T5HA 2IDLA 2WBMA 3AQPA 1I3OB 1IM6A 2W4DA 5L9NA 4JI6F 2HQDA 5DQGA 4TU8A 1SJ4P 4TQRA 3PYEA 4OZJA 1VQ9S 3FFIB 4X84A 2G2OA 1W7WA 2DGTA 2YNGB 4Z2XA 4DQSA 5ETPA 1CSJA 3OR2B 3RR7A 2D69A 4NXMF 3KLEB 4KGVB 3E51A 2ROGA 1L3TA 3O3LA 2VC1A 1U7LA 4I7FB 1TKZA 4DQIA 4NI2A 3OR2A 1QM9A 3DM2A 4GMKA 3V81B 2MEWA 1CJKB 3FFIA 3GU0A 3KWMA 4IQXA 2JEIA 4NLXA 5JXSA 4Z7CA 4ES3A 5D15A 2LLZA 4EBDA 4PG4A 5KTQA 4P10A 1S6PB 4IKAA 1RB0A 1YRTA 5JUMA 4O4GA 4K5RA 2I5JA 2UVWA 3GV8B 1U8SA 2FGOA 3MPDA 1VR6A 3W2WA 4ECRA 5D6GA 2OPPA 3CC4S 3DDNA 4PZVA 2DR9A 4IR1A 4OX9F 5MAOA 2QYGA 4OZNA 4USWA 4WTOB 2OPRA 1TL3A 4K7QA 4PABA 2YPZA 4E2FB 1VHIA 2PSZA 3QIDA 4CZCA 2UXBF 3ELHA 4OFZA 1KFSA 3HSZA 2WZ1A 3ZZRA 3K5PA 1T7PA 5KG2A 4KIAA 2HNYA 3BSAA 1WTBA 5KG0A 1EP4B 1HNXJ 4OI2A 5M2RA 3DU5A 4JI7J 1S57A 5I3PA 1C0UA 4PQAA 5HI7A 1EARA 4F0HA 3BKUA 4B3MF 1T9WA 1XJWB 3DRSA 2L48A 4ECUA 3NLCA 4TNOA 2IBOA 5GADI 3BSOA 3H2VE 1QJHA 4ID5B 5EX3A 1NRKA 3D0GE 3FSXA 3AODA 3UN2A 3J7A1 2OHDA 1GXTA 5K20B 1N36F 5LMNJ 3R5GA 2NS1B 2VBWA 1J5OB 5ADZA 3MUMP 3H98A 4B02A 1S59A 3NOGA 4O3NA 5T14A 1DTQA 3MAAA 3TAPA 2GMJA 1XK8A 1YJVA 2J7UA 2U1AA 2YXLA 3BH6B 3C6TA 2E7XA 6FD1A 2P9CA 4UY85 3T1YJ 2P9EA 6FDRA 1GMWD 2O01C 2MGZB 3H5YA 2CQ0A 4A8WA 2DCLA 2QG9B 3OR1A 4YY3J 4P2SA 3OVSA 1YG0A 2M9KA 5KOWA 2DPIA 2QE5A 1RK8A 1SC1B 4BDPA 2BKOA 1NHUA 3S01A 1NHVA 4WFBQ 2LQ8A 2OPSB 1SIZA 1FDBA 4XPEA 4NRTA 1YJNS 2DNRA 1HNWF 2VQFJ 1VDHA 4ICLA 4IRKA 3WX4A 1IUJA 2COLA 5AE1A 2ZHAA 2EPIA 2C2RA 3MTJA 3NGSA 9ATCB 1YHQS 3H4DA 4JI6J 1RTJB 3EM1A 3GJSB 1WG1A 3BEGB 2E5HA 3JSMA 3M9OB 2IJNA 2WSEC 1KD1T 1EIYB 1NMEB 5D3GA 1RBOB 2EC2A 2GJFA 5HMXA 3JSMB 2OTJS 2H5EA 3J7ZT 1YRXA 3HK2A 4O4GB 3M30B 2YNFA 4NLWA 3EPIA 4F4YA 5K14B 1ZYQA 2NREA 4ZIVA 2LXIA 2AIRB 3A3OB 3MMBA 4WP3A 1H3DA 1B70B 2CQIA 3OD2A 4L6V3 5DZ7A 1LW0B 1TUVA 3PRVA 3CJKB 4DPUA 4HTIA 4XTTA 2RVJA 2OPSA 2GNKA 2GX8A 3HVTA 3C6UA 3TYTA 3D1HA 3BN4A 3DC2A 1KQGB 1Q5VA 2XG8A 4OI0A 1EP4A 3KHLA 1FWLA 1VQMS 2C3MA 3R2DJ 1LXJA 2CDQA 3US5A 2ZH3A 3OTEA 1H98A 1HR0F 2CQ1A 3FRZA 4F8RA 3ZTQA 2AJ2A 3V6DB 2G0CA 2CZ9A 1UJ5A 2GJIA 3NBPB 3KLFA 3L7UA 1DARA 4NLPA 1OQ3A 2FY8A 4AT1B 1B64A 2Z57B 5E33A 1Y9OA 4DZ6A 4GO7X 3SCKE 2W2NP 1ITPA 4OZ5A 2XQCA 2JEGA 1ULRA 1S6PA 3BR9A 3FCVA 4CTAA 2O3DA 2J9EA 1KVKA 1S6UA 1VRTA 3EYZA 4KJIA 2DNNA 1O5JA 3Q8QB 3DN9A 2KRRA 3A13A 3CJ3A 4UQGA 2PGCA 4CLSA 3KLVA 3D3CJ 3P4UB 4J9OA 5L1LA 3IRWP 3HHLC 4I7FA 5HJYA 2IM2A 5IC6B 5BJRA 4Y2IA 7FDRA 3IG1B 3KDNA 1FCAA 4NZ7A 2MKJA 4I2PB 1MMNA 3KK2A 4B9UA 2HSEB 1TAUA 4ERDA 2WVEA 5K8PA 1FHTA 4H54A 1EAYC 2HHTA 4ZVQB 4UOGA 1HWJA 1P9QC 3CE8A 4DI6A 4DL2A 1U1NA 3T3FA 1JJ4A 4U95A 2FZGB 2ATCB 2Q1LA 3UR3C 4DBQA 1UJ4A 3W9JA 2XZDB 1WC0A 5L39A 4KSEB 2XS2A 2F7VA 1F2GA 2UUWA 1U0SA 3MMAB 2JFKA 5KFVA 4MYUA 2QLJB 1Q8IA 1HQEA 3D66A 2C22A 1SQGA 2QGFB 3DM2B 4HL9A 5H9EK 2UUTA 4LVOP 4C3KA 4ES1A 3RZAA 1HI8A 2DTJA 3D1OA 2J5AA 3D6HB 1YZ6A 2DYAA 4YY3F 1M5KC 1RLDA 2M0GB 3GTYX 4OIXA 4JUZA 4QZVB 3EJMA 4X4SA 3U02A 4IOCQ 3MM8B 1UVJA 2EKNA 2CG8A 2K1RA 2VFVA 3KFWX 1MWQA 1CLFA 1WSRA 3UQSA 4F4KA 2W4PA 4GRSA 2JLGA 3H2UB 2FHJA 1T3NA 3D7SB 2ZKTA 2UXCJ 3VGUA 3L9ZA 1ZAWA 3MCMA 1PYSB 3AJ2A 1SC4B 2RQMA 4X66J 4WFAQ 4FZVA 4FS1A 3R5JB 3DRXA 2GC8A 2POKA 2NZCA 4NL5A 2MXYA 3OVAA 1MWYA 2QIFA 3M8WA 2AJ1A 3V4MA 1HBUA 2CNNB 2VJVA 1FRJA 4U96A 3HD2A 4ZJOA 4UT4A 2FHMA 5CYQB 1MW7A 4ED8A 3FBEA 1KRPA 4Q0BB 2X1GA 1KHWA 2W8LA 1VGYA 1L3UA 3T6BA 2GW8A 4QWAA 2A6MA 3OHBA 3PR5B 1IKVB 4IYQA 5IQ6A 3PZPA 1BQXA 2AX0A 4TY8A 5H9FJ 2RB7A 1EQMA 3C2PA 2V8PA 1MG7A 3LGHA 4IFYA 5LMUJ 2HURA 2ILZA 3CO0P 2G0JA 1S77D 4YB6A 2DVIA 4BS2A 4NZ0A 3NRBA 5EWGA 3CCWA 1S99A 4JI3J 3JS9A 1KLMB 3IR6B 3QYYA 4CH0S 3G6ES 3I96A 1X4AA 4PEOA 5HBMB 4P74A 1VQKS 1SVDA 3A3NB 1HNWJ 1Q0NA 3PJ9A 4A8MP 2Z4PA 5HROA 1SKSA 1CJTB 2ABYA 2KI2A 4DL6A 4OJ3A 4DFJA 4AL7A 3HHLD 1CBKA 4Y2KA 2DNZA 2GA7A 1AA1B 4OYXA 5D0HA 3K5OA 1RA6A 3R3TA 2B7CB 1GMUA 2XWXA 4Y6IA 1B99A 2DGVA 1LW2B 3MUTP 3M9MB 2R7RA 4C8KA 3RBXA 4Y34A 3QT7A 2KZMA 2BUNA 2FDNA 2YQ3A 1YITS 1MWZA 1ROFA 3MEGB 2EK6A 4G1IA 1RU1A 2B3TB 1X9MA 1HQUB 4IDKB 4DPTA 3A8KA 5GAHI 3KJVA 3LPEA 1RT4A 4IOBA 1ZM3A 1X9WA 2OUGA 1FX4A 4U6PA 2ZBCA 1UPPA 4F04B 3D2WA 3IRXA 4W92B 3MM6B 2D1CA 3CJ4A 4I1TA 3R1LA 3SI8A 4PRFA 2J0QD 4DV1F 1R6YA 2XMWA 3GR0A 3G86A 4DL7A 3CJ8A 4QWDA 4ZVPB 1MMDA 2DK2A 2VL1A 1JLCA 1FO1A 3B8HA 1RT2A 1KTQA 2CUYA 3KLIB 2MQNA 3EDRB 4RO0A 4EI2A 2DISA 3R8YA 1RAJA 1UEVA 2VDIA 3WIUA 2D41A 2JH3A 3M6WA 5I3UA 2QFIA 1Y3KA 4LRAA 3B78A 3PEHA 2DNLA 2GHPA 2NXNA 3V4IA 1T94A 4OQJA 1FA0A 5A8WA 2FLLA 1JNRB 3TJ9A 4F4AA 2OMLA 4NYOA 2HLTA 2V50A 1C2PA 4ZVTB 4FYDA 2I9SA 2R7QA 4Q45A 2KTQA 5K8NA 1YWXA 4J5OA 1RWUA 3L09A 1Z2ZA 2PFFB 1N5SA 3CJRA 3QFWA 3FZ2A 3H40A 4UZBA 3PX0A 3M8RA 4Y2AA 4PWUA 1JLFA 3TOQA 1U6BA 1HYSA 3I4HX 3H0PA 3QGPA 4DUZF 1DZ5A 1SC3B 4JI2J 1XN9A 7AT1B 5EUHA 1UWAA 2K2PA 4RW6A 4J9KA 3SQGB 4OLPA 1T9VA 2HQGA 5M2PA 2MZ1A 5F8GA 5DDQC 3M2VB 2M70A 3UDCA 3OXFA 5BYSA 4YOEA 1QUVA 4OZ1A 5HL7Q 1SJFA 3HXMA 3QNWB 1WG4A 3TVZA 5SUHA 2MZRA 2JDJA 1OJ4A 2Q43A 3CJQA 1YJ9S 2J8AA 5GAEI 1RWMB 2CFXA 2BZ2A 2YX4A 1PGZA 3MOZA 5JVGQ 4DR2F 3U1LA 3I32A 1HBOB 2ZD1B 2GIQA 2KFYA 2HHQA 5KFSA 3VCDA 4OYWA 2Y1IA 5GAGI 2CXEA 3Q8RB 2HMIA 4OI6A 2XLJA 3CCRS 1KQFB 2PI5A 4LFCJ 1CQMA 1R0AA 2P6SA 1S0MA 3PG9A 2L9NA 1K9MT 3QWPA 2UVUA 1WOPA 2EFNA 1YTYA 3M2UA 4WFXA 4HT7A 2BACA 5FJ4A 3KLGA 1ZM4A 2HNDA 2ALYB 1MSWD 1U1RA 2B9WA 1Y5IB 2VFSA 2Y1LB 4Y00A 2XY6A 4ED7A 2DNOA 1TV6A 2GCFA 5CHCB 1CJUA 3EVMA 1YIJS 3Q83A 1F3FA 1M5PC 1Z2LA 2BEFA 1N33J 3IFEA 4DR7F 2DHHA 3LQVA 4G1QB 4A48A 1ZPWX 3QMQA 5EHHA 2OO4A 5IM0B 5EWFA 5E5NA 2YWFA 2NZ4A 2CQHA 3AFGA 3NS7B 2MQMA 3HLUA 2V2VA 2XI3A 2XMMA 4X62F 1EQ0A 1V6HA 1YJ7A 3DMJB 3C14A 4QPXA 1WF0A 4FF3A 4K0KJ 4RBTA 4NLRA 3HMJG 2XHWA 3DRYA 3I4PA 4YQWA 2Z8QA 4MKAA 1XQIA 3RUBL 5A0YA 4KV8A 1KP6A 2HHPA 2QL9B 4P72A 3W9HA 1UWBA 4DL3A 2H48B 2EBGA 1F2HA 1HBMB 3D0HE 3ET6A 2OPQB 3H5SA 3IGNA 3P8BB 4I6WA 3G6YA 4K4XA 1UVMA 4M5MA 1S1WA 2UV8A 4PXDA 4DR1F 4ED0A 2E7VA 3I0SA 4ZIWA 2R8HA 1IKYA 5B7WA 2R8JA 3DLEA 3M32A 3G8QA 5HK4A 2DITA 1B0TA 2BJEA 1GH8A 1RWKB 2DBBA 4F7VA 3QGGA 3PKMA 4LREA 4DV0F 3D68A 2NPIA 2RS2A 1N56A 4XDCA 5F41A 4LF9J 4ZCKA 1M0SA 3C46A 1R6VA 1GEHA 2FHJD 3VAIA 2FY1A 5IV4A 2R7SA 3IC1A 1PYTA 2V8DA 1JLEA 3H20A 2WK4A 1NCLA 3MHYA 3VAGA 4WK3A 1S48A 2GGPA 2VH7A 4JI8F 1S4FA 4O44B 1RISA 4UUXA 4HLBA 4UW2A 3BGRA 5ETTA 4C6AA 3CPWR 2J6TA 4LF6F 1HNVA 4LF6J 2RD5C 3QIPA 2DNQA 2LCWA 4G65A 1S5ZA 4EEYA 1DFDA 3A8EA 3KOAA 1FTRA 4Q5VA 2APOA 2NUHA 2AW0A 2E44A 1WG5A 3KLGB 1TMMA 3VVUA 1NSQA 1LNQA 4M5DA 1JLEB 2DNMA 3EGNA 3FRYA 4FYXB 5H9EJ 3IXQA 1JMTA 2WONA 2KDOA 1H38A 1FE0A 4F4ZA 3TEGA 4NMLA 5D8HB 1S9EB 4NMXA 2I2YA 3ZNJ1 4RLEA 1RT3A 3VGTA 1FD8A 4XAKA 3NWGA 2W2MP 3GJQB 1OS5A 3LPYA 1FNXH 3J81Y 1S0NA 4OV1A 4OYAA 5F9LA 1ZTWA 4N47A 3UI3A 3KLHB 3CT9A 3DLLQ 1A9NB 4A46A 2XSFA 4X2BA 5F3TA 3UDVA 4FF2A 1ZBTA 1GTEA 1N5YA 3OVBA 3GZ7A 1FRLA 4DR2J 4OMFG 4KHMA 4PWDB 2OPQA 1T03A 2WVDA 5J2MB 3MD3A 3PX4A 2YKNB 3HF5A 4OZ2A 3P5BP 4M5IA 2HQFA 4M1KA 2V63A 2AGOA 2HVEA 4C8MA 1RWVB 2HNDB 2PDAA 3SV3A 1HMVA 1BQMB 1XMBA 4IRCA 3QBCA 2A1BA 2AHOB 3Q23A 5C5JA 3C16A 3QT8A 2KU7A 2AX1A 1RGVA 1TVRB 2JZ5A 4C0BA 1S6OA 1NNDA 5IV3A 4NLYA 5J2PA 5L38A 1N8RT 1IR0A 4DXLA 2BM0A 5FDLB 4LF5F 1YDLA 2HZVA 5T41A 4G1QA 3ITHB 4U7CA 4FS2A 2ZH8A 4USIA 2HK3A 3LUYA 4E8UA 5KFCA 2FVCA 4GKKJ 2JX2A 4FBTA 2ZH5A 1TV6B 2IRYA 2UZAA 5G4DA 5DM7Q 4R5PA 1RT6A 2VBYA 2WOMA 4Q8FA 5HSPA 5F8LA 1S10A 2CJYB 1NB2A 5KG7A 1ZOTA 2VICA 4MT1A 4GVBA 3SYZA 3MCSA 4USJC 2WOMB 4TLRA 4DG1A 2E5LJ 4A8XA 3Q8PB 2CQPA 3W62A 2XGQA 1NXIA 2AZ3A 1VMBA 1RT2B 2GZOA 1BE4A 5DZ6A 2IAJB 2PIIA 4R25A 4NZ6A 4X4QA 3F44A 4N5SA 1NK4A 1VQ5S 2AYGA 2J9DA 3AA8A 2VG7B 5CYJA 1G7CB 2E1RA 4USUA 3UO0A 4LRCA 4QR2A 3SCLE 3VQTA 3ENWA 5ETOA 1V5IB 1Y00A 1JLFB 1R8AA 5H1SV 4AUKA 3BV8A 3QPIA 1TVRA 2P8IA 4M5JA 2H51B 1QDUB 3CDWA 3R27A 3ZZ0A 3B6BA 2PC6A 1YBUA 2JFDA 2H1YA 2LDYA 1RTHA 4MK8A 1R8PA 1HBNA 1U6FA 1SBRA 1FJCA 4ZLPA 3UFCX 3CJ5A 5DM6Q 4GC6A 4F3MA 2V9WA 2KKHA 1UW4A 3HSDA 3HZGA 3ILIA 4OZLA 3CCJS 4DR3J 4HH0A 4IG0B 2V6AA 2UXBJ 3BYPA 3W63A 1XMQJ 1JX4A 4R0EA 1Q5YA 4WXOA 4ZA1A 2G1HA 4DV6J 3U1MA 4W4MA 4EYHB 1FD2A 4FF1A 4TY9A 3KLHA 2VG6A 2A2CA 1UZHA 2XC9A 1RTJA 5AXKA 3EGZA 2HQIA 1Y10A 2QLXA 3VR1A 1R3NA 1VBKA 3A12A 5C42B 1YJWS 1S9FA 1S76D 1WEXA 4C9DA 4OJGA 4KHPF 1Q8LA 4LBIA 3VAMA 2HK2A 3R1HA 4TYBA 1VHFA 3OPKA 1FI4A 5KT4A 4NLDA 1Y7PA 2IVYA 3FJ2A 1W2IA 2MHEA 2VZ9A 4JP8A 4O3QA 4RW8B 5K8MA 2BJ3A 3NP5A 1OY8A 4M5DB 4BWMA 1S79A 3L4BC 2XLIA 4AL5A 2M8HA 2VQEF 4C11B 4K4YA 2J7WA 4MTPA 5K5MA 2VB6A 1RKJA 4WTYA 2L9DA 3OR1B 3J7Z5 2O5DA 5DLFA 4PG6A 1DRZA 3NG8A 2QC3A 4DR6F 1UFKA 3SDEA 2VFUA 4RUHA 4RW9B 2KHCA 1RU2A 1IJFB 1LW2A 2QYCA 3BBBA 3PRBA 4O44A 3BH7B 3OLAA 2KRBA 2BRLA 3NGTA 1GXLA 3V5RA 3Q89A 1J5OA 2AGQA 2LXUA 4ETXA 5FLXY 3MM6A 2QLFB 2XHCA 3DLBA 1DQ8A 2YWHA 3H7HB 1VJWA 1S9GB 3L7OA 4J37A 4JI2F 4DUZJ 2VKRA 2GQ2A 2ZC3A 4QOTA 1HL6A 2YQ1A 5KFFA 5A2QU 2EFPA 3DGPA 2IHR1 4ATNA 2N4CA 4RBVA 3R97A 2BANB 2F8EX 4LJMA 4RU2A 1KLMA 1UTAA 2K1RB 2MPUA 1SQFA 2B7BB 1RJJA 3CDBA 4DF8A 1KHVA 2QSWA 3HT3A 2J6UA 4IFYB 3NGDA 1XR7A 1QSYA 1FWKA 4DV3J 1L3KA 2BV3A 4OV6A 3QO9B 4CO5A 1BD6A 1KSPA 2PA8D 2HHUA 1FRKA 1WKJA 1L3VA 1SL2A 1HPZB 4JOUA 1DLOA 2DGUA 2DT9A 2G2YA 1N6QB 3NNHA 5DGAA 4FYVB 3JAMY 3KYLA 2G0IA 3NGRA 4ZDNA 5T7LA 5LXRA 1AUSL 3CCMS 2DIVA 3FVYA 4WPAA 5EX0A 3K5NA 2R8GA 1N32F 2FTRA 4W98A 4ZP7A 1G3OA 4V1Ak 2W8KA 2K7JA 2DHSA 1UEUA 3IBCB 3R9LA 1RT5A 1C1CA 2NSCA 3ISND 1WC3A 2WSFC 3PCOB 2KM8C 2YKQA 2C2NA 3Q86A 3RU0A 3E01A 1K73T 2E9RX 1XWLA 3BO3A 1QAYA 2KYXA 1GK8A 4H4OB 5LSOA 3BO4A 3A8JA 3GMGA 3KJQB 3OTCA 5DG8A 3EZ5A 1ZETA 4WZQA 1T05B 3JQJA 4DR7J 3JSRA 3W5XA 3CCES 4I69A 2HIYA 1PC4A 1UVLA 4WE1A 1X5SA 3NAIA 4ZCLA 4HHJA 1GTHA 2CRLA 2MY8A 5JVHQ 1PILA 2AP6A 2GS8A 2JVOA 3B82A 4FP9A 3UNYA 1U1LA 1T95A 4KE5A 4KBIA 5KFRA 1C0TB 4A8OA 3F73A 2ZJPQ 3M05A 2ASJA 5IT0A 2DNKA 1UVIA 1HQ2A 1NJWA 4ALZA 5A8KB 3VTIA 4U8YA 1TK0A 1IBKJ 5DLGA 8AT1B 1H73A 1LWCA 3M8YA 1WDDA 1ZZFA 4DR1J 1C4CA 3BZQA 1U4BA 1REVB 3AOBA 1UAWA 4PXEA 3LP1B 1DHMA 5DO2A 4CDIA 4FF4A 4YEAA 1H2VZ 2J76E 2YKMB 3I9V9 4RZRA 5RUBA 5HO4A 2EKYA 1GQEA 3DOKB 4J9QA 1LW0A 2FD2A 3GFXA 2EXUA 4P2MA 3G8SA 3GIJA 3KTQA 2EK1A 1UCNA 1TFYA 2DGSA 2DEJA 3T5KA 3KLFB 1HLWA 1J27A 3N9UC 3DFEA 3CMAS 3M30A 5IT4A 4LVNP 1VFJA 1WI8A 1X4BA 2GAGC 3GSIA 4UOHA 4UZCA 3T1AA 3WQPA 1IBLF 2RF2A 2GQQA 4WWSA 4USMA 2FLNA 3T5JA 4U9RA 1R0BG 2EC0A 2DNPA 2KJWA 3VGVA 5C25A 2BM1A 2LYVA 3UDLA 1WWHA 2Y8WA 5C24B 1Z1ZA 3MAHA 1IBMF 1S4EA 1SL1A 1S7HA 1RHQB 3KUGA 1XR6A 2FZCB 4C0OC 1DJ0A 5KT2A 4M8LA 1TKDA 2LEPA 4O23A 3V2UC 5CCLA 2QMWA 5IOLA 2CAJA 1RABB 2R2UA 3D6MB 2MLXA 3V4IB 3GFHA 5KFAA 4DSLA 2HFOA 4XIUA 3KJFB 1KQKA 2HAFA 3HVTB 3VV2B 5L1KA 2FZKB 3QRQA 1U26A 2LQ5A 2BA9A 3LF0A 3ZZYA 3IWNC 1Q86T 2FVSA 1HNZF 4FBUA 2MGZA 1D8ZA 2YTCA 2UUBF 5K14A 5LSRA 2RH3A 1P9YA 2IA6A 3RBZA 2GAHC 1OQ6A 4PQUB 1QSSA 2EFOA 1IKXA 4KKOA 1J5EJ 4IG3A 3OJSA 2HVIA 2I0XA 3LAMA 1JXVA 2ZH2A 5BXIA 4DFMA 4NLQA 4Y0FA 2HHWA 3KUHA 3N0VA 5AXLA 1HARA 4FNHA 3TP2A 3KJVB 2YKAA 1P6TA 4B3SF 3MECB 2RQKA 3KMSA 4DPWA 3ISNC 3BSNA 2L08A 3AJ1A 2CJXB 5KFEA 3OTDA 4IH7A 1ACMB 5E2QA 2W25A 3SCJE 3IA0A 4KB7A 2YNFB 2KN4A 2XNQA 3LGNA 3PTWA 4UUWA 5E3RA 3UD3P 1SV5A 4DHVA 3PO4A 5E3CA 2FJAB 2C2MB 7FD1A 1RBAA 1U49A 2A18A 3MEDB 1U1KA 1K44A 3HO1A 3K57A 2G1DA 4YR0A 1N4LA 2KH9A 1NAQA 2Y9HA 4JI5F 2FB0A 3TVYA 1NPRA 4JI0J 1C0UB 1WHYA 2HPUA 4ICLB 1DTTB
chains in the Genus database with same CATH topology
4DL0C 2DJWA 4ZPAA 3DOKA 1NH8A 3TARA 4IUFA 4EO6A 2OFGX 2MKIA 1X4HA 2J9CA 3I31A 1TL1A 1Y3JA 4FVCA 3K5LA 3R5DA 1RA7A 1F0XA 1GNKA 2AJ0A 3CTRA 2N3LA 4MAKA 2ZH6A 4WU3A 3KK1B 1M5SA 1NO8A 3D1QA 1HNIA 3G9CA 1FJ7A 1HBUB 2K7KA 4N8NA 1FDNA 2DO0A 3K5MA 4U67Q 3DYAA 1X5OA 4FVMA 1PO6A 1D9FA 1S49A 3L7PA 1KLNA 3C66A 2XB2D 4UY8T 3IWXA 1LWEA 4KFBB 3W2VB 5A8KA 4IFVB 5DG7A 4MKYA 2ZE2B 4DQRA 5ITHA 3KHRA 2VQFF 1H7WA 2XS7A 2WBRA 2OPRB 4DR4F 3KLEA 1QSLA 1S1XA 1URRA 2XS5A 2AGPA 2YNGA 1HQEB 2XY7A 2RE1A 4RWXA 1U25A 2VA2A 4E98A 3O1LA 4G6VB 1DLOB 1N5TA 1WEYA 2L3MA 4NOHA 5HMYA 4I6YA 2RRBA 4ED3A 2UXDF 3CJ2A 3GB0A 1KVJA 1K1SA 3S7RA 3NS5A 4DSKA 5KFDA 1ZM9A 1ZH5A 4F3QA 2WHOA 3IG1A 1DQ9A 2ZH7A 2HNZB 3GIMA 2I8EA 1XEZA 1ZM2A 2R7UA 3VZIA 2GFFA 5F8HA 2MY7A 1X0FA 3MEKA 1RTIB 2ZHBA 3H59A 4HI1A 1N0VC 4LF4F 4CNZA 3UWTA 2XMKA 2N7YA 2HHSA 2P5VA 2FC9A 3NKYA 4NLOA 3JSBA 4EBEA 4PR6A 2K3KA 2E9TA 3MAQA 2CPXA 4CCHA 2B6AA 3MEDA 2HAIA 2DH9A 3HHEA 2JEFA 5G0RB 4RU9A 1U09A 3CD7A 4RW9A 3KK3B 5D78A 2ZUGA 2XMUA 3DRRA 3ISZA 3MZIA 4N8OA 3O2IA 2CJBA 3CUNA 5EN1A 1FK9A 3BM7A 1D9AA 1N52B 4C0HA 4CT8A 2LEAA 2B9YA 1F5CA 3J7YU 2CPFA 2G9OA 4EO8A 1W2BR 2M8DB 3LP2B 1HWLA 4X4TA 2HFNA 1QLNA 3OUYB 1LWFA 4MFBB 1GT8A 4TLQA 2J0XA 2HIQA 5DQIA 1X8DA 4CO4A 4OI4A 1S1TB 5D3GB 4WU2A 1NEEA 3VALA 1S1VB 2R7WA 3RRHA 3SFUA 3QWUA 4C8LA 2IC3B 2B56A 4MIWA 4URGA 4QW8A 3DI6B 4LSLA 4NRUA 2ZOGA 2PMZD 2WCXA 1ZPVA 1RKIA 3JTOA 4O0IA 2GHVC 3IRWP 4JV0A 3N79A 4TU9A 3K5NA 2E7WA 2XCAA 1N33F 1TL4A 4DN0A 2BANA 2V4JB 3K0JA 2MSTA 5CZXA 1SB6A 5C42A 2GQCA 2XSJA 3MM9B 2CPJA 2KYZA 2ZNZA 2OSRA 5BYQA 4ES2A 4LF9F 2HHUA 4X4OA 2JVRA 1V9OA 4KKOB 3PY8A 2A2DA 1FKOB 2IVMA 1CPZA 1BC6A 2E5LF 3HM9A 3C6TB 1NK0A 1QUPA 2KFZA 1WACA 4M63A 5EWEA 5KFGA 1HWIA 3CCTA 4JI0F 4LFAF 2VC0A 5LMUF 2BQUA 4ITSA 3T1YF 4CH1A 3OW2R 4ED1A 3HJFA 2ZM6F 1NU4A 1WI6A 4ILRA 3FSIA 2DRBA 5CYMA 5L1JA 4XO0A 5A8RB 2X1AA 4PUOB 4DJBA 1JK9B 3RAMA 4KC5A 4DX8H 4MK9A 2YX1A 4MIAA 1AXQA 1FNMA 4PG7A 1NJXA 3ITHA 2VG6B 2BOPA 3FGVA 4KHRA 1MNEA 4NCGA 2UP1A 3PW7A 2DD8S 3H5UA 1Y5LB 4WKYA 5B0GA 2Y1JA 4NX9A 2V4QA 3PFOA 2ASLA 3DLGB 4OI1A 1S0VA 2BXJA 2CPDA 2D3OR 3T6JA 4RX6A 1F9FA 3HHNB 2MZQA 3M9NB 5J1PA 3Q8SB 1L3VA 1SIWB 3SMZA 3G6ES 4IQMA 1TAUA 1H7XA 3BGUA 3OFGA 2YKMA 2DO4A 2GO9A 1S97A 3LP1A 5KFIA 1RT5B 5LXYA 2Z0GA 1D0EA 3PIPQ 3H4BA 2XI2A 4LUBA 2RIJA 5KG3A 5J2PB 3BGLA 3M8QA 4ZPTR 3NMAA 1Q7YT 1L3SA 2DGXA 2C3YA 4RNHA 5GVQA 4GO5X 4Z37A 2ZZMA 1KFDA 2E66A 4K0KF 4XK8C 4YR2A 3MEEA 4B9SA 3FEYB 2YKNA 4B08A 2LU2A 4DSIA 2CPEA 4PWDA 3D28A 1FNOA 4ECVA 1FRIA 3SSSA 1N5YB 3TA2A 3DDKA 4F26A 2BQRA 4EUVA 4NXNF 2PN6A 2LECA 2LDIA 1VBXA 1SI9A 4ED6A 5J2QB 1S0OA 1FKPA 5KG4A 4M95A 2YWKA 4TQSA 4I0WA 3BSCA 2QFJA 4X4NA 2R2SA 4R0JA 2VOPA 3TAMB 3SCIE 3MFHA 4FPRA 4E0DA 2C28A 2CYYA 3EUNA 4DPOA 1KC8T 2ZZNA 1TP7A 4EYIB 3L3CA 1ZAXA 2HZCA 1N6QA 4EGLA 3SSQA 2VG5B 1X0PA 3SDEB 4K4UA 5A6PA 2YNHA 3NS6A 3BQ2A 1NK7A 1HNVB 2BR0A 2QT7A 3OV7A 4C8OA 2IMOA 3I9ZA 4EBCA 1CC7A 1XMQF 1U2FA 4V19X 3BB5A 2HG4A 3M6VA 2Q6BA 4GKKF 4O3OA 3R5BA 2DGQA 5KFNA 4YB5A 2VPZB 1SH0A 1UMJA 1Q7LB 1WELA 1VI7A 2OAUA 1U2RA 2FUG9 3EZUA 1UFLA 3TX8A 3MURP 1QAIA 4ILLA 3CIZA 3F56A 4R8UA 2WONB 3U27A 5KFPA 4TXSA 1JLAB 1R7IA 2HWIA 3CCQS 3NCPA 3MFIA 4KO0B 1A6LA 2E1AA 4HVZA 4ZOSA 4I68A 4K4VA 3I5AA 4DF4A 1F5BA 1WHVA 1HW8A 2EBEA 3POTB 3QGHA 2LQBA 3S6EA 1S6QB 2DB1A 4H4KC 5KFYA 1JXEA 2MQPA 2EWHA 3NNAA 2AJQA 1VRUB 1SUQA 2JHEA 1VBYA 4JI4F 3VAJA 3KHGA 1S6QA 3P5TL 5KFBA 3MUVP 4LFCF 3DHXA 4DWIA 4ZHRA 3IS9A 3DMJA 4BC9A 3TNVA 5DDRC 3TUZC 2CQDA 3LWMA 2R9LA 2XULA 2EI5A 1QAXA 3ZFVA 2CJQA 4DQQA 1X9SA 5J2QA 2B4UA 5DETA 3RB0A 4OJ1A 2WRMA 1VQ7S 1HBOA 3DOMA 5HLFB 2J0WA 4A8YA 4CO3A 1FVSA 3VQSA 3M2UB 1HNXF 4JI7F 2E1CA 1DBDA 1HBMA 1FXLA 3RAXA 1B7FA 4R5PB 1APSA 1R0AB 5KFUA 1P1LA 2CPHA 1IJEB 1YQHA 2HHXA 3OL8A 4OI3A 1VQ6S 2B51A 4ZP6A 4PG5A 3TI0A 2GHWA 2GIRA 4CH7A 3OFEA 4WFZA 2FJWA 2JC1A 4F50A 4C3MA 3ETOA 1IN0A 3TUIC 3FEXB 3CIMA 3GIKA 2W7PA 1FE4A 2ATLA 5CH7B 4HEA9 3IO1A 1R8HA 1VIXA 4LF7F 4A8QA 1KNZA 2K3IA 3VAKA 1IQZA 1HFEL 5A8WB 4DG1B 5LJ5Y 2E29A 3DLHA 4JBCA 1UETA 1IKWA 4DR5F 4XPCA 2D9PA 3UR0A 4LSNA 2XO7A 1RT6B 2FJXA 1SJQA 1TKXA 4YB1P 2KO1A 2ACYA 2C3PA 3RR8A 3H5XA 2J0SD 2EVZA 2F9JA 2JWNA 3BQ0A 2YH1A 2VV5A 3MI7X 4B9MA 2C3OA 1T8EA 5AXNA 2JL9A 2V9KA 4G1PA 5B0EA 1JLQA 5KFOA 5DS7A 3FCHA 1X4FA 5A8RA 1GXUA 4NLVA 1SC6A 4OX8A 2PEHA 1BQMA 1CG2A 1U1MA 5KG6A 4DL5A 3Q24A 2FPHX 1T3OA 2CZVC 2QA2A 3FMBA 1XERA 1P1TA 2E1MC 3HPOA 1FF2A 2XEXA 1FKOA 5HLFA 2VPWB 4QPTA 2NLWA 1VBZA 1TZ0A 5B0CA 4QU6A 2IYIA 4DN9A 1N0UA 1X4DA 4OX6A 1RT3B 2RU9A 3MM7A 1HQUA 3HVAA 3OXGA 4IDKA 4OZ0A 4FXDA 1HD0A 1U6ZA 3FEZA 2UVRA 3PVXA 2EFQA 5HMZA 1ZZNA 3OSNA 1CEZA 1OO0B 1W25A 3S1TA 1FRHA 1S1WB 2RMLA 4P7VA 2DH7A 2HS4A 3TRGA 1JLCB 3KLIA 5A0YB 3QIPB 3WBZA 4QCLA 5HBMA 2MB0B 3ZC4A 1OPZA 3BJYA 1TK5A 2PI4A 3CGIA 2ILYA 3RB6A 3OFHA 2FVPA 4B9VA 3M2RA 2OIHA 2K8GA 1FKPB 4ZHRB 3JTNA 1RYSA 4TY8B 4TYAA 4B17A 3DLKB 1XMOF 3QJJA 1O51A 3KG1A 3MDFA 4O3RA 1WHXA 4A8KA 2ROPA 3DLEB 1FJGF 2MYFA 4J9RA 3AH6A 2ROEA 4KQZA 4DLGA 2HGNA 2HW3A 1I94F 4RNNA 1AROP 3CD0A 2B6AB 4ZKAA 4JV5F 1KN6A 3Q2SC 2R2TA 2F3JA 3R5CA 2RDJA 4QIEA 1KONA 2CG4A 2CPIA 2PA3A 3M8PB 1N34F 3KHHA 3Q0AA 2HMIB 2XMTA 1CVJA 4X65F 3AQOA 2NPFA 4J9MA 3MGJA 3CCVS 1G6BA 2U2FA 4Y65A 2DHGA 5SZTA 1R8CA 5IM0A 2MQLA 2D3UA 3MR6A 1LKZA 3CDAA 1CQNA 3MMCB 2M52A 3IR5B 1XTZA 4C8ZA 2CQGA 5AXMA 5KFZA 2RJZA 2HVZA 3BR8A 4K59A 2XGPA 1YRUA 4ILMA 1JNZB 2X3GA 3LWLA 3FMWA 1RYRA 3ENVA 4Y3CA 1LOUA 4BWJA 1YJTA 2D9OA 2FJDB 4NPOA 2XMVA 4TN2A 1M90T 2QEXS 2MKKA 4HDHA 2I38A 2B9XA 4IH5A 2D74B 2BQ3A 1S1UA 1QAJA 2PT0A 3V6DA 2RKIB 3EXCX 3J7YI 2IM0A 3TA0A 2JJ4D 2CPYA 1LWEB 4KFBA 1U24A 2GJ2A 3W2VA 2Q79A 4NLTA 4PUOA 1QVFR 3WDOA 4ELVA 2CZ4A 4IH6A 5CYMB 1R43A 3CC2S 4N77A 1NK9A 1YBAA 4OHXA 2BW2A 4HI2A 3MMAA 4QIVA 5B08A 3OQ2A 3H8YA 3DLJA 3KKFA 3MMBB 2C3UA 1M5HA 2OKQA 2YNIB 1NK8A 2R7OA 4GC7A 4ELTA 1H2UX 2PD1A 2VPXB 3DLGA 4RW6B 1VIOA 4ZMMA 1V3SA 4QYRA 2BDPA 3O8WA 3V6HA 2EFGA 5KT7A 1HYSB 1WNEA 2SXLA 1K0VA 3KK2B 2V8GA 1S1XB 1WD6A 5KFJA 3NL0A 1HWUA 3HKWA 5KFTA 4QWEA 4ZPCA 4DFPA 3C6UB 2B43A 2FJBB 1DQAA 3OJUA 4IFVA 2V4JA 3CXCR 1JB0C 1JKHA 1NJZA 4MJKA 3OTOF 3SV4A 2A3JA 3AAWB 4YDDB 3GG0A 5AE3A 1KTVA 1MU2A 2DNGA 2YKOA 2LQ9A 3DI6A 3HX9A 4LSLB 1WTFA 2DIUA 4H4MB 2QO3A 2L41A 4ECXA 4MIBA 2VBZA 4ZVEA 3RTVA 3QAUA 4NCAA 3PKYA 4NCGB 4QJVA 1URNA 5A6WA 1N5QA 2WAQD 4KRWA 5KOXA 3IAS9 3MPVA 3WC2A 2R7TA 2QZ8A 3UCUP 4DOZA 4LMZA 4DR3F 3W3SA 5GAEU 2R2RA 3OUYA 3N01A 1Q78A 3J80Y 2OTLS 2UUCF 2M7SA 1IQTA 4MMOA 2V5HG 3CVKA 1X7VA 2R8KA 1E6YB 2R7VA 2ZHOA 4DV2F 3AHPA 2NR0A 5F8IA 3I0RB 2AV5A 5I3QA 4ED5A 1O8BA 1FXDA 1Y5NB 2WSCC 5HP1B 2KM8B 3ICLA 3CF5Q 4ECYA 5KFLA 4DSEA 3CB4A 5HMWA 3OSPA 1DTQB 3I87A 2W24A 4NCBA 1G2EA 1FT8A 5E3PA 1DAXA 1TR0A 2LEBA 1NKEA 4LFBF 3BO2A 4WFNQ 4HT5A 2QLWA 1N48A 2N3OA 4RWWA 3W2WB 4P7TA 3T19A 3K8VA 3CJ0A 4IO9Q 1P8GA 1IBKF 2AYBA 3GWCA 1SH2A 3BREA 3EX7B 4HYKA 2EW9A 2HNYB 3MM8A 2VFRA 4Y2MA 2FJVA 3UCGA 3FSYA 1LXNA 1WHWA 3RW7A 4OL8A 4YFUA 4NA1A 5KFHA 1FDAA 2HNZA 4YR3A 3MM5A 2EG2A 4JV1A 1QY7A 2F9DA 1DTTB 1RI7A 1JWWA 2HWHA 3GR1A 3G71S 1G1XA 1UVKA 4EFAC 3TQ1A 4K5SA 1VQLS 2JLEA 2FLPA 2LA4A 3TO8A 2EG1A 2IRXA 3ZZZA 1SQEA 1UKUA 2AWZA 3TR5A 1L5UA 2PO4A 5DG9A 1C1BB 3HDSA 3LP2A 4X4UA 3UCZP 3V81A 1RT1A 4ID5A 2B4PA 4I2PA 4L72B 1Q82T 3OLBA 4A8SA 1UJ6A 5IS2A 3FZBA 1NJIT 2MMYA 1KEKA 2XBPA 4H4KA 4I4BA 1R8BA 1BY9A 4YUDA 5IZHA 3PNIA 1HI0P 4KGKA 2V8VA 2O1PA 3THPA 4ECQA 2XWYA 2RRNA 5AJ3F 1H2TZ 3CD6S 2W9BA 1NB7A 2JEJA 4DV3F 2Y1RI 4K4SA 1VQSA 3TVKA 5F8JA 5GMKa 2Q3PA 1OSDA 1NKBA 4F02A 4NYZA 4LF8F 4IOAQ 5KT6A 1EETA 4FNIA 4F4XA 4I67A 1JLGB 1QE1B 4F4WA 4ECZA 3TANA 1DURA 1FXRA 1VC5A 3N28A 1TKTB 3ZZUA 4F2RA 2G4BA 4IO1A 1REVA 3MM5B 3T9NA 4ZCMA 2B4OA 3S8SA 3MPYA 4D3GA 4WKRA 2Z2LA 2AJFE 3GFYA 4RUCA 3CEDA 2X51A 2ZDOA 4DV7F 1I1GA 3M8PA 4C97A 3EGWB 4ID8A 1X5TA 3E3XA 2V94A 4CO2A 2LKZA 3U1NA 5IFMA 4DSFA 4C4WA 4ZPWR 2W9BB 2DNYA 2PMHA 3HZEA 3N6MA 3TA1A 1R89A 4OLOA 3NBPA 3N6LA 2ZE2A 2C2DA 3SZ2A 3RBDA 3RRKA 3HI9A 4U7UK 3X1LB 4O4RA 3KK1A 3FQLA 2VKZG 1Q16B 2JC0A 1SJ1A 5D77A 2WTFA 3E01B 2GMLA 2IYGA 2HGLA 2VBXA 3MECA 2ZH1A 1C1CB 3PJXA 1YJRA 1TL1B 1Z4UA 2I1RA 3M2RB 3QGIA 4ZPBA 1C4AA 3F41A 1O0PA 1H6KX 3CJKA 3LALA 3DYAB 5AE2A 1C1BA 2HS3A 3RBEA 3DXSX 1DTTA 1Q79A 5T7LB 5FIIA 1MROB 1SH3A 2HRYA 3O6QA 3GE9A 2R4FA 1HNIB 2HFZA 1FJEB 4PG8A 2OSQA 4ECTA 1A9NB 5D4LA 3I0RA 1LK5A 2MSSA 4YP3A 4DS5A 3PW0A 2ADBA 2QRRA 3KG0A 3P3DA 3RW6A 4AXIA 3QLHA 3MR5A 2ZVSA 1UL3A 1SV5B 1VLYA 5CD4H 1VQOS 3BDPA 3K59A 3K2YA 5HP1A 1RT7B 4X64F 2IRUA 3HKZD 1S72S 1U48A 2L9WA 3DHWC 1JKHB 2UV8G 1E6VA 1HW9A 1E6YA 1FEHA 2HWTA 3MM7B 2AU0A 3IGVA 2E5IA 3AA9A 4WYWA 5IQQA 2DR8A 1JLBA 1OSCA 1TL3B 2BYCA 3QLHB 4IG3B 4RBUA 2FIUA 4PPZA 4Q2LA 5C25B 2KXNB 4PQUA 2KVIA 1NH7A