2LF6A

Solution nmr structure of hopabpph1448_220_320 from pseudomonas syringae pv. phaseolicola str. 1448a, midwest center for structural genomics target apc40132.4 and northeast structural genomics consortium target pst3a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
b'QGLDLESARLASAARHNHSANQTNEALRRLTQEGVDMERLRTSLGRYIMSLEPLPPDLRRALESVGINPFIPEELSLVDHPVLNFSAALNRMLASRQTTTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB1
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Signaling protein
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf6A00
2LF3A 3TL8B 2LF6A
chains in the Genus database with same CATH superfamily
2B1EA 4GAMC 3HP9A 4DTPA 2VIXA 3HGLA 1XVDE 4M3ZA 1FZ0E 3HL8A 4DTUA 3QNOA 3QEVA 3LZJA 2RKHA 3SI6A 3LD8A 3TL8B 1MTYG 3TABA 1XVEE 4FJ9A 2DEBA 2YB5A 4RL5A 1XU5E 3QEPA 4KHSA 1MHYG 2JHPA 1FZ8E 2B7MA 2MMBA 3L0MA 4DTNA 3SJJA 4FJIA 2PFVA 2MW2A 2VJ5A 3E4YA 4JRQA 2VJ4A 4I9LA 3J27A 2P5GA 2DTUA 3KD1E 4DU4A 3SPYA 4JS5A 2MZWB 2FYOA 2HD0A 3C6PB 3NHGA 4DTJA 4M41A 1XU3E 3V7DB 1WAJA 1WAFA 1FZ7E 3OGMB 3SUOA 2OYQA 1FZ3E 4RNGA 4FJ5A 2OZMA 4M3RA 2LF3A 3KD5E 4FJJA 4M3XA 3CQ8A 4E4BA 3L1NA 3SNNA 4HCCA 3TAGA 4I9QA 2OVRB 4QNCA 2E32A 3RWUA 2DY4A 3TAFA 4ADOA 3N1BA 1FZ4E 3NE6A 4JRPA 3C95A 2H4TA 3E4WA 4M3YA 4FJLA 3K2OA 2P1PB 4RG8A 4J2BA 4M3WA 3NDKA 3TAEA 4KI4A 1MHZG 3LZIA 4X5NA 3C6OB 4DTXA 2JQTA 2OVPB 3CFOA 3NGIA 4FJMA 4AKGA 3QEIA 2P5OA 3OGLB 2JH9A 1FZ6E 3SUNA 5H37A 1FS1A 1CLQA 4JS4A 3L2OB 2RCUA 1FZ2E 1FZ1E 3OGKB 1FZHE 4QNDA 2ATQA 1P22A 1N1CA 3HGKE 3NCIA 1XVGE 4FJKA 4AKIA 2P1OB 4E3SA 4J2EA 3SUPA 4DTOA 4I6JB 1FZ9E 1LDKE 1FXXA 3QETA 4FK4A 4M3UA 1XVFE 3BVOA 2OZSA 2E31A 4ICGC 4B08A 3RMBA 1XMHE 3QEWA 3QERA 3SQ4A 3RMCA 4DTSA 3UIQA 4KHWA 4FJ8A 4J2DA 4KHYA 1MMOG 3SVIA 4DTMA 4M3TA 2JH8A 3RMAA 1NEXB 4AI6A 3SQ2A 4KHQA 4EYWA 3WSOA 4KHNA 2K5SA 3NAEA 2LF6A 4DU3A 2P1NB 4HCBA 4FJGA 3LDSA 3CFRA 3SUQA 3LDBA 2P1MB 5IBKB 1FZ5E 3QEXA 4DU1A 4FK2A 1XMFE 3SCXA 3SQ0A 1FPOA 1XVCE 2FW3A 2JPNA 3QNNA 2PFTA 3L8BA 3QESA 3SQ1A 2QXFA 3C94A 3J2PA 4KHUA 1Q9XA 4EP9A 4FJXA 3TJYA 3RMDA 2JHAA 1FZIE 4EPHA 3UO3A 3CFPA 1XVBE 3SPZA 4M42A 3C6NB 3MKSB 1IG9A 1XL3C 1Q9YA 2OVQB 2JHCA 3S9HA 5IZ7A 4FJ7A 4KI6A 2P1QB 3N1EA 4FJNA 5IREA 4AKHA 4IT5A 4J2AA 4X5MA 1FYZE 4FK0A 4FJHA 4FVMA 4DTRA 1XMGE 1IH7A 2B8IA 4M45A 3UO2A 1JW2A 4ADNA
chains in the Genus database with same CATH topology
2B1EA 4GAMC 3HP9A 4DTPA 2VIXA 3HGLA 1XVDE 4M3ZA 1FZ0E 3HL8A 4DTUA 3QNOA 3QEVA 3LZJA 3SI6A 3LD8A 3TL8B 1MTYG 3TABA 1XVEE 4FJ9A 2DEBA 2YB5A 4RL5A 1XU5E 3QEPA 4KHSA 1MHYG 2JHPA 1FZ8E 2B7MA 2MMBA 3L0MA 4DTNA 3SJJA 4FJIA 2PFVA 2VJ5A 3E4YA 4JRQA 2VJ4A 4I9LA 3J27A 2P5GA 2DTUA 3KD1E 4DU4A 3SPYA 4JS5A 2MZWB 2FYOA 2HD0A 3C6PB 3NHGA 4DTJA 4M41A 1XU3E 3V7DB 1WAJA 1WAFA 1FZ7E 3OGMB 3SUOA 2OYQA 1FZ3E 4RNGA 4FJ5A 2OZMA 4M3RA 2LF3A 3KD5E 4FJJA 4M3XA 3CQ8A 4E4BA 3L1NA 3SNNA 4HCCA 3TAGA 4I9QA 2OVRB 4QNCA 2E32A 3RWUA 2DY4A 3TAFA 4ADOA 3N1BA 1FZ4E 3NE6A 4JRPA 3C95A 2H4TA 3E4WA 4M3YA 4FJLA 3K2OA 2P1PB 4RG8A 4J2BA 4M3WA 3NDKA 3TAEA 4KI4A 1MHZG 3LZIA 4X5NA 3C6OB 4DTXA 3NGIA 2OVPB 3CFOA 4FJMA 4AKGA 3QEIA 2P5OA 3OGLB 2JH9A 1FZ6E 3SUNA 5H37A 1FS1A 1CLQA 4JS4A 3L2OB 2RCUA 1FZ2E 1FZ1E 3OGKB 1FZHE 4QNDA 2ATQA 1P22A 3HGKE 3NCIA 1XVGE 4FJKA 4AKIA 2P1OB 4E3SA 4J2EA 3SUPA 4DTOA 4I6JB 1FZ9E 1LDKE 1FXXA 3QETA 4FK4A 4M3UA 1XVFE 2OZSA 2E31A 4B08A 3RMBA 1XMHE 3QEWA 3QERA 3SQ4A 3RMCA 4DTSA 3UIQA 4KHWA 4FJ8A 4J2DA 4KHYA 1MMOG 3SVIA 4DTMA 4M3TA 2JH8A 3RMAA 1NEXB 4AI6A 3SQ2A 4KHQA 4EYWA 3WSOA 4KHNA 3NAEA 2LF6A 4DU3A 2P1NB 4HCBA 4FJGA 3LDSA 3CFRA 3SUQA 3LDBA 2P1MB 5IBKB 1FZ5E 3QEXA 4DU1A 4FK2A 1XMFE 3SCXA 3SQ0A 1XVCE 2FW3A 2JPNA 3QNNA 2PFTA 3L8BA 3QESA 3SQ1A 2QXFA 3C94A 3J2PA 4KHUA 1Q9XA 4EP9A 4FJXA 3TJYA 3RMDA 2JHAA 1FZIE 4EPHA 3CFPA 3SPZA 1XVBE 4M42A 3C6NB 3MKSB 1IG9A 1XL3C 1Q9YA 2OVQB 2JHCA 3S9HA 5IZ7A 4FJ7A 4KI6A 2P1QB 3N1EA 4FJNA 5IREA 4AKHA 4J2AA 4X5MA 1FYZE 4FK0A 4FJHA 4FVMA 4DTRA 1XMGE 1IH7A 2B8IA 4M45A 4ADNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF3 A;  3TL8 B;  2LF6 A; 
#chains in the Genus database with same CATH topology
 2B1E A;  4GAM C;  3HP9 A;  4DTP A;  2VIX A;  3HGL A;  1XVD E;  4M3Z A;  1FZ0 E;  3HL8 A;  4DTU A;  3QNO A;  3QEV A;  3LZJ A;  2RKH A;  3SI6 A;  3LD8 A;  3TL8 B;  1MTY G;  3TAB A;  1XVE E;  4FJ9 A;  2DEB A;  2YB5 A;  4RL5 A;  1XU5 E;  3QEP A;  4KHS A;  1MHY G;  2JHP A;  1FZ8 E;  2B7M A;  2MMB A;  3L0M A;  4DTN A;  3SJJ A;  4FJI A;  2PFV A;  2MW2 A;  2VJ5 A;  3E4Y A;  4JRQ A;  2VJ4 A;  4I9L A;  3J27 A;  2P5G A;  2DTU A;  3KD1 E;  4DU4 A;  3SPY A;  4JS5 A;  2MZW B;  2FYO A;  2HD0 A;  3C6P B;  3NHG A;  4DTJ A;  4M41 A;  1XU3 E;  3V7D B;  1WAJ A;  1WAF A;  1FZ7 E;  3OGM B;  3SUO A;  2OYQ A;  1FZ3 E;  4RNG A;  4FJ5 A;  2OZM A;  4M3R A;  2LF3 A;  3KD5 E;  4FJJ A;  4M3X A;  3CQ8 A;  4E4B A;  3L1N A;  3SNN A;  4HCC A;  3TAG A;  4I9Q A;  2OVR B;  4QNC A;  2E32 A;  3RWU A;  2DY4 A;  3TAF A;  4ADO A;  3N1B A;  1FZ4 E;  3NE6 A;  4JRP A;  3C95 A;  2H4T A;  3E4W A;  4M3Y A;  4FJL A;  3K2O A;  2P1P B;  4RG8 A;  4J2B A;  4M3W A;  3NDK A;  3TAE A;  4KI4 A;  1MHZ G;  3LZI A;  4X5N A;  3C6O B;  4DTX A;  2JQT A;  2OVP B;  3CFO A;  3NGI A;  4FJM A;  4AKG A;  3QEI A;  2P5O A;  3OGL B;  2JH9 A;  1FZ6 E;  3SUN A;  5H37 A;  1FS1 A;  1CLQ A;  4JS4 A;  3L2O B;  2RCU A;  1FZ2 E;  1FZ1 E;  3OGK B;  1FZH E;  4QND A;  2ATQ A;  1P22 A;  1N1C A;  3HGK E;  3NCI A;  1XVG E;  4FJK A;  4AKI A;  2P1O B;  4E3S A;  4J2E A;  3SUP A;  4DTO A;  4I6J B;  1FZ9 E;  1LDK E;  1FXX A;  3QET A;  4FK4 A;  4M3U A;  1XVF E;  3BVO A;  2OZS A;  2E31 A;  4ICG C;  4B08 A;  3RMB A;  1XMH E;  3QEW A;  3QER A;  3SQ4 A;  3RMC A;  4DTS A;  3UIQ A;  4KHW A;  4FJ8 A;  4J2D A;  4KHY A;  1MMO G;  3SVI A;  4DTM A;  4M3T A;  2JH8 A;  3RMA A;  1NEX B;  4AI6 A;  3SQ2 A;  4KHQ A;  4EYW A;  3WSO A;  4KHN A;  2K5S A;  3NAE A;  2LF6 A;  4DU3 A;  2P1N B;  4HCB A;  4FJG A;  3LDS A;  3CFR A;  3SUQ A;  3LDB A;  2P1M B;  5IBK B;  1FZ5 E;  3QEX A;  4DU1 A;  4FK2 A;  1XMF E;  3SCX A;  3SQ0 A;  1FPO A;  1XVC E;  2FW3 A;  2JPN A;  3QNN A;  2PFT A;  3L8B A;  3QES A;  3SQ1 A;  2QXF A;  3C94 A;  3J2P A;  4KHU A;  1Q9X A;  4EP9 A;  4FJX A;  3TJY A;  3RMD A;  2JHA A;  1FZI E;  4EPH A;  3UO3 A;  3CFP A;  1XVB E;  3SPZ A;  4M42 A;  3C6N B;  3MKS B;  1IG9 A;  1XL3 C;  1Q9Y A;  2OVQ B;  2JHC A;  3S9H A;  5IZ7 A;  4FJ7 A;  4KI6 A;  2P1Q B;  3N1E A;  4FJN A;  5IRE A;  4AKH A;  4IT5 A;  4J2A A;  4X5M A;  1FYZ E;  4FK0 A;  4FJH A;  4FVM A;  4DTR A;  1XMG E;  1IH7 A;  2B8I A;  4M45 A;  3UO2 A;  1JW2 A;  4ADN A; 
#chains in the Genus database with same CATH homology
 2B1E A;  4GAM C;  3HP9 A;  4DTP A;  2VIX A;  3HGL A;  1XVD E;  4M3Z A;  1FZ0 E;  3HL8 A;  4DTU A;  3QNO A;  3QEV A;  3LZJ A;  3SI6 A;  3LD8 A;  3TL8 B;  1MTY G;  3TAB A;  1XVE E;  4FJ9 A;  2DEB A;  2YB5 A;  4RL5 A;  1XU5 E;  3QEP A;  4KHS A;  1MHY G;  2JHP A;  1FZ8 E;  2B7M A;  2MMB A;  3L0M A;  4DTN A;  3SJJ A;  4FJI A;  2PFV A;  2VJ5 A;  3E4Y A;  4JRQ A;  2VJ4 A;  4I9L A;  3J27 A;  2P5G A;  2DTU A;  3KD1 E;  4DU4 A;  3SPY A;  4JS5 A;  2MZW B;  2FYO A;  2HD0 A;  3C6P B;  3NHG A;  4DTJ A;  4M41 A;  1XU3 E;  3V7D B;  1WAJ A;  1WAF A;  1FZ7 E;  3OGM B;  3SUO A;  2OYQ A;  1FZ3 E;  4RNG A;  4FJ5 A;  2OZM A;  4M3R A;  2LF3 A;  3KD5 E;  4FJJ A;  4M3X A;  3CQ8 A;  4E4B A;  3L1N A;  3SNN A;  4HCC A;  3TAG A;  4I9Q A;  2OVR B;  4QNC A;  2E32 A;  3RWU A;  2DY4 A;  3TAF A;  4ADO A;  3N1B A;  1FZ4 E;  3NE6 A;  4JRP A;  3C95 A;  2H4T A;  3E4W A;  4M3Y A;  4FJL A;  3K2O A;  2P1P B;  4RG8 A;  4J2B A;  4M3W A;  3NDK A;  3TAE A;  4KI4 A;  1MHZ G;  3LZI A;  4X5N A;  3C6O B;  4DTX A;  3NGI A;  2OVP B;  3CFO A;  4FJM A;  4AKG A;  3QEI A;  2P5O A;  3OGL B;  2JH9 A;  1FZ6 E;  3SUN A;  5H37 A;  1FS1 A;  1CLQ A;  4JS4 A;  3L2O B;  2RCU A;  1FZ2 E;  1FZ1 E;  3OGK B;  1FZH E;  4QND A;  2ATQ A;  1P22 A;  3HGK E;  3NCI A;  1XVG E;  4FJK A;  4AKI A;  2P1O B;  4E3S A;  4J2E A;  3SUP A;  4DTO A;  4I6J B;  1FZ9 E;  1LDK E;  1FXX A;  3QET A;  4FK4 A;  4M3U A;  1XVF E;  2OZS A;  2E31 A;  4B08 A;  3RMB A;  1XMH E;  3QEW A;  3QER A;  3SQ4 A;  3RMC A;  4DTS A;  3UIQ A;  4KHW A;  4FJ8 A;  4J2D A;  4KHY A;  1MMO G;  3SVI A;  4DTM A;  4M3T A;  2JH8 A;  3RMA A;  1NEX B;  4AI6 A;  3SQ2 A;  4KHQ A;  4EYW A;  3WSO A;  4KHN A;  3NAE A;  2LF6 A;  4DU3 A;  2P1N B;  4HCB A;  4FJG A;  3LDS A;  3CFR A;  3SUQ A;  3LDB A;  2P1M B;  5IBK B;  1FZ5 E;  3QEX A;  4DU1 A;  4FK2 A;  1XMF E;  3SCX A;  3SQ0 A;  1XVC E;  2FW3 A;  2JPN A;  3QNN A;  2PFT A;  3L8B A;  3QES A;  3SQ1 A;  2QXF A;  3C94 A;  3J2P A;  4KHU A;  1Q9X A;  4EP9 A;  4FJX A;  3TJY A;  3RMD A;  2JHA A;  1FZI E;  4EPH A;  3CFP A;  3SPZ A;  1XVB E;  4M42 A;  3C6N B;  3MKS B;  1IG9 A;  1XL3 C;  1Q9Y A;  2OVQ B;  2JHC A;  3S9H A;  5IZ7 A;  4FJ7 A;  4KI6 A;  2P1Q B;  3N1E A;  4FJN A;  5IRE A;  4AKH A;  4J2A A;  4X5M A;  1FYZ E;  4FK0 A;  4FJH A;  4FVM A;  4DTR A;  1XMG E;  1IH7 A;  2B8I A;  4M45 A;  4ADN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...