2LF6A

Solution nmr structure of hopabpph1448_220_320 from pseudomonas syringae pv. phaseolicola str. 1448a, midwest center for structural genomics target apc40132.4 and northeast structural genomics consortium target pst3a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
QGLDLESARLASAARHNHSANQTNEALRRLTQEGVDMERLRTSLGRYIMSLEPLPPDLRRALESVGINPFIPEELSLVDHPVLNFSAALNRMLASRQTTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB1
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Signaling protein
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf6A00
2LF3A 3TL8B 2LF6A
chains in the Genus database with same CATH superfamily
2JQTA 3HP9A 3L2OB 3MKSB 3TAEA 3L1NA 2MMBA 3BVOA 4FJJA 2P5OA 4EYWA 2E31A 4DTXA 3E4YA 1XMGE 3OGKB 4QNCA 1FZ3E 2P1NB 2E32A 2JHAA 4ICGC 3SPZA 3N1EA 3NE6A 4KHWA 4IT5A 2OVRB 1N1CA 4J2AA 3KD5E 3SI6A 4AI6A 3C6PB 4FK0A 3NCIA 4M3UA 3CQ8A 2YB5A 1FXXA 4KHYA 4DTMA 1Q9XA 1FYZE 4ADNA 4RL5A 1XU3E 5H37A 3CFRA 4DU4A 3SUPA 2VJ4A 4KI4A 2JHPA 4AKIA 1FZ2E 1XMFE 3SUOA 2P1PB 1FZ5E 2B7MA 2RCUA 1XVBE 4FJ9A 4FJMA 2MZWB 3K2OA 4M3RA 4JS5A 2MW2A 1FZHE 3L0MA 3N1BA 4M42A 1WAFA 4M3XA 3QEXA 2FYOA 1MHZG 4DTRA 3QEPA 4M3WA 4B08A 1XVCE 2HD0A 2JPNA 4EPHA 4RG8A 4DTUA 3QEVA 1IG9A 4FJ7A 2LF6A 1LDKE 2B8IA 1NEXB 1FZ8E 1FZ1E 3C95A 4J2EA 5IZ7A 3NHGA 3HGKE 3RWUA 2K5SA 2JHCA 1FPOA 1XU5E 3TABA 2PFVA 1FZ7E 1FZ9E 3HGLA 3QNNA 4M41A 1XMHE 4FJ5A 2FW3A 3UO3A 4EP9A 3SUNA 2P5GA 1FS1A 3QETA 2LF3A 4I9LA 3HL8A 3WSOA 3UO2A 3TAGA 4KHQA 3CFOA 3SJJA 4JRQA 4M3ZA 1Q9YA 5IBKB 3L8BA 2B1EA 1CLQA 2JH9A 4FJXA 4I9QA 3C6OB 4ADOA 4HCBA 4FJ8A 1MTYG 4DTOA 3C94A 3SQ1A 1P22A 2QXFA 4GAMC 2ATQA 3J27A 4FJNA 1XL3C 1FZ0E 2JH8A 2DEBA 2P1OB 4QNDA 4RNGA 4X5MA 4DTJA 3NDKA 4E4BA 3QEIA 2OZSA 2P1QB 3SQ0A 3UIQA 4J2DA 4FK2A 3TL8B 4FK4A 3J2PA 1IH7A 2PFTA 3V7DB 3RMBA 3E4WA 3QERA 3KD1E 4AKGA 3NGIA 1XVDE 4KI6A 2P1MB 3NAEA 5IREA 4JS4A 3RMAA 4M3YA 1MMOG 4DTPA 4FJGA 4DTNA 2VJ5A 3SUQA 4M3TA 3SNNA 2VIXA 2RKHA 4X5NA 4DTSA 2OYQA 2OVQB 2OVPB 3SQ4A 4KHUA 4JRPA 4AKHA 1XVGE 3TAFA 4HCCA 1FZIE 3OGMB 3QESA 3C6NB 4DU3A 3LD8A 4FJHA 3QNOA 4DU1A 1XVEE 4FJKA 4I6JB 3SQ2A 4FVMA 2DTUA 3QEWA 3LZIA 1FZ4E 3LDSA 3SVIA 3SCXA 4KHSA 1XVFE 4M45A 3CFPA 3TJYA 4KHNA 3SPYA 3LDBA 3LZJA 1WAJA 3RMDA 1FZ6E 2DY4A 1MHYG 4FJLA 3OGLB 4J2BA 2H4TA 4E3SA 3RMCA 4FJIA 1JW2A 3S9HA 2OZMA
chains in the Genus database with same CATH topology
3L2OB 3HP9A 3MKSB 3TAEA 3L1NA 2MMBA 4FJJA 2P5OA 4EYWA 2E31A 4DTXA 3E4YA 1XMGE 3OGKB 4QNCA 1FZ3E 2P1NB 2E32A 2JHAA 3SPZA 3N1EA 3NE6A 4KHWA 2OVRB 4J2AA 3KD5E 3SI6A 4AI6A 3C6PB 4FK0A 3NCIA 4M3UA 3CQ8A 2YB5A 1FXXA 4KHYA 4DTMA 1Q9XA 1FYZE 4ADNA 4RL5A 1XU3E 5H37A 3CFRA 4DU4A 3SUPA 2VJ4A 4KI4A 2JHPA 4AKIA 1FZ2E 1XMFE 3SUOA 2P1PB 1FZ5E 2B7MA 2RCUA 1XVBE 4FJ9A 4FJMA 2MZWB 3K2OA 4M3RA 4JS5A 3L0MA 1FZHE 4M42A 3N1BA 4M3XA 1WAFA 3QEXA 2FYOA 1MHZG 4DTRA 3QEPA 4M3WA 4B08A 1XVCE 2HD0A 2JPNA 4EPHA 4RG8A 4DTUA 3QEVA 1IG9A 4FJ7A 2LF6A 1LDKE 2B8IA 1NEXB 1FZ8E 1FZ1E 3C95A 4J2EA 5IZ7A 3NHGA 3HGKE 3RWUA 2JHCA 1XU5E 3TABA 2PFVA 1FZ7E 1FZ9E 3HGLA 3QNNA 4M41A 1XMHE 4FJ5A 2FW3A 4EP9A 3SUNA 2P5GA 1FS1A 3QETA 2LF3A 4I9LA 3HL8A 3WSOA 3TAGA 4KHQA 3CFOA 3SJJA 4JRQA 4M3ZA 1Q9YA 5IBKB 3L8BA 2B1EA 1CLQA 2JH9A 4FJXA 4I9QA 3C6OB 4ADOA 4HCBA 4FJ8A 1MTYG 4DTOA 3C94A 3SQ1A 1P22A 2QXFA 4GAMC 2ATQA 3J27A 4FJNA 1XL3C 1FZ0E 2JH8A 2DEBA 2P1OB 4QNDA 4RNGA 4X5MA 4DTJA 3NDKA 4E4BA 3QEIA 2OZSA 2P1QB 3SQ0A 3UIQA 4J2DA 4FK2A 3TL8B 4FK4A 3J2PA 1IH7A 2PFTA 3V7DB 3RMBA 3E4WA 3QERA 3KD1E 4AKGA 3NGIA 1XVDE 4KI6A 2P1MB 3NAEA 5IREA 4JS4A 3RMAA 4M3YA 1MMOG 4DTPA 4FJGA 4DTNA 2VJ5A 3SUQA 4M3TA 3SNNA 2VIXA 4X5NA 4DTSA 2OYQA 2OVQB 2OVPB 3SQ4A 4KHUA 4JRPA 4AKHA 1XVGE 3TAFA 4HCCA 1FZIE 3OGMB 3QESA 3C6NB 4DU3A 3LD8A 4FJHA 3QNOA 4DU1A 1XVEE 4FJKA 4I6JB 3SQ2A 4FVMA 2DTUA 3QEWA 3LZIA 1FZ4E 3LDSA 3SVIA 3SCXA 4KHSA 1XVFE 4M45A 3CFPA 3TJYA 4KHNA 3SPYA 3LDBA 3LZJA 1WAJA 3RMDA 1FZ6E 2DY4A 1MHYG 4FJLA 3OGLB 4J2BA 2H4TA 4E3SA 3RMCA 4FJIA 3S9HA 2OZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF3 A;  3TL8 B;  2LF6 A; 
#chains in the Genus database with same CATH topology
 2JQT A;  3HP9 A;  3L2O B;  3MKS B;  3TAE A;  3L1N A;  2MMB A;  3BVO A;  4FJJ A;  2P5O A;  4EYW A;  2E31 A;  4DTX A;  3E4Y A;  1XMG E;  3OGK B;  4QNC A;  1FZ3 E;  2P1N B;  2E32 A;  2JHA A;  4ICG C;  3SPZ A;  3N1E A;  3NE6 A;  4KHW A;  4IT5 A;  2OVR B;  1N1C A;  4J2A A;  3KD5 E;  3SI6 A;  4AI6 A;  3C6P B;  4FK0 A;  3NCI A;  4M3U A;  3CQ8 A;  2YB5 A;  1FXX A;  4KHY A;  4DTM A;  1Q9X A;  1FYZ E;  4ADN A;  4RL5 A;  1XU3 E;  5H37 A;  3CFR A;  4DU4 A;  3SUP A;  2VJ4 A;  4KI4 A;  2JHP A;  4AKI A;  1FZ2 E;  1XMF E;  3SUO A;  2P1P B;  1FZ5 E;  2B7M A;  2RCU A;  1XVB E;  4FJ9 A;  4FJM A;  2MZW B;  3K2O A;  4M3R A;  4JS5 A;  2MW2 A;  1FZH E;  3L0M A;  3N1B A;  4M42 A;  1WAF A;  4M3X A;  3QEX A;  2FYO A;  1MHZ G;  4DTR A;  3QEP A;  4M3W A;  4B08 A;  1XVC E;  2HD0 A;  2JPN A;  4EPH A;  4RG8 A;  4DTU A;  3QEV A;  1IG9 A;  4FJ7 A;  2LF6 A;  1LDK E;  2B8I A;  1NEX B;  1FZ8 E;  1FZ1 E;  3C95 A;  4J2E A;  5IZ7 A;  3NHG A;  3HGK E;  3RWU A;  2K5S A;  2JHC A;  1FPO A;  1XU5 E;  3TAB A;  2PFV A;  1FZ7 E;  1FZ9 E;  3HGL A;  3QNN A;  4M41 A;  1XMH E;  4FJ5 A;  2FW3 A;  3UO3 A;  4EP9 A;  3SUN A;  2P5G A;  1FS1 A;  3QET A;  2LF3 A;  4I9L A;  3HL8 A;  3WSO A;  3UO2 A;  3TAG A;  4KHQ A;  3CFO A;  3SJJ A;  4JRQ A;  4M3Z A;  1Q9Y A;  5IBK B;  3L8B A;  2B1E A;  1CLQ A;  2JH9 A;  4FJX A;  4I9Q A;  3C6O B;  4ADO A;  4HCB A;  4FJ8 A;  1MTY G;  4DTO A;  3C94 A;  3SQ1 A;  1P22 A;  2QXF A;  4GAM C;  2ATQ A;  3J27 A;  4FJN A;  1XL3 C;  1FZ0 E;  2JH8 A;  2DEB A;  2P1O B;  4QND A;  4RNG A;  4X5M A;  4DTJ A;  3NDK A;  4E4B A;  3QEI A;  2OZS A;  2P1Q B;  3SQ0 A;  3UIQ A;  4J2D A;  4FK2 A;  3TL8 B;  4FK4 A;  3J2P A;  1IH7 A;  2PFT A;  3V7D B;  3RMB A;  3E4W A;  3QER A;  3KD1 E;  4AKG A;  3NGI A;  1XVD E;  4KI6 A;  2P1M B;  3NAE A;  5IRE A;  4JS4 A;  3RMA A;  4M3Y A;  1MMO G;  4DTP A;  4FJG A;  4DTN A;  2VJ5 A;  3SUQ A;  4M3T A;  3SNN A;  2VIX A;  2RKH A;  4X5N A;  4DTS A;  2OYQ A;  2OVQ B;  2OVP B;  3SQ4 A;  4KHU A;  4JRP A;  4AKH A;  1XVG E;  3TAF A;  4HCC A;  1FZI E;  3OGM B;  3QES A;  3C6N B;  4DU3 A;  3LD8 A;  4FJH A;  3QNO A;  4DU1 A;  1XVE E;  4FJK A;  4I6J B;  3SQ2 A;  4FVM A;  2DTU A;  3QEW A;  3LZI A;  1FZ4 E;  3LDS A;  3SVI A;  3SCX A;  4KHS A;  1XVF E;  4M45 A;  3CFP A;  3TJY A;  4KHN A;  3SPY A;  3LDB A;  3LZJ A;  1WAJ A;  3RMD A;  1FZ6 E;  2DY4 A;  1MHY G;  4FJL A;  3OGL B;  4J2B A;  2H4T A;  4E3S A;  3RMC A;  4FJI A;  1JW2 A;  3S9H A;  2OZM A; 
#chains in the Genus database with same CATH homology
 3L2O B;  3HP9 A;  3MKS B;  3TAE A;  3L1N A;  2MMB A;  4FJJ A;  2P5O A;  4EYW A;  2E31 A;  4DTX A;  3E4Y A;  1XMG E;  3OGK B;  4QNC A;  1FZ3 E;  2P1N B;  2E32 A;  2JHA A;  3SPZ A;  3N1E A;  3NE6 A;  4KHW A;  2OVR B;  4J2A A;  3KD5 E;  3SI6 A;  4AI6 A;  3C6P B;  4FK0 A;  3NCI A;  4M3U A;  3CQ8 A;  2YB5 A;  1FXX A;  4KHY A;  4DTM A;  1Q9X A;  1FYZ E;  4ADN A;  4RL5 A;  1XU3 E;  5H37 A;  3CFR A;  4DU4 A;  3SUP A;  2VJ4 A;  4KI4 A;  2JHP A;  4AKI A;  1FZ2 E;  1XMF E;  3SUO A;  2P1P B;  1FZ5 E;  2B7M A;  2RCU A;  1XVB E;  4FJ9 A;  4FJM A;  2MZW B;  3K2O A;  4M3R A;  4JS5 A;  3L0M A;  1FZH E;  4M42 A;  3N1B A;  4M3X A;  1WAF A;  3QEX A;  2FYO A;  1MHZ G;  4DTR A;  3QEP A;  4M3W A;  4B08 A;  1XVC E;  2HD0 A;  2JPN A;  4EPH A;  4RG8 A;  4DTU A;  3QEV A;  1IG9 A;  4FJ7 A;  2LF6 A;  1LDK E;  2B8I A;  1NEX B;  1FZ8 E;  1FZ1 E;  3C95 A;  4J2E A;  5IZ7 A;  3NHG A;  3HGK E;  3RWU A;  2JHC A;  1XU5 E;  3TAB A;  2PFV A;  1FZ7 E;  1FZ9 E;  3HGL A;  3QNN A;  4M41 A;  1XMH E;  4FJ5 A;  2FW3 A;  4EP9 A;  3SUN A;  2P5G A;  1FS1 A;  3QET A;  2LF3 A;  4I9L A;  3HL8 A;  3WSO A;  3TAG A;  4KHQ A;  3CFO A;  3SJJ A;  4JRQ A;  4M3Z A;  1Q9Y A;  5IBK B;  3L8B A;  2B1E A;  1CLQ A;  2JH9 A;  4FJX A;  4I9Q A;  3C6O B;  4ADO A;  4HCB A;  4FJ8 A;  1MTY G;  4DTO A;  3C94 A;  3SQ1 A;  1P22 A;  2QXF A;  4GAM C;  2ATQ A;  3J27 A;  4FJN A;  1XL3 C;  1FZ0 E;  2JH8 A;  2DEB A;  2P1O B;  4QND A;  4RNG A;  4X5M A;  4DTJ A;  3NDK A;  4E4B A;  3QEI A;  2OZS A;  2P1Q B;  3SQ0 A;  3UIQ A;  4J2D A;  4FK2 A;  3TL8 B;  4FK4 A;  3J2P A;  1IH7 A;  2PFT A;  3V7D B;  3RMB A;  3E4W A;  3QER A;  3KD1 E;  4AKG A;  3NGI A;  1XVD E;  4KI6 A;  2P1M B;  3NAE A;  5IRE A;  4JS4 A;  3RMA A;  4M3Y A;  1MMO G;  4DTP A;  4FJG A;  4DTN A;  2VJ5 A;  3SUQ A;  4M3T A;  3SNN A;  2VIX A;  4X5N A;  4DTS A;  2OYQ A;  2OVQ B;  2OVP B;  3SQ4 A;  4KHU A;  4JRP A;  4AKH A;  1XVG E;  3TAF A;  4HCC A;  1FZI E;  3OGM B;  3QES A;  3C6N B;  4DU3 A;  3LD8 A;  4FJH A;  3QNO A;  4DU1 A;  1XVE E;  4FJK A;  4I6J B;  3SQ2 A;  4FVM A;  2DTU A;  3QEW A;  3LZI A;  1FZ4 E;  3LDS A;  3SVI A;  3SCX A;  4KHS A;  1XVF E;  4M45 A;  3CFP A;  3TJY A;  4KHN A;  3SPY A;  3LDB A;  3LZJ A;  1WAJ A;  3RMD A;  1FZ6 E;  2DY4 A;  1MHY G;  4FJL A;  3OGL B;  4J2B A;  2H4T A;  4E3S A;  3RMC A;  4FJI A;  3S9H A;  2OZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...