2LF8A

Intramolecular regulation of the ets domain within etv6 sequence r335 to r458
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor ETV6
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf8A01
2R7DA 3K1PA 1W5TA 4ZZLA 4GYIA 3B73A 2GZWA 3GZ5A 3ECOA 4FX0A 3JSPA 1IUYA 4R8HA 1STZA 2GQQA 2PEXA 2JPCA 1L0OC 1OYWA 1WKMA 3NRVA 3SQNA 3M1EA 2GA2A 5LGNA 3WGHA 1XDSA 1C0WA 1P6RA 2XAFA 1HSTA 1KQ8A 1TNSA 2DU9A 4R79A 3R4KA 2DK8A 4UXNA 2EFWA 5CYVA 4MNUA 2F5EA 3BJ6A 4XSZF 5TJJA 1E2XA 2MH9A 2EFNA 4YIIA 2XKOA 4CICA 3EUHA 1J0RA 2FBIA 1R5HA 2UZKA 5LBQA 3ML6A 4A6EA 2M30A 1ZG1A 2ZMEA 3AAFA 1FZPB 2A6HF 2FNAA 2JTVA 4L0ZB 4U0VA 2NRAC 3JW4A 3KP7A 3H92A 1TQMA 1JHFA 2OBPA 2ZFWA 2FF4A 3H3ZA 2MD5A 1IN4A 5DV5A 3E5UA 4LG0A 3M8FA 3T5XA 2QENA 4OINF 4IHTA 1FPQA 1RIOH 3WTTC 3SZPA 1XGNA 1P92A 2HQRA 2ADUA 2EWNA 3IRRA 5LEJA 4Y17A 3KEOA 3KE2A 1YTYA 4WK8F 4K2EA 4UVCA 2A5YB 3RYRA 3K2ZA 3HOSA 2JRTA 1O7LA 5LLQA 3VODA 5LRSA 1XGSA 3M9AA 3I0TA 4YG2F 4U7BA 1SMYF 3E6CC 3RI4A 2V1DA 4UVBA 3TQNA 3F72A 5KVRA 1XSXA 2QQ9A 3ZN1A 4N9IA 3MWMA 2YU3A 4YIFA 1GHCA 3ELKA 5LHGA 2H27A 1J9IA 1RUNA 2LF8A 1GVJA 2DAOA 1B9MA 2RN7A 2OAZA 3I54A 1ON2A 3MAJA 4G94A 2ACJA 1SD7A 1K78B 4CDGA 4MHGA 2VOOA 1R36A 3REOA 5DD4A 3R0JA 2H6CA 2FRHA 4OOIA 2BGCA 5A2QZ 2EFPA 3BZ6A 4I0BA 2FOKA 2IJLA 3EETA 2L4AA 2VXZA 1K6OA 3I5UA 3HHHA 1RNLA 4CZZA 1HKSA 2W24A 4HQMA 2UWMA 1SFEA 5ERIA 3FXQA 1KQ9A 2EV6A 1SD4A 2HKXA 4L9VA 4L9NA 1U8RA 5DD8A 5HLIA 4RGXA 4ON0A 1BC8C 3JTGA 1HXDA 1SMTA 4P9UA 1XN7A 1TTYA 3FM5A 2ZNZA 1Q1HA 4XLNF 2EJRA 2RV8A 1IZ1A 1U5TA 4WXDA 2XASA 3MCZA 4S05A 4LD5A 1B4AA 1I1SA 4G7ZF 2W84A 3JTHA 3FM3A 1RI7A 5E8GA 1KYWA 1FSEA 2P5KA 1FYLA 1W7PB 3JAMZ 4G7HF 1MKMA 1LVAA 2HOEA 1QZYA 2IPQX 2KKOA 2K7LA 5E18F 4A0YA 4FHTA 3WU0A 4N0BA 3O3KA 1QO0D 3RKYA 3E6BA 4LLLA 4U7DA 3GXOA 3GUDA 3SZTA 5CVUA 2G7HA 1IRFA 4HV6A 3HRUA 5IT3A 4PGHA 3F3XA 3PQKA 1G3TA 2A6EF 3ZN0A 2FBHA 3EDPA 4M6XA 3WU1B 2PMUA 4EGYA 2FQ3A 1R7JA 2YX4A 3TOAA 1J59A 2H94A 3O6BB 2JT1A 5FLXK 5FO5A 3TO9A 3GZ6A 4O3MA 1JE8A 4RGRA 2M45A 4N9HA 4EMSA 1S8NA 2EB7A 2PI0A 2NAZA 4ENJA 4RB0A 1LB2A 2STTA 3HRSA 3BWGA 2O6GE 3CDHA 4G6QA 4Y15A 3C7JA 3CLOA 1DPUA 4HZFA 4LJZF 3SHFA 4WX9A 4EM0B 1OYYA 2WV0A 5F64A 5FD5A 3V7CA 2YR2A 3Q5FA 3E6MA 3HYIA 4UV9A 1MJ9A 1OKRA 4RS8A 2Z5UA 1AOYA 4O6JA 3I59B 2VT2A 1QQIA 2ETHA 4U0YA 3QP5A 5HVQC 2Z3YA 4XSXF 4GGGA 1FBSA 3QOPA 1ZRCA 3FXUA 3E6DA 2W57A 4OIOF 2QZ8A 1L3LA 3QRFF 3MEXA 2WC2A 3HHGA 5H20A 1R1TA 1MDMB 2LDUA 4B8XA 1BC7C 3QU3A 3KCCA 4NB5A 1J2XA 1XCBA 2W25A 3WTZA 1FNNA 5AIPA 4FX4A 3WE2A 2E1CA 1UB9A 1B6AA 1F5TA 3DKWA 2JSCA 6PAXA 5HS7A 4MTDA 2DT5A 2ISYA 1WI9A 3ZP5A 1IN8A 5JVTA 3LA3A 1O57A 4LB5A 5LRRA 5L3FA 4IVNA 4U0WA 1JXSA 2IRFG 4KNYA 3L9FA 3GW2A 2CG4A 2D2WA 5HLHA 1IN6A 1SFXA 3S2WA 4IXAA 4RB1A 3KLNA 4ENMA 4JBAA 3TOBA 4ZH4F 4BHCA 3IL2A 1SD6A 2EFQA 5D8LB 2VBXA 1HKTA 5JI6A 4EVIA 1K7AA 2P7CB 1H9TA 4EV0A 5L3CA 3CUQC 1YQAA 3QPHA 3V4GA 1QGPA 2ISZA 1HQCA 2RQPA 4CYDA 3DQVC 3T1BA 5E17F 3DV8A 3PFIA 4E70A 4KUMA 1MZBA 2EFOA 1X3UA 3K69A 1ZLJA 2DI3A 5E8IA 3BPVA 4RB3C 4CGZA 2GWRA 1O3SA 1FY7A 2MC3A 4OU0A 2M87A 2B0LA 1TW2A 2FMYA 2GA1A 2CW0F 2QWWA 5DCMA 5CVVA 2VE8A 4M71A 4HYEA 2CWEA 4EQQA 4KYWA 1IXCA 4G6DA 1Z6RA 2OZ6A 4XLPF 3EYYA 4AD9A 2EA2A 1KQ0A 5E1WA 3V8KA 2HZTA 5CVRA 3I64A 1ZH5A 4M9XA 2XRNA 1D8KA 2RKHA 3U9GA 5LHIA 4MEXF 5KK1A 4ESJA 1ODDA 2P6TA 3IWZA 2GXGA 3Q9SA 4PDKA 2VE9A 4LLGF 4I09A 3GFMA 4I0AA 4EJOA 1DUXC 3LAJA 2LNBA 1A04A 3RPQA 4S04A 1ZARA 1P4XA 1XSDA 3GYHX 4HX4A 4L5IA 1JHHA 1VTNC 1K78A 5FFZA 2XVCA 5JHUA 2AS5F 3HTSB 5FLXZ 2Y48A 2VN2A 1UFMA 1BJAA 2O8XA 4IRIA 2QM3A 1HBXG 1S3JA 2JZYA 3M8EA 3L2CA 3ABTA 4XBFA 5HOOA 5ED4A 3LQRA 4CHUA 1QBJA 2LSOA 2PJPA 2FU4A 1D8JA 1PP8F 1BI3A 1OMIA 5L3BA 3HSEA 3T0YA 2RGVA 2NNNA 4HW0A 5D5VB 1XSVA 3ZMZA 2UXNA 4IRHA 4P9FA 4LG0B 2BYVE 4GO1A 1PP7U 4OIQF 2FXAA 3VOEA 3ZMUA 3GWZA 1IAWA 5ICEA 1FBUA 2Q0OA 1BI1A 1FX7A 3E5XA 2QVOA 4ZYGA 3N97A 4UHTA 2PQ8A 5IT9K 3WG9A 1EV7A 2XUBA 2OQRA 3WGGA 4BNCA 4G7OF 2RNJA 2X4HA 2Y0MA 4A5NA 5DEQA 2PLYA 3WGIA 3P9KA 4DQ2A 2HTJA 3V8JA 1ZYRF 3F6VA 5IT9Z 2DPUA 4GYGA 4ENKA 2F5DA 4WXHA 4OMZA 3JSOA 1ULYA 2DBBA 5H6QA 2CSOA 3E3VA 2ELHA 4Z2YA 1J75A 2P5VA 3DEUA 5FFXA 3KZYA 3LA7A 4NHJA 3FZVA 1IXRC 2WTEA 3IWFA 3KETA 2IT0A 1DP7P 1K79A 4ESBA 3B02A 1R22A 3WTUC 4CXFA 2OZUA 3Q9VA 4M9SA 1MJBA 4NQWA 2FNPA 2V79A 1MD0A 2LKPA 2FSWA 2RDPA 3HSRA 1ZG3A 1G3YA 2E7XA 3ROUA 3HSFA 4LFUA 3ZMDA 3NQOA 2BE5F 2ZBKA 1S6LA 3R61A 3FHZA 3GFLA 2K86A 3M7GA 4IF4A 4KDPA 4EGZA 1Z91A 2D1VA 2AXLA 3RJPA 4LK0F 1KU2A 1S29A 1WWXA 4L5JA 1KYZA 1HSJA 1G4DA 2BV6A 1LNWA 3RKWA 4O5VA 1CF7A 4UV8A 2H6BA 2EV0A 4ZZDA 3LSTA 5DDGA 3J80K 3KLOA 4KIFA 2CFXA 3ECHA 2L54A 1LDJA 1U78A 1GXPA 1XDUA 2HR3A 2O03A 3MFKA 4WF2A 2VOPA 5ICGA 2F2EA 1T38A 1KA8A 3F8NA 2R7FA 4LK1F 1IXSB 1F1ZA 3ZMSA 3QP6A 2Q2EA 4GCVA 3DXJF 3GVAA 1FP2A 2R3SA 1ZLKA 4P96A 4PZJA 2DQRA 5K5RA 2P5LC 4MEYF 4I2OA 3WTYC 3CUQB 2ZNYA 1J7KA 4AIJA 5HDNA 2BEOA 3J81Z 1ZAOA 4QWQA 2JPBA 4U88A 3FXRA 4HA8A 2BBYA 1ZGAA 4KMFA 4Q48A 4I01A 3TO7A 4IJAA 2ESHA 1LEAA 1BN5A 5ILSA 5EEGA 5ILVA 2KJCA 1B59A 4I02A 4M9ZA 5BS6A 2OD5A 4XRFA 3HUGA 4RB2C 2DTRA 3IKVA 2P7VB 2XAHA 2HEOA 2OQGA 2HGCA 3IC7A 2O0YA 4AIHA 4OIRF 5HS8A 4I98B 1ONVA 2V1UA 3FMSA 1SD5A 4HDVA 2J5PA 4B09A 3ABUA 4M6YA 4WWCA 2V6CA 1FYKA 1U5TB 1IW7F 1CGPA 3DPTA 2XKPA 3FMQA 1TW3A 2ZJ2A 3NEUA 3LQQA 2CYYA 1S7AA 3FWEA 1FLIA 1UHMA 3KFWX 1O7FA 2XAJA 1V4RA 2KIUA 2PG4A 2XIGA 3D5LA 3KP3A 4ESFA 4L0YB 1BIAA 3LFKA 2FBKA 1AWCA 1XGOA 2HTSA 2XAGA 3PQJA 4KA4A 2A61A 1QZZA 5H6RA 5F6FA 3BJOA 2A69F 5DYMA 3OOPA 3I53A 3L00A 2L3DA 3WTWC 1YIOA 1Z1DA 3BY6A 4I7HA 3CO7C 3KP4A 2IA2A 3K9TA 4A6DA 1IRGA 3K0LA 2PMHA 5HDGA 3BJAA 5BPIA 2HYGD 5D5UB 1FYMA 4HF0A 5D4RA 3TGNA 1R00A 1P4WA 3GFIA 1GXQA 5D4SA 2K02A 1YS7A 1YO5C 5J8FA 5E1ZB 3TKYA 1ZRDA 4Q47A 1BI2A 4AWXB 2IA1A 1OYIA 3E5QA 4HLXA 5LEKA 1DDNA 2UXXA 4BYYA 4LMYA 1KU9A 3J80Z 1LQ1A 4BAYA 2P4WA 5J8CA 2ZO4A 3I4PA 2Z33A 1B1BA 1H0MA 2Y75A 4FT8A 5E1XA 4ETSA 3I58A 4M74A 5L3GA 3F23A 4DNCA 3KEQA 5K5OA 3ULQB 4G8XA 2ZXJA 4BH9A 2CO5A 2MLKA 3P9CA 4D0PA 3T8TA 1SAXA 2VC1A 1P4AA 1XCVA 4Q4ZF 3GX4X 4MQ9F 5E20A 4LGWA 3G3ZA 2P8TA 3IKTA 3L09A 5EEHA 1G6NA 5LHHA 4WXCA 3U2RA 4LLNA 3BPXA 1LJ9A 1B9NA 3R0AA 2PFBA 2XAQA 5D6EA 4BHPA 2VC0A 2YSRA 2GAUA 4L18B 4HOBA 2E1NA 4EJUA 3C1DA 4KMUX 2ESNA 4Y13A 3KZZA 2CGPA 3WTSC 3LAPA 1I1GA 2HFHA 3RYPA 3DFGA 4HV5A 3D0SA 4F7ZA 4EJTA 1XD7A 3ISPA 1ZN2A 2NYXA 5D5WB 1NHAA 2STWA 4HAMA 4CO8A 5CJ9A 3L7WA 3KP6A 2X0LA 5DUIA 3F6OA 3BP8A 5D5XB 1YYVA 2C6YA 1Y0UA 2KJBA 2DLLA 3WTVC 2COMA 2FMLA 4M73A 5BQTA 5AIQA 1D3YA 5DCMB 1RZ4A 3DF8A 1QNTA 3I59A 4UNOA 2EV5A 3MQ0A 2E7WA 1J5YA 5K1YA 3LWFA 5L3DA 2V1XA 3P7NA 4QLCU 2FA5A 1Z6TA 4YFXF 2D45A 2VBZA 3GF2A 2NS0A 2Z9OA 1ZHFA 4HBLA 4GXOA 1XGMA 3DPLC 2DQLA 2HQNA 4HDUA 2WWYA 1TQIA 4A0ZA 4HX8A 4LB6B 1HKQA 4HQEA 2A3SA 1H9GA 4L9JA 3ZMTA 4ZYHA 1G3WA 3G73A 2XHKA 4JQFA 2QBYB 3VEPA 1BM9A 3ZMVA 1FOKA 5JFRA 5D6FA 4RAZA 4EM2A 2HKOA 1R23A 1Z05A 1U5TC 3QAHA 4RAYA 1Z7UA 1LDDA 2CQKA 1P2FA 4IPAA 1LEBA 3CJNA 3J7AO 3MZHA 4EM1A 3RPUA 1O3QA 1I6XA 3J81K 3DP7A 3P9IA 1REPC 1PDNC 3QPTA 2OU2A 3HTUA 3HRMA 1TLHB 4RGUA 2IP2A 3EYIA 2DFIA 1D5VA 2RVCA 2M5WA 4IRGA 1HW2A 4PCQA 1BOAA 1MGTA 4MGRA 3VB2A 2K4JA 2FEZA 1FT9A 3C18A 5D8KB 1YG2A 1ON1A 3GEZA 1KU3A 1T6SA 2QQBA 3U1DA 5CVIA 2VT3A 4EJWA 2NNYA 1USTA 2A68F 2KIFA 3BROA 2HWVA 3CTAA 1XMKA 2QBYA 2QYOA 2RC4A 4ZYEA 4Q5SF 1UCRA 3HRTA 4YFNF 5F1RA 3KP2A 1PUEE 1XMAA 2DO7A 2MBFA 3GFJA 2HYFA 4HLYA 1TNTA 1YW7A 1CF7B 2OA4A 4PGGA 3HOTA 2EA4A 1W5SA 4BHBA 1EH7A 1F9NA 2DW4A 3R60A 5BOXA 2GXBA 2HDCA 2J5OA 1U3EM 5BPDA 2D1HA 5FD6A 1HW1A 4YFKF 4WCGA 2O3FA 2VBYA 2PBIA 3VFZA 3FX3A 4ZYDA 3IRQA 4UVAA 2MH2A 2L01A 3E97A 3WE3A 2F5FA 1W7PD 1USSA 1HW5A 2GIVA 1IF1A 4A0XA 1Z9CA 3CUQA 1T2KA 1T0FA 3COAC 1YW9A 3WODF 3T8RA 3K1NA 5A2QK 1YFHA 2IA0A 3F21A 1JGSA 1ZREA 2XV4S 1FWZA 1RUOA 3TDZC 3TDUC 4ENNA 2HS5A 1ZRFA 2XROA 1XB4A 2VBWA 3CO6C 5FGMA 3ZPLA 3F8FA 1V3FA 3W6KB 2W85A 5CVJA 1BIBA 3I71A 4KICA 2QUFA 3F8BA 3OV8A 2YX7A 4KIGA 3QU6A 4ASNA 2TDXA 3IHUA 1E17A 1YS6A 2KIMA 5L3EA 1IN5A 2G7UA 2VODA 2P6SA 4TV7A 3HIFA 3RKXA 5HLGA 4M72A 4UUVA 4JK1X 3EQLF 1EH8A 1U2WA 1MJAA 4A5MA 1OPCA 5JR3A 2QLZA 5ILUA 2XGXA 5FB2A 3N4MA 2FE3A 2M1BA 3C3WA 3H3UA 4OMYA 1MDMA 1T39A 1I27A 1UHWA 4H0EA 4HX7A 1S7OA 3F8MA 3GLXA 1ZG5A 2L02A 2F5CA 3BDDA 4MQVA 1BI0A 3K1MA 5K5QA 4KN7X 4HF2A 5CLSA 1OR7A 4R1HA 3CUOA 3F22A 2MLGA 1WSUA 2Z99A 2ZMEB 3TO6A 3V7SA 2PN6A 1EH6A 1T98A 3V8LA 1LDKB 3W6JB 4KIBA 3KP5A 3RDIA 1WQ2A 1KGSA 4P55A 3FF5A 1F4KA 2A07F 1ZGJA 4OIPF 1SFUA 1R58A 4L9TA 5AONA 4MTEA 1KU7A 2QQAA 5J6XA 1FC3A 4BXUA 1R1VA 2KRFA 2V9VA 2K27A 4EJVA 2EK5A 5LGUA 2K4BA 1YW8A 5LGTA 5HS9A 3F8CA 3R6SA 5TRDA 2IVMA 1R1UA 5DUKA 2DPDA 2O61A 2VONA 3RTRA 4A12A 3SXYA 4RGSA 3BOQA 4AIKA 4A2UA 4IHSA 1BBYA 2DK5A 1WRJA 4KFCA 1W7PA 3RIRA 1FBQA 5DCFA 4KN4X 2Q8KA 5ICFA 1DPRA 5ICCA 4KT5C 3SFZA 5HDKA 1O3RA 1U6GA 1QPMA 2IW5A 1IN7A 2L4MA 3O2PE 1TQPA 3ZQ7A 4BQAA 1O3TA 4P5OA 1I5ZA 4G9YA 4HF1A 3LA2A 3MZYA 2LF7A 2YPRA 2ZKZA 1FP1D 1FSHA 3GO5A 2ZCWA 2H09A 3V7RA 1TBXA 1YLFA 1R5GA 3FMRA 3JAMK 3ERED 1G3SA 2M8EA 3WTXC 2G9WA 1W4MA 4AVPA 2MA3A 5BMZA
chains in the Genus database with same CATH superfamily
3QYFA 4BJTA 1X1DA 2R7DA 2HPIA 3ASOH 3K1PA 2DFEA 1W5TA 4ZZLA 2JQ7A 2OCEA 3LSIA 4GYIA 3B73A 2GZWA 4BUPA 2LG4A 2OUMA 3GZ5A 3ECOA 2DDBA 3DBLB 4FX0A 4PUSA 2VQLA 3JSPA 1IUYA 4PSXA 4BGDA 3ZR8X 4R8HA 1STZA 2GQQA 2PEXA 4M3GA 2JPCA 1L0OC 1OYWA 2VQGA 1WKMA 3NRVA 3SQNA 3M1EA 1I50J 1HA8A 1IUFA 2GA2A 5LGNA 3WGHA 1XDSA 1OCCH 1C0WA 5FKMA 3GTJJ 1P6RA 3IH4A 2K9QA 2XAFA 4PFOA 1HSTA 3K2AA 2EINH 2LFBA 3G4SI 1MSFC 2ELJA 3M3YJ 4E7KA 2XGEA 1JI8A 4B3AA 3IAM2 2GIZA 3IV5A 1KQ8A 1YOVB 4FETA 1TNSA 2DU9A 1D0ZA 2GOMA 3R4KA 2OJED 4FE7A 4R79A 2DK8A 4UXNA 2EFWA 4CA0A 4FASD 5CYVA 3PSIA 4MNUA 2F5EA 3BJ6A 4XSZF 5TJJA 4BDZA 1E2XA 2MH9A 2EFNA 4YIIA 2XKOA 4CICA 2L7MP 3EUHA 1J0RA 2FBIA 4E7ZA 1R5HA 2UZKA 5LBQA 3ML6A 2DMTA 4DZPA 2JMWA 2CS3A 3OS1A 2KZGA 2E1OA 2W4SA 2M30A 2X6XA 4A6EA 1ZG1A 2V26A 2ZMEA 2VJJA 1WGXA 3FISA 3AAFA 1FZPB 2ECCA 4BE0A 1S72I 1MSEC 2A6HF 2FNAA 2JTVA 1JKPC 4L0ZB 5K7FA 5EGOA 4BY1J 4U0VA 2NRAC 4ZTJA 1T33A 1X2NA 2VASA 3JW4A 4F92B 3KP7A 1BA5A 1MMGA 4GRIA 3H92A 1XMXA 3DEEA 1TQMA 1JHFA 2OBPA 2ZFWA 2FF4A 3H3ZA 1MBEA 1IDZA 4H4KC 2V9PA 3H9GA 1R6RA 2XB5A 2MD5A 1IN4A 2I8DA 5DV5A 1YHQI 3E5UA 4G12A 4LG0A 3M8FA 3T5XA 2QENA 4NC7A 4OINF 4IHTA 3U21A 5EDNA 1FPQA 1RIOH 4BU2A 3WTTC 2R7SA 3C2HA 3SZPA 1WJ5A 3AKZA 1JKRC 3GTGJ 1XGNA 1P92A 2HQRA 2ADUA 2EWNA 3ZQQA 3IRRA 5LEJA 1ZTRA 1A36A 4Y17A 2Y69H 3OOUA 3KEOA 3KE2A 1YTYA 4WK8F 3RQIA 4K2EA 4UVCA 2A5YB 3CC2I 4A3MJ 5EYRA 3HB9A 2DJNA 3RYRA 1RR7A 2LD5A 3K2ZA 3HOSA 1QPIA 1Z0XA 4BJ6C 2JRTA 1P7JA 3SEQA 2HOTA 3C2BA 1O7LA 5LLQA 3VODA 5LRSA 1XGSA 1NG7A 4HNVA 3M9AA 3UNGC 4AU7A 3I0TA 1GUUA 4YG2F 2P0WA 3G1MA 1BR2A 2BXZA 4U7BA 1SMYF 3E6CC 5M5XJ 3LSRA 4FTHA 3RI4A 2V1DA 5JLXA 1FOYA 3A2KA 4UVBA 5FKLA 3TQNA 2M0MA 3F72A 3S3MA 5KVRA 1XSXA 2QQ9A 3OL3A 1MBJA 3ZN1A 4PJNA 4BKXA 4N9IA 2KHMA 3MWMA 2YU3A 3OYDA 4YIFA 2JUGA 2XRLA 1GHCA 3ELKA 4XL9A 2CW8A 2JWTA 2WY7Q 5LHGA 2H27A 1J9IA 1MNMC 2NVYJ 3KX2A 5KAIC 2LF8A 1RUNA 1GVJA 2DAOA 3JRIA 1QVTA 3D1NI 1WJEA 1B9MA 3FDYA 5C3EJ 2RN7A 2OAZA 1MH3A 3I54A 1ON2A 2LMDA 3A0HC 3MAJA 4G94A 4BS9A 1GVDA 2OPTA 1SD7A 2ACJA 1K78B 4CDGA 4MHGA 2NOGA 2VOOA 1R36A 3REOA 5DD4A 3R0JA 3QPLA 1T56A 2H6CA 2VXDA 5FKOA 1FIPA 2FRHA 3OYGA 1X19A 4OOIA 2BGCA 2L5QA 5A2QZ 2E35A 3CCYA 2EFPA 3BZ6A 4I0BA 4EATA 2FOKA 2IJLA 2OCCH 1A5JA 1RR8C 2L9VA 1IRXA 2BVMA 3EETA 2L4AA 1QHGA 2VXZA 1K6OA 3I5UA 2PMZA 4MIMA 3HHHA 1TL8A 1RESA 3A4CA 1RNLA 3CP8A 4XONA 4CZZA 5C4JJ 1Y1WJ 1F43A 2AXTC 1HKSA 4NDLA 3BCBA 2UV1A 2W24A 2KDZA 2IS4A 2VLAA 4HQMA 2V1NA 2RAEA 2UWMA 1NG6A 1SFEA 1NTCA 2X48A 3W2VA 5ERIA 4BE2A 1SEUA 4V19K 1B72A 3FXQA 1KQ9A 2GM4A 2EV6A 1WH7A 2KQRA 1JTXA 3PSFA 1VQ5I 1SD4A 2HKXA 3DTKA 2VQHA 4L9VA 4W97A 1SAUA 4IHXA 4M3BA 4L9NA 3IH2A 3OMYA 1TT5B 2ZXWH 1U8RA 4L5EA 4A3GJ 1H8AC 5DD8A 5HLIA 2ZB9A 4RGXA 4ON0A 5K7HA 5EG0A 1BC8C 1TWAJ 3JTGA 1HXDA 1YIJI 4J00A 1SMTA 5GTHC 4P9UA 2NVUB 1MBFA 3M1CA 1XN7A 1TTYA 3QQAA 3CMAI 3FM5A 5HODA 2OTJI 2ZNZA 2NVQJ 1Q1HA 3B6CA 4XLNF 2EJRA 1ZR4A 4ANJA 2RV8A 2EIKH 2HDWA 2ZC2A 4D5CA 1X3ZB 1IZ1A 1U5TA 2E2HJ 4WXDA 2XASA 3MCZA 4S05A 2LBFB 2JSPA 2LOOA 1B4AA 1Y6IA 4LD5A 4XKVA 1I1SA 2L2OA 2L7KA 2DFFA 2WA0A 4RLFA 2YU9J 4DBQA 4G7ZF 2W84A 5GP9A 2JN6A 3JTHA 3FM3A 1RI7A 5E8GA 1MNEA 3PFYA 1S9HA 3JREA 4V2GA 2QKMB 1KYWA 3V42A 1FSEA 1DGRM 1JKOC 2P5KA 3MVPA 1FYLA 1W7PB 2BHYA 3MKZA 2BZTA 3H5NA 3JAMZ 4G7HF 3H0GJ 1MKMA 1SFKA 3K4JA 1LVAA 2HOEA 3IH3A 3G1LA 2M3AA 1WJAA 4AYBA 2RREA 3CF5F 4IX7A 3HUGB 3ERMA 1QZYA 2MGQA 2IPQX 1QA6A 1X3WB 2KKOA 2K7LA 5E18F 4A0YA 2O8KA 4FHTA 3WU0A 5DM7F 4N0BA 3O3KA 1DU6A 1QO0D 3RKYA 3Q0UA 3E6BA 4LLLA 3GXOA 4U7DA 3GUDA 3SZTA 5CVUA 2G7HA 3F9KA 1IRFA 4HV6A 3HRUA 5IT3A 2W7NA 4PGHA 3F3XA 3PQKA 4C9YA 5GADJ 1G3TA 2A6EF 3ZN0A 2V4JC 3VYUB 3HM5A 4BDYA 2FBHA 4OAZA 3EDPA 3CP2A 3ZQLA 4M6XA 3CCMI 3WU1B 2PMUA 4EGYA 1R7JA 2FQ3A 2YX4A 3TOAA 2HOSA 2F5VA 2JK3A 2H94A 1J59A 3O6BB 2B9SA 1SVMA 2R5ZB 2JT1A 5FLXK 5FO5A 3J7AY 3TO9A 3GZ6A 1JUMA 1JE8A 4O3MA 4RGRA 2ZFUA 2M45A 4BEHB 4B47A 4X0GA 2CV2A 4N9HA 4EMSA 1S8NA 2EB7A 4A69C 1W0TA 1JTYA 3AL0C 2PI0A 3RZDJ 2NAZA 3TW6A 4ENJA 2QSFX 4RB0A 1LB2A 2STTA 1YE9A 3HRSA 3BWGA 3CDHA 4G6QA 2O6GE 4Y15A 4X6AJ 3C7JA 1ETQA 3CLOA 4HZFA 4CYCA 4LJZF 1DPUA 3SHFA 4WX9A 4EM0B 1LE8B 1X58A 1OYYA 1SVOA 2WV0A 1Y39A 5F64A 2R7RA 5FD5A 3V7CA 2YR2A 3Q5FA 3CZ6A 4XLHA 3E6MA 3RSNA 3HYIA 4ITVA 1JUSA 4UV9A 1MJ9A 4CZCA 2Y30A 5E3NA 3S2HJ 1VQ9I 3H9QA 1EJ9A 1TWGJ 1VQ8I 3OYMA 1WCMJ 1OKRA 4QSHA 4RS8A 2Z5UA 1AOYA 3CF2A 4O6JA 3I59B 1OCRH 2VT2A 1QQIA 2ETHA 5M3MJ 3G6EI 4U0YA 3PO2J 4HNTA 3A0BC 3O8GA 3QP5A 4XMYA 1V5GA 2Z3YA 5HVQC 4XSXF 4A3CJ 3VSKA 4GGGA 1FBSA 3QOPA 1ZRCA 3FXUA 3E6DA 3Q0WA 3CCRI 1IGNA 1RPWA 2QZ8A 2W57A 4OIOF 1L3LA 4Y4RA 3QRFF 3MEXA 2WC2A 2VQCA 3HHGA 2EZIA 1N25A 5H20A 2ZJQF 1R1TA 1MDMB 4MO7A 1EA3A 3ZXSA 2LDUA 4B8XA 3K4NA 1BC7C 4U87A 4KT6A 4OWRB 3QU3A 4DGWB 2G0EA 1U9NA 3KCCA 4UUSA 1LE8A 1B72B 4NB5A 1J2XA 1P7IA 1XCBA 2KL4A 2W25A 3WTZA 1FNNA 5IP7J 3PIPF 5AIPA 1IJWC 4FX4A 3WE2A 3LSMA 1IC8A 1HLVA 2E1CA 1UB9A 1B6AA 1F5TA 2WAFA 3DKWA 4C2TA 2JSCA 3QYBA 1WJFA 3CQZJ 3ZQCA 1YJWI 3I55I 1ZQ3P 4D5FA 5HS7A 4MTDA 6PAXA 2DT5A 4XRSA 4QIWN 2ISYA 4HPQA 1WI9A 3ZP5A 1IN8A 5JVTA 3LA3A 1O57A 2QSHX 2LR8A 4AVZA 4LB5A 5LRRA 5L3FA 5B1AH 4IVNA 3S15J 2Y2ZA 1X1AA 4U0WA 1JXSA 2M9HA 2MG4A 2IRFG 5JHFA 1TP4A 4KNYA 3L9FA 3S16J 3GW2A 3NARA 2CG4A 2D2WA 3OS2A 4DYRA 3BTLA 2CQXA 4Y33A 5HLHA 1IN6A 3LFUA 4ZJZA 2MC4A 1SFXA 3S2WA 3CLQA 2IGMA 4IXAA 4RB1A 4AM3A 3KLNA 4ENMA 4JBAA 1AHDP 1UMQA 3BR6A 2E5ZA 5DM6F 3TOBA 2QQ8A 4ZH4F 5FRNA 4BHCA 3IL2A 4IHYA 2AQEA 1SD6A 1Y8RB 2FJ1A 2EFQA 4C3JJ 1BR4A 1XS9A 1GLNA 5D8LB 5EZHA 3OY9A 2VBXA 1YX3A 1HKTA 3KIOA 5JI6A 4EVIA 2Y0SN 5CQGA 4XQFA 2LKXA 1K7AA 2P7CB 1H9TA 1D0XA 4EV0A 5L3CA 1IRZA 1SC7A 3OYLA 1WJBA 3CUQC 4RM3A 1YQAA 3QPHA 3CMYA 3TP0A 3V4GA 5HNFA 4F52A 4MLOA 1QGPA 5GAGJ 3FHNA 2ISZA 1HQCA 2RQPA 4CYDA 4IQJA 3DQVC 2M8GX 4YRVA 1X2MA 2JVGA 3AG4H 3FXLA 3T1BA 5E17F 5FJ8J 1ZGWA 4HG2A 3DV8A 2DA1A 2DA5A 3PFIA 2CU7A 1ACIA 4E70A 1E0EA 3HPGA 1VQ4I 4KUMA 4CCLA 2DOFA 4F93B 1YJ9I 2FX0A 1MZBA 2VKEA 2EFOA 1X3UA 3GMEA 3K69A 2I10A 1PUFB 1ZLJA 2DI3A 3OYHA 5E8IA 4QPOA 1Z7LA 3BPVA 4RB3C 3HOXJ 4CGZA 2GWRA 3BG3A 3GTLJ 1O3SA 1FY7A 3VYSB 2MC3A 1U0JA 2WY8Q 3BR1A 2CQQA 4OU0A 2M87A 1D1CA 2B0LA 1TW2A 2FMYA 2GA1A 2CW0F 4CYCB 2NS8A 3S3OA 2QWWA 5DCMA 2JVHA 3DTIA 5CVVA 2VE8A 5JVGF 1R71A 2DXIA 2X6WA 4M71A 5F27A 2DA7A 4XRSG 5IPAA 4HYEA 2K9SA 2CWEA 4AC0A 2E19A 4EQQA 4KYWA 2Z1DA 3AFHA 4XNFA 1IXCA 3JRFA 4G6DA 1Z6RA 2OZ6A 1MMSA 1XG1A 3IUOA 4XLPF 3EYYA 4AD9A 2EA2A 3I3LA 3PUBA 3BLYA 1KQ0A 2LY9A 5E1WA 3V8KA 2HZTA 3OYEA 1QU3A 2KFDA 5CVRA 3I64A 2R92J 1ZH5A 4UUSB 4M9XA 5EG0B 2XRNA 5GPAA 1D8KA 2RKHA 3U9GA 5LHIA 3FKIJ 1WHUA 4MEXF 2OC6A 5KK1A 1T08B 4ESJA 3LSKA 1QRYA 3CCSI 1TZLA 3S14J 1ODDA 1V54H 4UB8C 2P6TA 3IWZA 3I4NJ 1UG2A 4Y52J 2GXGA 3DKXA 3Q9SA 4ZDLA 4PDKA 2VE9A 4LLGF 4I09A 3GFMA 2RNGA 2V9KA 4XM3A 3VYRB 3N05A 4I0AA 4EJOA 1DUXC 2EIMH 1W5CC 3LAJA 3BTIA 1X1PA 2LNBA 1A04A 1LFBA 3RPQA 4S04A 1ZARA 4CH7A 4B44A 1P4XA 1V5EA 1XSDA 3GYHX 4HX4A 4Z6YA 2K9NA 2GOXB 4L5IA 3S1RJ 3H5RA 2HYJA 1D0YA 1JHHA 1VTNC 1K78A 1BW5A 1OCOH 3ASNH 5FFZA 2XVCA 5JHUA 1ENHA 2O5RA 2AS5F 3HOWJ 3HTSB 1R5ID 5FLXZ 2Y31A 4FQGA 2Y48A 1SANA 2VN2A 3A01A 1VQMI 1UFMA 2DMUA 3OL4A 4BXFA 1BJAA 2DT6A 3X2QH 1UJ8A 2O8XA 4IRIA 2QM3A 1HBXG 1UELB 1S3JA 2JZYA 4G6TB 3M8EA 3L2CA 3L2WA 3ABTA 2LREA 4XBFA 4CCJA 4FCYA 4DBRA 5HOOA 5ED4A 4F3QA 4XOPA 3RZOJ 3LQRA 2JA8J 4CHUA 2FD5A 1QBJA 2LSOA 2PX9A 3L2VA 2LLKA 2PJPA 2FU4A 2BOLA 3PIOF 2L9RA 1D8JA 3HGGA 1PP8F 1BI3A 1D1BA 1OMIA 2DN0A 3FKJA 5L3BA 3HSEA 1TWHJ 3T0YA 2RGVA 2NNNA 5E3MA 2VL8A 2LY1A 3SYTA 4HW0A 2W82A 1OISA 1XSVA 5D5VB 1TT0A 2M0CA 3ZMZA 4GFBA 2M7BA 2UXNA 4IRHA 4P9FA 4LG0B 3O8HA 3HEFA 2BYVE 4BXXJ 4XKCA 1UHSA 2UUZA 4GO1A 1PP7U 4OIQF 1VFCA 2FXAA 3VOEA 3ZMUA 3GWZA 5ICEA 2WBMA 1IAWA 1A6IA 2E2IJ 1FBUA 2Q0OA 1BI1A 4E4HA 1FX7A 3E5XA 2QVOA 4DIQA 4ZYGA 3N97A 4P1WA 5GTIC 4UHTA 4UUTA 2PQ8A 5IT9K 3WG9A 3ZGKA 1Y56A 2EBIA 1EV7A 2IS6A 2XUBA 4LG3A 2OQRA 3WGGA 1ZK8A 5M5YJ 3S1QJ 4BNCA 3PJRA 2HPMA 4G7OF 2RNJA 2X4HA 2Y0MA 3AG2H 4M3EA 2M34A 4A5NA 1UAAA 4BBRJ 2EZLA 5DEQA 2PLYA 1MMDA 3WGIA 3P9KA 4DYCA 4DQ2A 4BQNA 2HTJA 3H0DA 1FOWA 4DW6A 3V8JA 1ZYRF 3K7AJ 5LD2C 3JRAA 3F6VA 1AU7A 3A02A 5IP6A 1VQ7I 5IT9Z 2DPUA 4GYGA 2KISA 2N8GA 4ENKA 5FLVA 2F5DA 4WXHA 2HI3A 4OMZA 2CRGA 3JSOA 1Y8QB 2M4KA 3ABKH 2D5VA 3ABMH 1ULYA 3FXMA 2DBBA 5H6QA 2CSOA 3E3VA 5E3OA 2ID6A 1A31A 4IZZA 3J7ZI 1WFXA 3VSLA 1DP3A 1F36A 5FROA 4AUXA 2ELHA 4Z2YA 1LVKA 2BY2A 1J75A 4PJJA 2P5VA 3DKYA 1UZCA 5FKKA 1XC5A 3DEUA 2IBDA 3BTJA 5FFXA 3KZYA 3LA7A 4NHJA 3PO3J 1KONA 1IXRC 3FZVA 2WTEA 1N78A 1IV8A 2K85A 3IWFA 5E3LA 2IEKA 4JX4A 1FMWA 4ZDPA 3KETA 3G1OA 2IT0A 1DP7P 1Y0NA 2KDOA 2VPLA 2JJ7A 1K79A 4ESBA 3B02A 2CMPA 1R22A 3BG7A 2H8RA 4PK4A 3WTUC 3E0JB 4CXFA 2VIXA 2OZUA 3Q9VA 4M9SA 4C3HJ 1YRNB 1MJBA 3BTCA 4NQWA 2FNPA 2ID3A 2V79A 1MD0A 3MN2A 3CJRB 2LKPA 2FSWA 2RDPA 3HSRA 3AG1H 3HPHA 4JX6A 1ZG3A 1G3YA 3QYEA 2E7XA 4Y7NJ 3ROUA 4DYQA 4D1QA 2VKDA 3HSFA 1VQKI 4LFUA 3ZMDA 1HDPA 3FK7A 2BE5F 3GLLA 2VB6A 1E3PA 3NQOA 2ZBKA 1S6LA 4EEFG 1G59A 3R61A 3FHZA 3GFLA 5M3FJ 2AQFA 3JRHA 2K86A 3M7GA 4IF4A 4KDPA 4EGZA 3JR9A 3BR3A 2L9NA 3KYDB 1Z91A 4LIUA 1B8IB 2D1VA 2ICWG 2DOAA 2AXLA 3RJPA 2BY1A 3BR5A 4LK0F 1KU2A 4IL6C 1S29A 1WWXA 4HSTA 4L5JA 1KYZA 1HSJA 3BG6A 5B66C 3I9V2 1G4DA 2QEXI 2BV6A 2JA7J 1LNWA 5GAHJ 3RKWA 4O5VA 1CF7A 1IDYA 4UV8A 2H6BA 2EV0A 3J7YJ 4HEA2 1YITI 3BQYA 4ZZDA 3LSTA 5DDGA 3GBGA 5IOYA 3J80K 2HOAA 3CJTB 2E2JJ 2VUMJ 3KLOA 4KIFA 2CFXA 3CDLA 1K61A 3ECHA 3L1PA 2Z16A 5J1RA 3PUFA 1WH5A 5J40A 1O4XA 5B5EC 1T95A 2KPMA 4BQOA 2Y9ZA 2L54A 1LDJA 2IAIA 4ZTFA 5C4XJ 1U78A 1GXPA 1XDUA 3OYFA 2HR3A 2O03A 1ETWA 3S3NA 2DA6A 4PJ0C 4PFPA 4WF2A 3MFKA 2VOPA 3A01B 1B8IA 5ICGA 2KLOA 3OYJA 2F2EA 1KA8A 1T38A 3F8NA 2F6CA 2R7FA 1VQNI 4LK1F 5F0FA 1IXSB 2XF6A 1NK2P 2OF7A 1F1ZA 3ZMSA 3QP6A 2Q2EA 4F55A 4GCVA 3DXJF 3GVAA 1FP2A 2BW3A 2R3SA 3PL8A 4NNJA 4LIVA 1ZLKA 2DMNA 4P96A 4PZJA 2DQRA 3H35A 5K5RA 2P5LC 1NK3P 3HXLA 1J09A 4MEYF 1VQ6I 4I2OA 1X1BA 3WTYC 1JJ6C 2EIJH 1S5LC 4KISA 3CUQB 2ZNYA 1J7KA 5EEAA 1DQUA 3K10A 4AIJA 2MSYA 3DLLF 3A03A 5HDNA 2BEOA 5F1JA 3J81Z 2DMPA 1ZAOA 4QWQA 3VYTB 1TC3C 2JPBA 4U88A 2OV7A 3FXRA 4HA8A 2BBYA 4LITA 4IQ4A 1ZGAA 3LMMA 3HOVJ 4KMFA 4Q48A 4I01A 1VQPI 2KT0A 3TO7A 4E7JA 4DOZA 1W36D 3OYIA 4IJAA 2ESHA 1LEAA 1BN5A 5BNGA 4D9JA 4C2UA 5ILSA 5EEGA 5ILVA 2CQNA 4IO9F 2Q2EB 1FJLA 2KJCA 2BY0A 2TCTA 3BR2A 3I56I 1B59A 4I02A 3FBIB 4M9ZA 5BS6A 2OD5A 1I3QJ 2LVSA 3WU2C 4XRFA 1FTZA 2JUCA 3HUGA 4RB2C 2DTRA 3IKVA 3OYNA 2P7VB 2XAHA 2DYRH 2HEOA 2PMZN 1DGWY 2OQGA 5TGTA 4PSWA 2HGCA 3IC7A 2H1KA 2O0YA 1IV6A 1PYVA 3K4CA 5IYDJ 4AIHA 2EZKA 1JT0A 3QWLA 2L7ZA 4OIRF 5HS8A 4I98B 1ONVA 2V1UA 3FMSA 1SD5A 4HDVA 4UB6C 2J5PA 2FQ4A 4B09A 3ABUA 2WAQN 2GLOA 4M6YA 4WWCA 4JX5A 2V6CA 1FYKA 1U5TB 1IW7F 1ETVA 2CW7A 1CGPA 3DPTA 4ZYAA 2XKPA 3FMQA 1X1CA 3NAUA 2ZJPF 1TW3A 2ZJ2A 1ITYA 3NEUA 2LTPA 3LQQA 2CYYA 4IOCF 1S7AA 4V2FA 3FWEA 1FLIA 1UHMA 4CCMA 1LUJB 2R7UA 1EKEA 1K83J 1FOXA 4ZDOA 3KFWX 1O7FA 2XAJA 5F04A 1V4RA 2NVTJ 2KIUA 1POGA 2PG4A 2XIGA 3D5LA 3KP3A 4ESFA 2HNHA 4L0YB 1BIAA 3CCVI 3DU5A 1Z67A 2QA4I 1G2HA 3LFKA 2ZJRF 2LYCA 3MZ8A 2FBKA 1AWCA 1XGOA 2HTSA 2Y9YA 2XAGA 3PQJA 2R5YB 3HL2A 2CH0A 4KA4A 1MMAA 3ZQHA 3OYKA 2ZXIA 2A61A 2R93J 4QPQA 2BY3A 5CPRB 4BACA 3DLAA 1QZZA 2QF7A 3LSJA 3OS0A 5H6RA 4XIDA 2RQQA 3BG9A 5F6FA 3BJOA 2A69F 2ZXHA 5DYMA 2XB0X 5KHDA 3OOPA 4HNUA 4XLEA 3HOZJ 3I53A 2KZVA 2XPWA 3L00A 1RRJA 4A3FJ 2L3DA 3WTWC 1YIOA 1Z1DA 3BY6A 4I7HA 3CO7C 4NC8A 2WAEA 2CUFA 3KP4A 3DPUA 2IA2A 3K9TA 2KRHA 3UR3C 4XKWA 1MBHA 1BW6A 1MNDA 4IEJA 2HQ5A 3KPHA 1R49A 2R7ZJ 4A6DA 3LSPA 1IRGA 4B4CA 2H1LA 3K0LA 2PMHA 4OAYA 4HSRA 2XPUA 3WHCA 3NWTA 5HDGA 3BJAA 5BPIA 2HYGD 5D5UB 2Y0SA 4HF0A 1FYMA 2XF5A 1ETXA 4XK4A 1A6QA 5D4RA 3TGNA 4LOCA 1R00A 1P4WA 4XORA 3GFIA 1Y1VJ 1GXQA 2EILH 3HG9A 5D4SA 1HOMA 1ETYA 4CSWA 2K02A 1YS7A 3D5SC 1YO5C 3CC4I 3K4LA 5J8FA 4I6ZA 1MW7A 5E1ZB 3TKYA 3FXKA 2OTLI 1RKTA 1ZRDA 1R4MB 5J4YA 1VNDA 4Q47A 1BI2A 4KITB 4AWXB 2R7TA 2A6TA 1YX5A 1H89C 2IA1A 1OYIA 3E5QA 2X9DA 4HLXA 4XN0A 5LEKA 1DDNA 2UXXA 4BYYA 4LMYA 1KU9A 3J80Z 1LQ1A 3W2WA 4BAYA 2P4WA 5J8CA 5KCMA 3MKWB 2ZO4A 3I4PA 2Z33A 4ZC3A 4RDUA 1B1BA 2R7QA 3OR1C 4D7NA 1H0MA 2Y75A 1SVLA 1W1WE 2TRTA 4FT8A 4RLQA 5E1XA 4CCNA 4E6KG 4ETSA 1TWCJ 3I58A 4M74A 5L3GA 3OR2C 2K3FA 3F23A 4DNCA 1T8IA 3KEQA 2NVXJ 5K5OA 2NXNB 3ULQB 4G8XA 2ZXJA 2VKVA 4BH9A 2MW8A 2CO5A 2MLKA 1N77A 1K6YA 2PJRA 3P9CA 1D1AA 3AG3H 4D0PA 3T8TA 1SAXA 3EUAA 1GV5A 2VC1A 1JT6A 1ORKA 1R4NB 2E60A 3BZCA 3QOEA 1P4AA 1XCVA 2JA2A 2R4GA 4Q4ZF 3GX4X 3RCOA 4MQ9F 3S1MJ 2LKSA 3S1NJ 2GXAA 1Z3YA 2XSJC 5E20A 4LGWA 4XRMA 3G3ZA 2P8TA 3IKTA 3L09A 2K3PA 3PNTA 3ZRGA 5EEHA 1G6NA 3CCJI 5LHHA 1OQYA 2LBFA 2IGOA 4WXCA 3JCUC 2ZSHB 3U2RA 4LLNA 2BHZA 3MMYB 4E7IA 4J19A 1LPQA 1MBKA 4MFEA 4YELA 2MD0A 3BPXA 1LJ9A 3Q0VA 1B9NA 3KEYA 2COBA 3R0AA 4XR6A 2PFBA 2R5ZA 2KMUA 3S2DJ 1VZ0A 3SJMA 2MABA 2XAQA 4CUGA 5D6EA 4BHPA 2VC0A 2YSRA 5KNLA 2Z2SB 2GAUA 4L18B 4HOBA 5IP9J 2E1NA 4XN3A 4RM2A 1MBGA 5EZGA 4EJUA 2W48A 1QHHD 3JRBA 2IGKA 3C1DA 5EGOB 2K5CA 4KMUX 2ESNA 4CCOA 4Y13A 3OSFA 2CUZA 2CUJA 9ANTA 3KZZA 2CGPA 3WTSC 3LAPA 1TWFJ 3G71I 4MFDA 1Q1VA 4RBOA 3TW7A 1I1GA 2HFHA 4YIRX 2X1CA 3RYPA 3DFGA 4HV5A 3D0SA 4F7ZA 1X4OA 3U1KA 1VQOI 2CFOA 5J1YA 4IKFA 4IHWA 2DA4A 4EJTA 3DU6A 1XD7A 2VPRA 3ISPA 1KZHA 3ZQIA 1W0UA 3GTQJ 1ZN2A 3OIOA 3OYCA 2NYXA 5D5WB 3JRGA 1NHAA 2V7FA 2STWA 3P5JA 4HAMA 4CO8A 5CJ9A 3LSGA 2ECBA 2E34A 3L7WA 4II2A 5J1UA 5TISC 3KP6A 3FXOA 2DDAA 4NC6A 1YJNI 1IG7A 3S17J 2X0LA 3S32A 3OSGA 4B48A 1YI2I 5DUIA 1HF0A 3EUKL 3F6OA 3BP8A 1JGGA 5D5XB 2HDDA 1YYVA 2C6YA 1Y0UA 2KJBA 3CESA 2DLLA 3WTVC 1P9QC 2COMA 2FMLA 4M73A 5BQTA 5AIQA 3SZGA 4E7SA 1V5FA 1HDDC 1D3YA 5DCMB 1RZ4A 1OFCX 3DF8A 1QNTA 2I5UA 3I59A 5IY5H 2DYSH 4UNOA 2EV5A 3MQ0A 5F0HA 2E7WA 1J5YA 4B43A 1OCZH 3IAS2 5K1YA 2LY2A 2LC2A 2W1OA 1ERDA 3GZNB 3LWFA 2V1XA 3P7NA 5L3DA 2FA5A 1Z6TA 4QLCU 1T0FC 1APLC 4YFXF 4IOAF 1EF4A 5KAFC 2D45A 3H36A 3W6VA 1OR7C 2VBZA 3E7LA 3GF2A 2NS0A 2Z9OA 1ZHFA 3BZKA 4HBLA 4PJMA 4GXOA 2E36A 2VJIA 1XGMA 2BVLA 2CQ7A 3DPLC 1VF9A 1PUFA 2DQLA 3H9JA 2HQNA 3PM1A 2VI6A 2FOWA 4RMNA 4HDUA 4AYBN 2WWYA 1TQIA 4A0ZA 2X1EA 1JUPA 4HX8A 4LB6B 1ZELA 2V6EA 3ZQFA 4A3LJ 1HKQA 2ELKA 4HQEA 3K70D 2A3SA 3DCFA 4YEJA 4C30A 1H9GA 4L9JA 1CQTA 3K6GA 2NS7A 2IS2A 4JYKA 3ZMTA 4ZYHA 1G3WA 2K9LA 3G73A 1OCTC 2XHKA 2XC7A 3L2RA 3OIPA 5EF6A 4JQFA 2QBYB 3VEPA 1BM9A 4CCKA 1VI0A 3Q3SA 3ZMVA 1FOKA 5JFRA 2MFZA 2ME6A 5D6FA 3H1CA 4RAZA 4EM2A 2HKOA 1R23A 1Z05A 1U5TC 3QAHA 4RAYA 2F48A 1XTAA 1Z7UA 2K9MA 1LDDA 1OLTA 2CQKA 1JJ8C 1P2FA 3HKZN 4IPAA 2DA3A 5HLTA 2Q1ZB 3LL7A 5GAEJ 1LEBA 3CJNA 3J7AO 3MZHA 1ZR2A 3FXJA 3BR0A 3C2GA 3M07A 4EM1A 3RPUA 1O3QA 1I6XA 3J81K 1GT0C 3DP7A 2DODA 3DWLE 3P9IA 1REPC 3ZOBA 1PDNC 2JRMA 3QPTA 2OU2A 3HTUA 3KYCB 2R0QC 2ZSIB 4BBSJ 3HRMA 1TLHB 4RGUA 3E1SA 5F08A 1QVUA 2XSDC 4PJLA 1MMNA 2AO9A 2IP2A 3EYIA 1YRNA 2DFIA 1UG0A 3B6AA 1D5VA 4NQWB 3QPSA 3KYLA 1N75A 1WI3A 2RVCA 2M5WA 3ESWB 4IRGA 4C2MJ 2R7XA 3K4KA 1HW2A 2QSGX 2R5YA 4A3KJ 4PCQA 4A3EJ 1BOAA 1MGTA 4MGRA 2QKLB 3VB2A 2K4JA 2FEZA 1FT9A 1V55H 1SFOJ 2X6OA 1WJCA 2WV1A 3WG7H 3C18A 5D8KB 1YG2A 1ON1A 1JKQC 3LNQA 3GEZA 1KU3A 1T6SA 2QQBA 3U1DA 5CVIA 2VT3A 4EJWA 2NNYA 2XDVA 1G8XA 1USTA 3HDDA 2A68F 2KIFA 3BROA 2EQRA 2HWVA 3CTAA 4XLAA 2GBYA 1XMKA 2DFHA 2QBYA 2QYOA 5E79C 3F0CA 3SDBA 4QTRA 2RC4A 4ZYEA 1RETA 4Q5SF 1UCRA 3HRTA 3MD2A 4YFNF 5F1RA 3KP2A 1PUEE 2WB1A 1XMAA 2DO7A 1Z77A 2MBFA 3GFJA 2HYFA 2HU9A 3ZQGA 3HBLA 4HLYA 1TNTA 1YW7A 1CF7B 2OA4A 4PGGA 3EUHC 3HOTA 5HNHA 3CC7I 1I39A 1QZEA 2W00A 3DEWA 2VKHA 3TMOA 4BQQA 5M5WJ 2O7OA 2EA4A 1W5SA 4BHBA 2E5NA 1MH4A 3W3CA 1EH7A 1F9NA 2E71A 2DW4A 3R60A 4JOMA 2L7FP 5BOXA 3H5AA 2GXBA 1K4SA 2XF7A 2HDCA 2J5OA 2NOJB 1U3EM 5BPDA 2D1HA 5FD6A 1XX5A 4BY7J 1HW1A 4YFKF 4WCGA 1M1EB 4DZJA 1ETOA 2E1MC 2O3FA 2XGCA 5J4VA 2VBYA 2PBIA 1FIAA 2L9SA 3VFZA 3FX3A 4ZYDA 2HVSA 3IRQA 4UVAA 2MH2A 3HC7A 1AKHB 4XLCA 3TP3A 2L01A 3FK6A 2M4GA 3E97A 3WE3A 2P81A 2F5FA 3WHBA 2LP0A 1W7PD 4A3DJ 1U9OA 1LFPA 1USSA 1HW5A 2GIVA 2CV0A 2F4IA 1IF1A 3EPZA 4A0XA 1Z9CA 2M2EA 1PVEA 4M3DA 3H3VK 2WB1N 2F4OB 3CUQA 3FBNB 1T2KA 2X6YA 3AL0B 4N4OB 2JA6J 1T0FA 2VJ4A 3W2AA 3D5RC 3COAC 1YW9A 3WODF 3VWBA 3T8RA 3K1NA 5A2QK 2YUSA 1OJLA 3TL4X 5C44J 1YFHA 2IA0A 3BQZA 4ABZA 4N4NB 3F21A 1JGSA 1ZREA 4BEHA 2CUEA 4I99C 2DJIA 2BW3B 2EH3A 4J01A 5LFAA 3GTPJ 2XV4S 1AA7A 2VJ5A 1FWZA 1RUOA 3M4OJ 3TDZC 3TDUC 4ENNA 3IP4B 2HS5A 1ZRFA 2XROA 1XB4A 2VBWA 3CO6C 1ZKGA 5FGMA 4BL0B 3F8FA 1V3FA 3BC8A 3S8PA 3W6KB 3ZPLA 2W85A 3TBIA 5B1BH 5CVJA 2M7AA 1BIBA 1ETKA 3I71A 5FLMJ 4KICA 4FE4A 2QUFA 1WPKA 3F8BA 3SEZA 3OV8A 2YX7A 5H2FC 4KIGA 3ABLH 3QU6A 4ASNA 2TDXA 3DBRB 3IHUA 1E17A 3LOCA 1YS6A 2KIMA 5J3LA 3HJEA 5L3EA 4DJAA 3JRCA 2XAUA 1IN5A 2G7UA 4XICA 2VODA 2JA5J 2P6SA 4TV7A 3HIFA 3RKXA 3CMEI 2IGNA 1NH3A 3SFIA 3HOYJ 1HC8A 5HLGA 1LKXA 4M72A 1GV2A 4UUVA 4HRIA 4JK1X 1AKHA 3A1YA 3EQLF 4A3IJ 1EH8A 5K7ZA 2A5WA 2E1MB 2DOEA 3RQ4A 4BJ5C 1U2WA 1MJAA 2X51A 2HZDA 4A5MA 2H8WA 1OPCA 5JR3A 2QLZA 4XOTA 5ILUA 5GPCA 2XGXA 3G2BA 5FB2A 3DTEA 3N4MA 2FE3A 2M1BA 3C3WA 3CDIA 3H3UA 4X1EA 4XKBA 2QCOA 3ZCOA 4A3BJ 2AHQA 1HCRA 4OMYA 1MDMA 3HKZA 1T39A 4BE1A 1I27A 1PJRA 3GTOJ 1UHWA 3CCQI 4H0EA 1E3OC 4HX7A 2WAQA 2EZHA 1S7OA 5IOZA 5EJCA 3BCAA 3F8MA 3GLXA 1E3HA 1DU0A 1ZG5A 2L02A 5CQEA 2F5CA 3BDDA 4MQVA 1BI0A 1VQLI 3K1MA 4A93J 5K5QA 4KN7X 4HF2A 5DTDA 5CLSA 3FIWA 3L2QA 2DA2A 4A3JJ 1OR7A 4R1HA 4Y3OA 1WVRA 2QGUA 3CUOA 3L2UA 3F22A 3OYBA 2MLGA 1WSUA 1RKWA 2Z99A 4XLFA 3CJQB 2ZMEB 1D5YA 3TO6A 1WZ2A 3V7SA 2B63J 3CMMA 2PN6A 1WJDA 1EH6A 2XGDA 1S7EA 1T98A 3V8LA 3BT9A 1BR1A 4D7MA 1LDKB 1K4TA 1BL0A 3K70C 2DMQA 3W6JB 4KIBA 3SDGA 3KP5A 3RDIA 1WQ2A 3CCUI 4B3XA 1KGSA 2KIQA 3MKYB 4P55A 2HXOA 3FF5A 1I3AA 1F4KA 2BXYA 3RPUD 5IYCJ 2A07F 1ZGJA 2HVRA 4OIPF 1SFUA 2X1DA 3HOUJ 4C3IJ 1Z3XA 2R7VA 1R58A 3CCLI 3TEDA 1BOBA 2F4MB 4L9TA 5AONA 4MTEA 1KU7A 2QQAA 1IO2A 5J6XA 2O9LA 1FC3A 2HVQA 4I76A 4BXUA 5JLWA 2ME0A 3I4MJ 5CKTA 5FKNA 4AIDA 3OWTA 1R1VA 3GCMA 3DBHB 1U8BA 5B3SH 1I6HJ 4RAFA 2IXSA 2KRFA 3UKGA 2V9VA 2K27A 4FISA 4JP0A 2ZMEC 4M3FA 4W1UA 3OIQA 2EK5A 4EJVA 2B7EA 3GTKJ 2HQAA 5LGUA 2K4BA 1YW8A 5LGTA 5HS9A 2LRDA 3F8CA 4II3A 3R6SA 5TRDA 2LH9A 2IVMA 1R1UA 5DUKA 2LK2A 1FEXA 4S0HB 4RA2A 5DS9A 2DPDA 2O61A 1FTTA 2VONA 5F0CA 1OCPA 3RTRA 4A12A 3SXYA 1GDTA 1RC9A 4RGSA 3JRDA 3CD6I 2XPVA 3BOQA 3VPRA 4AIKA 4A2UA 1A35A 1BBYA 2DK5A 4IHSA 1WRJA 4KFCA 4RAGA 2WADA 1W7PA 3RIRA 1FBQA 3MKLA 3CCEI 2DTZA 5DCFA 2L0KA 3M8JA 4KN4X 2Q8KA 5J47A 1MIJA 2FUG2 2KRCA 2CJJA 1XPXA 4E7LA 1R9TJ 5ICFA 1DPRA 5ICCA 4F91B 2CV1A 4KT5C 3SFZA 3HGYA 3K4MA 5HDKA 4B1RA 2IS1A 1O3RA 1U6GA 1QPMA 4GDFA 3PNYA 2IW5A 1IN7A 2L4MA 3O2PE 1H88C 1TQPA 4M6VA 2R7OA 5IYBJ 3ZQ7A 3K4BA 3OYAA 4BQAA 4IHVA 1O3TA 3RKQA 4E7HA 3LSHA 4NUBA 4P5OA 3BG5A 1I5ZA 3HZJA 4G9YA 4HF1A 3LA2A 3GTMJ 3PNVA 2DT7B 2KP6A 2A05A 3MZYA 3KZIC 2LF7A 3ONQA 2YPRA 1FMVA 2ZKZA 4UY8I 1FP1D 1LFUP 1FSHA 2MYSA 3GO5A 2ZCWA 2YS9A 2H09A 3QODA 3V7RA 5FRMA 2R7WA 1TBXA 1YLFA 1R5GA 1W36C 4KJZA 2PJRB 3FMRA 3JAMK 1X4PA 3ERED 1G3SA 3VDXA 2M8EA 3S93A 1Z21A 2HXIA 2X85A 2EPFA 1BJZA 4NBQA 3WTXC 2G9WA 3NWSA 1W4MA 2DCEA 4AVPA 2MA3A 5BMZA 2K40A
chains in the Genus database with same CATH topology
2R7DA 3K1PA 1W5TA 4ZZLA 4GYIA 3B73A 2GZWA 3GZ5A 3ECOA 4FX0A 3JSPA 1IUYA 4R8HA 1STZA 2GQQA 2PEXA 2JPCA 1L0OC 1OYWA 1WKMA 3NRVA 3SQNA 3M1EA 2GA2A 5LGNA 3WGHA 1XDSA 1C0WA 1P6RA 2XAFA 1HSTA 1KQ8A 1TNSA 2DU9A 4R79A 3R4KA 2DK8A 4UXNA 2EFWA 5CYVA 4MNUA 2F5EA 3BJ6A 4XSZF 5TJJA 1E2XA 2MH9A 2EFNA 4YIIA 2XKOA 4CICA 3EUHA 1J0RA 2FBIA 1R5HA 2UZKA 5LBQA 3ML6A 4A6EA 2M30A 1ZG1A 2ZMEA 3AAFA 1FZPB 2A6HF 2FNAA 2JTVA 4L0ZB 4U0VA 2NRAC 3JW4A 3KP7A 3H92A 1TQMA 1JHFA 2OBPA 2ZFWA 2FF4A 3H3ZA 2MD5A 1IN4A 5DV5A 3E5UA 4LG0A 3M8FA 3T5XA 2QENA 4OINF 4IHTA 1FPQA 1RIOH 3WTTC 3SZPA 1XGNA 1P92A 2HQRA 2ADUA 2EWNA 3IRRA 5LEJA 4Y17A 3KEOA 3KE2A 1YTYA 4WK8F 4K2EA 4UVCA 2A5YB 3RYRA 3K2ZA 3HOSA 2JRTA 1O7LA 5LLQA 3VODA 5LRSA 1XGSA 3M9AA 3I0TA 4YG2F 4U7BA 1SMYF 3E6CC 3RI4A 2V1DA 4UVBA 3TQNA 3F72A 5KVRA 1XSXA 2QQ9A 3ZN1A 4N9IA 3MWMA 2YU3A 4YIFA 1GHCA 3ELKA 5LHGA 2H27A 1J9IA 1RUNA 2LF8A 1GVJA 2DAOA 1B9MA 2RN7A 2OAZA 3I54A 1ON2A 3MAJA 4G94A 2ACJA 1SD7A 1K78B 4CDGA 4MHGA 2VOOA 1R36A 3REOA 5DD4A 3R0JA 2H6CA 2FRHA 4OOIA 2BGCA 5A2QZ 2EFPA 3BZ6A 4I0BA 2FOKA 2IJLA 3EETA 2L4AA 2VXZA 1K6OA 3I5UA 3HHHA 1RNLA 4CZZA 1HKSA 2W24A 4HQMA 2UWMA 1SFEA 5ERIA 3FXQA 1KQ9A 2EV6A 1SD4A 2HKXA 4L9VA 4L9NA 1U8RA 5DD8A 5HLIA 4RGXA 4ON0A 1BC8C 3JTGA 1HXDA 1SMTA 4P9UA 1XN7A 1TTYA 3FM5A 2ZNZA 1Q1HA 4XLNF 2EJRA 2RV8A 1IZ1A 1U5TA 4WXDA 2XASA 3MCZA 4S05A 4LD5A 1B4AA 1I1SA 4G7ZF 2W84A 3JTHA 3FM3A 1RI7A 5E8GA 1KYWA 1FSEA 2P5KA 1FYLA 1W7PB 3JAMZ 4G7HF 1MKMA 1LVAA 2HOEA 1QZYA 2IPQX 2KKOA 2K7LA 5E18F 4A0YA 4FHTA 3WU0A 4N0BA 3O3KA 1QO0D 3RKYA 3E6BA 4LLLA 4U7DA 3GXOA 3GUDA 3SZTA 5CVUA 2G7HA 1IRFA 4HV6A 3HRUA 5IT3A 4PGHA 3F3XA 3PQKA 1G3TA 2A6EF 3ZN0A 2FBHA 3EDPA 4M6XA 3WU1B 2PMUA 4EGYA 2FQ3A 1R7JA 2YX4A 3TOAA 1J59A 2H94A 3O6BB 2JT1A 5FLXK 5FO5A 3TO9A 3GZ6A 4O3MA 1JE8A 4RGRA 2M45A 4N9HA 4EMSA 1S8NA 2EB7A 2PI0A 2NAZA 4ENJA 4RB0A 1LB2A 2STTA 3HRSA 3BWGA 2O6GE 3CDHA 4G6QA 4Y15A 3C7JA 3CLOA 1DPUA 4HZFA 4LJZF 3SHFA 4WX9A 4EM0B 1OYYA 2WV0A 5F64A 5FD5A 3V7CA 2YR2A 3Q5FA 3E6MA 3HYIA 4UV9A 1MJ9A 1OKRA 4RS8A 2Z5UA 1AOYA 4O6JA 3I59B 2VT2A 1QQIA 2ETHA 4U0YA 3QP5A 5HVQC 2Z3YA 4XSXF 4GGGA 1FBSA 3QOPA 1ZRCA 3FXUA 3E6DA 2W57A 4OIOF 2QZ8A 1L3LA 3QRFF 3MEXA 2WC2A 3HHGA 5H20A 1R1TA 1MDMB 2LDUA 4B8XA 1BC7C 3QU3A 3KCCA 4NB5A 1J2XA 1XCBA 2W25A 3WTZA 1FNNA 5AIPA 4FX4A 3WE2A 2E1CA 1UB9A 1B6AA 1F5TA 3DKWA 2JSCA 6PAXA 5HS7A 4MTDA 2DT5A 2ISYA 1WI9A 3ZP5A 1IN8A 5JVTA 3LA3A 1O57A 4LB5A 5LRRA 5L3FA 4IVNA 4U0WA 1JXSA 2IRFG 4KNYA 3L9FA 3GW2A 2CG4A 2D2WA 5HLHA 1IN6A 1SFXA 3S2WA 4IXAA 4RB1A 3KLNA 4ENMA 4JBAA 3TOBA 4ZH4F 4BHCA 3IL2A 1SD6A 2EFQA 5D8LB 2VBXA 1HKTA 5JI6A 4EVIA 1K7AA 2P7CB 1H9TA 4EV0A 5L3CA 3CUQC 1YQAA 3QPHA 3V4GA 1QGPA 2ISZA 1HQCA 2RQPA 4CYDA 3DQVC 3T1BA 5E17F 3DV8A 3PFIA 4E70A 4KUMA 1MZBA 2EFOA 1X3UA 3K69A 1ZLJA 2DI3A 5E8IA 3BPVA 4RB3C 4CGZA 2GWRA 1O3SA 1FY7A 2MC3A 4OU0A 2M87A 2B0LA 1TW2A 2FMYA 2GA1A 2CW0F 2QWWA 5DCMA 5CVVA 2VE8A 4M71A 4HYEA 2CWEA 4EQQA 4KYWA 1IXCA 4G6DA 1Z6RA 2OZ6A 4XLPF 3EYYA 4AD9A 2EA2A 1KQ0A 5E1WA 3V8KA 2HZTA 5CVRA 3I64A 1ZH5A 4M9XA 2XRNA 1D8KA 2RKHA 3U9GA 5LHIA 4MEXF 5KK1A 4ESJA 1ODDA 2P6TA 3IWZA 2GXGA 3Q9SA 4PDKA 2VE9A 4LLGF 4I09A 3GFMA 4I0AA 4EJOA 1DUXC 3LAJA 2LNBA 1A04A 3RPQA 4S04A 1ZARA 1P4XA 1XSDA 3GYHX 4HX4A 4L5IA 1JHHA 1VTNC 1K78A 5FFZA 2XVCA 5JHUA 2AS5F 3HTSB 5FLXZ 2Y48A 2VN2A 1UFMA 1BJAA 2O8XA 4IRIA 2QM3A 1HBXG 1S3JA 2JZYA 3M8EA 3L2CA 3ABTA 4XBFA 5HOOA 5ED4A 3LQRA 4CHUA 1QBJA 2LSOA 2PJPA 2FU4A 1D8JA 1PP8F 1BI3A 1OMIA 5L3BA 3HSEA 3T0YA 2RGVA 2NNNA 4HW0A 5D5VB 1XSVA 3ZMZA 2UXNA 4IRHA 4P9FA 4LG0B 2BYVE 4GO1A 1PP7U 4OIQF 2FXAA 3VOEA 3ZMUA 3GWZA 1IAWA 5ICEA 1FBUA 2Q0OA 1BI1A 1FX7A 3E5XA 2QVOA 4ZYGA 3N97A 4UHTA 2PQ8A 5IT9K 3WG9A 1EV7A 2XUBA 2OQRA 3WGGA 4BNCA 4G7OF 2RNJA 2X4HA 2Y0MA 4A5NA 5DEQA 2PLYA 3WGIA 3P9KA 4DQ2A 2HTJA 3V8JA 1ZYRF 3F6VA 5IT9Z 2DPUA 4GYGA 4ENKA 2F5DA 4WXHA 4OMZA 3JSOA 1ULYA 2DBBA 5H6QA 2CSOA 3E3VA 2ELHA 4Z2YA 1J75A 2P5VA 3DEUA 5FFXA 3KZYA 3LA7A 4NHJA 3FZVA 1IXRC 2WTEA 3IWFA 3KETA 2IT0A 1DP7P 1K79A 4ESBA 3B02A 1R22A 3WTUC 4CXFA 2OZUA 3Q9VA 4M9SA 1MJBA 4NQWA 2FNPA 2V79A 1MD0A 2LKPA 2FSWA 2RDPA 3HSRA 1ZG3A 1G3YA 2E7XA 3ROUA 3HSFA 4LFUA 3ZMDA 3NQOA 2BE5F 2ZBKA 1S6LA 3R61A 3FHZA 3GFLA 2K86A 3M7GA 4IF4A 4KDPA 4EGZA 1Z91A 2D1VA 2AXLA 3RJPA 4LK0F 1KU2A 1S29A 1WWXA 4L5JA 1KYZA 1HSJA 1G4DA 2BV6A 1LNWA 3RKWA 4O5VA 1CF7A 4UV8A 2H6BA 2EV0A 4ZZDA 3LSTA 5DDGA 3J80K 3KLOA 4KIFA 2CFXA 3ECHA 2L54A 1LDJA 1U78A 1GXPA 1XDUA 2HR3A 2O03A 3MFKA 4WF2A 2VOPA 5ICGA 2F2EA 1T38A 1KA8A 3F8NA 2R7FA 4LK1F 1IXSB 1F1ZA 3ZMSA 3QP6A 2Q2EA 4GCVA 3DXJF 3GVAA 1FP2A 2R3SA 1ZLKA 4P96A 4PZJA 2DQRA 5K5RA 2P5LC 4MEYF 4I2OA 3WTYC 3CUQB 2ZNYA 1J7KA 4AIJA 5HDNA 2BEOA 3J81Z 1ZAOA 4QWQA 2JPBA 4U88A 3FXRA 4HA8A 2BBYA 1ZGAA 4KMFA 4Q48A 4I01A 3TO7A 4IJAA 2ESHA 1LEAA 1BN5A 5ILSA 5EEGA 5ILVA 2KJCA 1B59A 4I02A 4M9ZA 5BS6A 2OD5A 4XRFA 3HUGA 4RB2C 2DTRA 3IKVA 2P7VB 2XAHA 2HEOA 2OQGA 2HGCA 3IC7A 2O0YA 4AIHA 4OIRF 5HS8A 4I98B 1ONVA 2V1UA 3FMSA 1SD5A 4HDVA 2J5PA 4B09A 3ABUA 4M6YA 4WWCA 2V6CA 1FYKA 1U5TB 1IW7F 1CGPA 3DPTA 2XKPA 3FMQA 1TW3A 2ZJ2A 3NEUA 3LQQA 2CYYA 1S7AA 3FWEA 1FLIA 1UHMA 3KFWX 1O7FA 2XAJA 1V4RA 2KIUA 2PG4A 2XIGA 3D5LA 3KP3A 4ESFA 4L0YB 1BIAA 3LFKA 2FBKA 1AWCA 1XGOA 2HTSA 2XAGA 3PQJA 4KA4A 2A61A 1QZZA 5H6RA 5F6FA 3BJOA 2A69F 5DYMA 3OOPA 3I53A 3L00A 2L3DA 3WTWC 1YIOA 1Z1DA 3BY6A 4I7HA 3CO7C 3KP4A 2IA2A 3K9TA 4A6DA 1IRGA 3K0LA 2PMHA 5HDGA 3BJAA 5BPIA 2HYGD 5D5UB 1FYMA 4HF0A 5D4RA 3TGNA 1R00A 1P4WA 3GFIA 1GXQA 5D4SA 2K02A 1YS7A 1YO5C 5J8FA 5E1ZB 3TKYA 1ZRDA 4Q47A 1BI2A 4AWXB 2IA1A 1OYIA 3E5QA 4HLXA 5LEKA 1DDNA 2UXXA 4BYYA 4LMYA 1KU9A 3J80Z 1LQ1A 4BAYA 2P4WA 5J8CA 2ZO4A 3I4PA 2Z33A 1B1BA 1H0MA 2Y75A 4FT8A 5E1XA 4ETSA 3I58A 4M74A 5L3GA 3F23A 4DNCA 3KEQA 5K5OA 3ULQB 4G8XA 2ZXJA 4BH9A 2CO5A 2MLKA 3P9CA 4D0PA 3T8TA 1SAXA 2VC1A 1P4AA 1XCVA 4Q4ZF 3GX4X 4MQ9F 5E20A 4LGWA 3G3ZA 2P8TA 3IKTA 3L09A 5EEHA 1G6NA 5LHHA 4WXCA 3U2RA 4LLNA 3BPXA 1LJ9A 1B9NA 3R0AA 2PFBA 2XAQA 5D6EA 4BHPA 2VC0A 2YSRA 2GAUA 4L18B 4HOBA 2E1NA 4EJUA 3C1DA 4KMUX 2ESNA 4Y13A 3KZZA 2CGPA 3WTSC 3LAPA 1I1GA 2HFHA 3RYPA 3DFGA 4HV5A 3D0SA 4F7ZA 4EJTA 1XD7A 3ISPA 1ZN2A 2NYXA 5D5WB 1NHAA 2STWA 4HAMA 4CO8A 5CJ9A 3L7WA 3KP6A 2X0LA 5DUIA 3F6OA 3BP8A 5D5XB 1YYVA 2C6YA 1Y0UA 2KJBA 2DLLA 3WTVC 2COMA 2FMLA 4M73A 5BQTA 5AIQA 1D3YA 5DCMB 1RZ4A 3DF8A 1QNTA 3I59A 4UNOA 2EV5A 3MQ0A 2E7WA 1J5YA 5K1YA 3LWFA 5L3DA 2V1XA 3P7NA 4QLCU 2FA5A 1Z6TA 4YFXF 2D45A 2VBZA 3GF2A 2NS0A 2Z9OA 1ZHFA 4HBLA 4GXOA 1XGMA 3DPLC 2DQLA 2HQNA 4HDUA 2WWYA 1TQIA 4A0ZA 4HX8A 4LB6B 1HKQA 4HQEA 2A3SA 1H9GA 4L9JA 3ZMTA 4ZYHA 1G3WA 3G73A 2XHKA 4JQFA 2QBYB 3VEPA 1BM9A 3ZMVA 1FOKA 5JFRA 5D6FA 4RAZA 4EM2A 2HKOA 1R23A 1Z05A 1U5TC 3QAHA 4RAYA 1Z7UA 1LDDA 2CQKA 1P2FA 4IPAA 1LEBA 3CJNA 3J7AO 3MZHA 4EM1A 3RPUA 1O3QA 1I6XA 3J81K 3DP7A 3P9IA 1REPC 1PDNC 3QPTA 2OU2A 3HTUA 3HRMA 1TLHB 4RGUA 2IP2A 3EYIA 2DFIA 1D5VA 2RVCA 2M5WA 4IRGA 1HW2A 4PCQA 1BOAA 1MGTA 4MGRA 3VB2A 2K4JA 2FEZA 1FT9A 3C18A 5D8KB 1YG2A 1ON1A 3GEZA 1KU3A 1T6SA 2QQBA 3U1DA 5CVIA 2VT3A 4EJWA 2NNYA 1USTA 2A68F 2KIFA 3BROA 2HWVA 3CTAA 1XMKA 2QBYA 2QYOA 2RC4A 4ZYEA 4Q5SF 1UCRA 3HRTA 4YFNF 5F1RA 3KP2A 1PUEE 1XMAA 2DO7A 2MBFA 3GFJA 2HYFA 4HLYA 1TNTA 1YW7A 1CF7B 2OA4A 4PGGA 3HOTA 2EA4A 1W5SA 4BHBA 1EH7A 1F9NA 2DW4A 3R60A 5BOXA 2GXBA 2HDCA 2J5OA 1U3EM 5BPDA 2D1HA 5FD6A 1HW1A 4YFKF 4WCGA 2O3FA 2VBYA 2PBIA 3VFZA 3FX3A 4ZYDA 3IRQA 4UVAA 2MH2A 2L01A 3E97A 3WE3A 2F5FA 1W7PD 1USSA 1HW5A 2GIVA 1IF1A 4A0XA 1Z9CA 3CUQA 1T2KA 1T0FA 3COAC 1YW9A 3WODF 3T8RA 3K1NA 5A2QK 1YFHA 2IA0A 3F21A 1JGSA 1ZREA 2XV4S 1FWZA 1RUOA 3TDZC 3TDUC 4ENNA 2HS5A 1ZRFA 2XROA 1XB4A 2VBWA 3CO6C 5FGMA 3ZPLA 3F8FA 1V3FA 3W6KB 2W85A 5CVJA 1BIBA 3I71A 4KICA 2QUFA 3F8BA 3OV8A 2YX7A 4KIGA 3QU6A 4ASNA 2TDXA 3IHUA 1E17A 1YS6A 2KIMA 5L3EA 1IN5A 2G7UA 2VODA 2P6SA 4TV7A 3HIFA 3RKXA 5HLGA 4M72A 4UUVA 4JK1X 3EQLF 1EH8A 1U2WA 1MJAA 4A5MA 1OPCA 5JR3A 2QLZA 5ILUA 2XGXA 5FB2A 3N4MA 2FE3A 2M1BA 3C3WA 3H3UA 4OMYA 1MDMA 1T39A 1I27A 1UHWA 4H0EA 4HX7A 1S7OA 3F8MA 3GLXA 1ZG5A 2L02A 2F5CA 3BDDA 4MQVA 1BI0A 3K1MA 5K5QA 4KN7X 4HF2A 5CLSA 1OR7A 4R1HA 3CUOA 3F22A 2MLGA 1WSUA 2Z99A 2ZMEB 3TO6A 3V7SA 2PN6A 1EH6A 1T98A 3V8LA 1LDKB 3W6JB 4KIBA 3KP5A 3RDIA 1WQ2A 1KGSA 4P55A 3FF5A 1F4KA 2A07F 1ZGJA 4OIPF 1SFUA 1R58A 4L9TA 5AONA 4MTEA 1KU7A 2QQAA 5J6XA 1FC3A 4BXUA 1R1VA 2KRFA 2V9VA 2K27A 4EJVA 2EK5A 5LGUA 2K4BA 1YW8A 5LGTA 5HS9A 3F8CA 3R6SA 5TRDA 2IVMA 1R1UA 5DUKA 2DPDA 2O61A 2VONA 3RTRA 4A12A 3SXYA 4RGSA 3BOQA 4AIKA 4A2UA 4IHSA 1BBYA 2DK5A 1WRJA 4KFCA 1W7PA 3RIRA 1FBQA 5DCFA 4KN4X 2Q8KA 5ICFA 1DPRA 5ICCA 4KT5C 3SFZA 5HDKA 1O3RA 1U6GA 1QPMA 2IW5A 1IN7A 2L4MA 3O2PE 1TQPA 3ZQ7A 4BQAA 1O3TA 4P5OA 1I5ZA 4G9YA 4HF1A 3LA2A 3MZYA 2LF7A 2YPRA 2ZKZA 1FP1D 1FSHA 3GO5A 2ZCWA 2H09A 3V7RA 1TBXA 1YLFA 1R5GA 3FMRA 3JAMK 3ERED 1G3SA 2M8EA 3WTXC 2G9WA 1W4MA 4AVPA 2MA3A 5BMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  3K1P A;  1W5T A;  4ZZL A;  4GYI A;  3B73 A;  2GZW A;  3GZ5 A;  3ECO A;  4FX0 A;  3JSP A;  1IUY A;  4R8H A;  1STZ A;  2GQQ A;  2PEX A;  2JPC A;  1L0O C;  1OYW A;  1WKM A;  3NRV A;  3SQN A;  3M1E A;  2GA2 A;  5LGN A;  3WGH A;  1XDS A;  1C0W A;  1P6R A;  2XAF A;  1HST A;  1KQ8 A;  1TNS A;  2DU9 A;  4R79 A;  3R4K A;  2DK8 A;  4UXN A;  2EFW A;  5CYV A;  4MNU A;  2F5E A;  3BJ6 A;  4XSZ F;  5TJJ A;  1E2X A;  2MH9 A;  2EFN A;  4YII A;  2XKO A;  4CIC A;  3EUH A;  1J0R A;  2FBI A;  1R5H A;  2UZK A;  5LBQ A;  3ML6 A;  4A6E A;  2M30 A;  1ZG1 A;  2ZME A;  3AAF A;  1FZP B;  2A6H F;  2FNA A;  2JTV A;  4L0Z B;  4U0V A;  2NRA C;  3JW4 A;  3KP7 A;  3H92 A;  1TQM A;  1JHF A;  2OBP A;  2ZFW A;  2FF4 A;  3H3Z A;  2MD5 A;  1IN4 A;  5DV5 A;  3E5U A;  4LG0 A;  3M8F A;  3T5X A;  2QEN A;  4OIN F;  4IHT A;  1FPQ A;  1RIO H;  3WTT C;  3SZP A;  1XGN A;  1P92 A;  2HQR A;  2ADU A;  2EWN A;  3IRR A;  5LEJ A;  4Y17 A;  3KEO A;  3KE2 A;  1YTY A;  4WK8 F;  4K2E A;  4UVC A;  2A5Y B;  3RYR A;  3K2Z A;  3HOS A;  2JRT A;  1O7L A;  5LLQ A;  3VOD A;  5LRS A;  1XGS A;  3M9A A;  3I0T A;  4YG2 F;  4U7B A;  1SMY F;  3E6C C;  3RI4 A;  2V1D A;  4UVB A;  3TQN A;  3F72 A;  5KVR A;  1XSX A;  2QQ9 A;  3ZN1 A;  4N9I A;  3MWM A;  2YU3 A;  4YIF A;  1GHC A;  3ELK A;  5LHG A;  2H27 A;  1J9I A;  1RUN A;  2LF8 A;  1GVJ A;  2DAO A;  1B9M A;  2RN7 A;  2OAZ A;  3I54 A;  1ON2 A;  3MAJ A;  4G94 A;  2ACJ A;  1SD7 A;  1K78 B;  4CDG A;  4MHG A;  2VOO A;  1R36 A;  3REO A;  5DD4 A;  3R0J A;  2H6C A;  2FRH A;  4OOI A;  2BGC A;  5A2Q Z;  2EFP A;  3BZ6 A;  4I0B A;  2FOK A;  2IJL A;  3EET A;  2L4A A;  2VXZ A;  1K6O A;  3I5U A;  3HHH A;  1RNL A;  4CZZ A;  1HKS A;  2W24 A;  4HQM A;  2UWM A;  1SFE A;  5ERI A;  3FXQ A;  1KQ9 A;  2EV6 A;  1SD4 A;  2HKX A;  4L9V A;  4L9N A;  1U8R A;  5DD8 A;  5HLI A;  4RGX A;  4ON0 A;  1BC8 C;  3JTG A;  1HXD A;  1SMT A;  4P9U A;  1XN7 A;  1TTY A;  3FM5 A;  2ZNZ A;  1Q1H A;  4XLN F;  2EJR A;  2RV8 A;  1IZ1 A;  1U5T A;  4WXD A;  2XAS A;  3MCZ A;  4S05 A;  4LD5 A;  1B4A A;  1I1S A;  4G7Z F;  2W84 A;  3JTH A;  3FM3 A;  1RI7 A;  5E8G A;  1KYW A;  1FSE A;  2P5K A;  1FYL A;  1W7P B;  3JAM Z;  4G7H F;  1MKM A;  1LVA A;  2HOE A;  1QZY A;  2IPQ X;  2KKO A;  2K7L A;  5E18 F;  4A0Y A;  4FHT A;  3WU0 A;  4N0B A;  3O3K A;  1QO0 D;  3RKY A;  3E6B A;  4LLL A;  4U7D A;  3GXO A;  3GUD A;  3SZT A;  5CVU A;  2G7H A;  1IRF A;  4HV6 A;  3HRU A;  5IT3 A;  4PGH A;  3F3X A;  3PQK A;  1G3T A;  2A6E F;  3ZN0 A;  2FBH A;  3EDP A;  4M6X A;  3WU1 B;  2PMU A;  4EGY A;  2FQ3 A;  1R7J A;  2YX4 A;  3TOA A;  1J59 A;  2H94 A;  3O6B B;  2JT1 A;  5FLX K;  5FO5 A;  3TO9 A;  3GZ6 A;  4O3M A;  1JE8 A;  4RGR A;  2M45 A;  4N9H A;  4EMS A;  1S8N A;  2EB7 A;  2PI0 A;  2NAZ A;  4ENJ A;  4RB0 A;  1LB2 A;  2STT A;  3HRS A;  3BWG A;  2O6G E;  3CDH A;  4G6Q A;  4Y15 A;  3C7J A;  3CLO A;  1DPU A;  4HZF A;  4LJZ F;  3SHF A;  4WX9 A;  4EM0 B;  1OYY A;  2WV0 A;  5F64 A;  5FD5 A;  3V7C A;  2YR2 A;  3Q5F A;  3E6M A;  3HYI A;  4UV9 A;  1MJ9 A;  1OKR A;  4RS8 A;  2Z5U A;  1AOY A;  4O6J A;  3I59 B;  2VT2 A;  1QQI A;  2ETH A;  4U0Y A;  3QP5 A;  5HVQ C;  2Z3Y A;  4XSX F;  4GGG A;  1FBS A;  3QOP A;  1ZRC A;  3FXU A;  3E6D A;  2W57 A;  4OIO F;  2QZ8 A;  1L3L A;  3QRF F;  3MEX A;  2WC2 A;  3HHG A;  5H20 A;  1R1T A;  1MDM B;  2LDU A;  4B8X A;  1BC7 C;  3QU3 A;  3KCC A;  4NB5 A;  1J2X A;  1XCB A;  2W25 A;  3WTZ A;  1FNN A;  5AIP A;  4FX4 A;  3WE2 A;  2E1C A;  1UB9 A;  1B6A A;  1F5T A;  3DKW A;  2JSC A;  6PAX A;  5HS7 A;  4MTD A;  2DT5 A;  2ISY A;  1WI9 A;  3ZP5 A;  1IN8 A;  5JVT A;  3LA3 A;  1O57 A;  4LB5 A;  5LRR A;  5L3F A;  4IVN A;  4U0W A;  1JXS A;  2IRF G;  4KNY A;  3L9F A;  3GW2 A;  2CG4 A;  2D2W A;  5HLH A;  1IN6 A;  1SFX A;  3S2W A;  4IXA A;  4RB1 A;  3KLN A;  4ENM A;  4JBA A;  3TOB A;  4ZH4 F;  4BHC A;  3IL2 A;  1SD6 A;  2EFQ A;  5D8L B;  2VBX A;  1HKT A;  5JI6 A;  4EVI A;  1K7A A;  2P7C B;  1H9T A;  4EV0 A;  5L3C A;  3CUQ C;  1YQA A;  3QPH A;  3V4G A;  1QGP A;  2ISZ A;  1HQC A;  2RQP A;  4CYD A;  3DQV C;  3T1B A;  5E17 F;  3DV8 A;  3PFI A;  4E70 A;  4KUM A;  1MZB A;  2EFO A;  1X3U A;  3K69 A;  1ZLJ A;  2DI3 A;  5E8I A;  3BPV A;  4RB3 C;  4CGZ A;  2GWR A;  1O3S A;  1FY7 A;  2MC3 A;  4OU0 A;  2M87 A;  2B0L A;  1TW2 A;  2FMY A;  2GA1 A;  2CW0 F;  2QWW A;  5DCM A;  5CVV A;  2VE8 A;  4M71 A;  4HYE A;  2CWE A;  4EQQ A;  4KYW A;  1IXC A;  4G6D A;  1Z6R A;  2OZ6 A;  4XLP F;  3EYY A;  4AD9 A;  2EA2 A;  1KQ0 A;  5E1W A;  3V8K A;  2HZT A;  5CVR A;  3I64 A;  1ZH5 A;  4M9X A;  2XRN A;  1D8K A;  2RKH A;  3U9G A;  5LHI A;  4MEX F;  5KK1 A;  4ESJ A;  1ODD A;  2P6T A;  3IWZ A;  2GXG A;  3Q9S A;  4PDK A;  2VE9 A;  4LLG F;  4I09 A;  3GFM A;  4I0A A;  4EJO A;  1DUX C;  3LAJ A;  2LNB A;  1A04 A;  3RPQ A;  4S04 A;  1ZAR A;  1P4X A;  1XSD A;  3GYH X;  4HX4 A;  4L5I A;  1JHH A;  1VTN C;  1K78 A;  5FFZ A;  2XVC A;  5JHU A;  2AS5 F;  3HTS B;  5FLX Z;  2Y48 A;  2VN2 A;  1UFM A;  1BJA A;  2O8X A;  4IRI A;  2QM3 A;  1HBX G;  1S3J A;  2JZY A;  3M8E A;  3L2C A;  3ABT A;  4XBF A;  5HOO A;  5ED4 A;  3LQR A;  4CHU A;  1QBJ A;  2LSO A;  2PJP A;  2FU4 A;  1D8J A;  1PP8 F;  1BI3 A;  1OMI A;  5L3B A;  3HSE A;  3T0Y A;  2RGV A;  2NNN A;  4HW0 A;  5D5V B;  1XSV A;  3ZMZ A;  2UXN A;  4IRH A;  4P9F A;  4LG0 B;  2BYV E;  4GO1 A;  1PP7 U;  4OIQ F;  2FXA A;  3VOE A;  3ZMU A;  3GWZ A;  1IAW A;  5ICE A;  1FBU A;  2Q0O A;  1BI1 A;  1FX7 A;  3E5X A;  2QVO A;  4ZYG A;  3N97 A;  4UHT A;  2PQ8 A;  5IT9 K;  3WG9 A;  1EV7 A;  2XUB A;  2OQR A;  3WGG A;  4BNC A;  4G7O F;  2RNJ A;  2X4H A;  2Y0M A;  4A5N A;  5DEQ A;  2PLY A;  3WGI A;  3P9K A;  4DQ2 A;  2HTJ A;  3V8J A;  1ZYR F;  3F6V A;  5IT9 Z;  2DPU A;  4GYG A;  4ENK A;  2F5D A;  4WXH A;  4OMZ A;  3JSO A;  1ULY A;  2DBB A;  5H6Q A;  2CSO A;  3E3V A;  2ELH A;  4Z2Y A;  1J75 A;  2P5V A;  3DEU A;  5FFX A;  3KZY A;  3LA7 A;  4NHJ A;  3FZV A;  1IXR C;  2WTE A;  3IWF A;  3KET A;  2IT0 A;  1DP7 P;  1K79 A;  4ESB A;  3B02 A;  1R22 A;  3WTU C;  4CXF A;  2OZU A;  3Q9V A;  4M9S A;  1MJB A;  4NQW A;  2FNP A;  2V79 A;  1MD0 A;  2LKP A;  2FSW A;  2RDP A;  3HSR A;  1ZG3 A;  1G3Y A;  2E7X A;  3ROU A;  3HSF A;  4LFU A;  3ZMD A;  3NQO A;  2BE5 F;  2ZBK A;  1S6L A;  3R61 A;  3FHZ A;  3GFL A;  2K86 A;  3M7G A;  4IF4 A;  4KDP A;  4EGZ A;  1Z91 A;  2D1V A;  2AXL A;  3RJP A;  4LK0 F;  1KU2 A;  1S29 A;  1WWX A;  4L5J A;  1KYZ A;  1HSJ A;  1G4D A;  2BV6 A;  1LNW A;  3RKW A;  4O5V A;  1CF7 A;  4UV8 A;  2H6B A;  2EV0 A;  4ZZD A;  3LST A;  5DDG A;  3J80 K;  3KLO A;  4KIF A;  2CFX A;  3ECH A;  2L54 A;  1LDJ A;  1U78 A;  1GXP A;  1XDU A;  2HR3 A;  2O03 A;  3MFK A;  4WF2 A;  2VOP A;  5ICG A;  2F2E A;  1T38 A;  1KA8 A;  3F8N A;  2R7F A;  4LK1 F;  1IXS B;  1F1Z A;  3ZMS A;  3QP6 A;  2Q2E A;  4GCV A;  3DXJ F;  3GVA A;  1FP2 A;  2R3S A;  1ZLK A;  4P96 A;  4PZJ A;  2DQR A;  5K5R A;  2P5L C;  4MEY F;  4I2O A;  3WTY C;  3CUQ B;  2ZNY A;  1J7K A;  4AIJ A;  5HDN A;  2BEO A;  3J81 Z;  1ZAO A;  4QWQ A;  2JPB A;  4U88 A;  3FXR A;  4HA8 A;  2BBY A;  1ZGA A;  4KMF A;  4Q48 A;  4I01 A;  3TO7 A;  4IJA A;  2ESH A;  1LEA A;  1BN5 A;  5ILS A;  5EEG A;  5ILV A;  2KJC A;  1B59 A;  4I02 A;  4M9Z A;  5BS6 A;  2OD5 A;  4XRF A;  3HUG A;  4RB2 C;  2DTR A;  3IKV A;  2P7V B;  2XAH A;  2HEO A;  2OQG A;  2HGC A;  3IC7 A;  2O0Y A;  4AIH A;  4OIR F;  5HS8 A;  4I98 B;  1ONV A;  2V1U A;  3FMS A;  1SD5 A;  4HDV A;  2J5P A;  4B09 A;  3ABU A;  4M6Y A;  4WWC A;  2V6C A;  1FYK A;  1U5T B;  1IW7 F;  1CGP A;  3DPT A;  2XKP A;  3FMQ A;  1TW3 A;  2ZJ2 A;  3NEU A;  3LQQ A;  2CYY A;  1S7A A;  3FWE A;  1FLI A;  1UHM A;  3KFW X;  1O7F A;  2XAJ A;  1V4R A;  2KIU A;  2PG4 A;  2XIG A;  3D5L A;  3KP3 A;  4ESF A;  4L0Y B;  1BIA A;  3LFK A;  2FBK A;  1AWC A;  1XGO A;  2HTS A;  2XAG A;  3PQJ A;  4KA4 A;  2A61 A;  1QZZ A;  5H6R A;  5F6F A;  3BJO A;  2A69 F;  5DYM A;  3OOP A;  3I53 A;  3L00 A;  2L3D A;  3WTW C;  1YIO A;  1Z1D A;  3BY6 A;  4I7H A;  3CO7 C;  3KP4 A;  2IA2 A;  3K9T A;  4A6D A;  1IRG A;  3K0L A;  2PMH A;  5HDG A;  3BJA A;  5BPI A;  2HYG D;  5D5U B;  1FYM A;  4HF0 A;  5D4R A;  3TGN A;  1R00 A;  1P4W A;  3GFI A;  1GXQ A;  5D4S A;  2K02 A;  1YS7 A;  1YO5 C;  5J8F A;  5E1Z B;  3TKY A;  1ZRD A;  4Q47 A;  1BI2 A;  4AWX B;  2IA1 A;  1OYI A;  3E5Q A;  4HLX A;  5LEK A;  1DDN A;  2UXX A;  4BYY A;  4LMY A;  1KU9 A;  3J80 Z;  1LQ1 A;  4BAY A;  2P4W A;  5J8C A;  2ZO4 A;  3I4P A;  2Z33 A;  1B1B A;  1H0M A;  2Y75 A;  4FT8 A;  5E1X A;  4ETS A;  3I58 A;  4M74 A;  5L3G A;  3F23 A;  4DNC A;  3KEQ A;  5K5O A;  3ULQ B;  4G8X A;  2ZXJ A;  4BH9 A;  2CO5 A;  2MLK A;  3P9C A;  4D0P A;  3T8T A;  1SAX A;  2VC1 A;  1P4A A;  1XCV A;  4Q4Z F;  3GX4 X;  4MQ9 F;  5E20 A;  4LGW A;  3G3Z A;  2P8T A;  3IKT A;  3L09 A;  5EEH A;  1G6N A;  5LHH A;  4WXC A;  3U2R A;  4LLN A;  3BPX A;  1LJ9 A;  1B9N A;  3R0A A;  2PFB A;  2XAQ A;  5D6E A;  4BHP A;  2VC0 A;  2YSR A;  2GAU A;  4L18 B;  4HOB A;  2E1N A;  4EJU A;  3C1D A;  4KMU X;  2ESN A;  4Y13 A;  3KZZ A;  2CGP A;  3WTS C;  3LAP A;  1I1G A;  2HFH A;  3RYP A;  3DFG A;  4HV5 A;  3D0S A;  4F7Z A;  4EJT A;  1XD7 A;  3ISP A;  1ZN2 A;  2NYX A;  5D5W B;  1NHA A;  2STW A;  4HAM A;  4CO8 A;  5CJ9 A;  3L7W A;  3KP6 A;  2X0L A;  5DUI A;  3F6O A;  3BP8 A;  5D5X B;  1YYV A;  2C6Y A;  1Y0U A;  2KJB A;  2DLL A;  3WTV C;  2COM A;  2FML A;  4M73 A;  5BQT A;  5AIQ A;  1D3Y A;  5DCM B;  1RZ4 A;  3DF8 A;  1QNT A;  3I59 A;  4UNO A;  2EV5 A;  3MQ0 A;  2E7W A;  1J5Y A;  5K1Y A;  3LWF A;  5L3D A;  2V1X A;  3P7N A;  4QLC U;  2FA5 A;  1Z6T A;  4YFX F;  2D45 A;  2VBZ A;  3GF2 A;  2NS0 A;  2Z9O A;  1ZHF A;  4HBL A;  4GXO A;  1XGM A;  3DPL C;  2DQL A;  2HQN A;  4HDU A;  2WWY A;  1TQI A;  4A0Z A;  4HX8 A;  4LB6 B;  1HKQ A;  4HQE A;  2A3S A;  1H9G A;  4L9J A;  3ZMT A;  4ZYH A;  1G3W A;  3G73 A;  2XHK A;  4JQF A;  2QBY B;  3VEP A;  1BM9 A;  3ZMV A;  1FOK A;  5JFR A;  5D6F A;  4RAZ A;  4EM2 A;  2HKO A;  1R23 A;  1Z05 A;  1U5T C;  3QAH A;  4RAY A;  1Z7U A;  1LDD A;  2CQK A;  1P2F A;  4IPA A;  1LEB A;  3CJN A;  3J7A O;  3MZH A;  4EM1 A;  3RPU A;  1O3Q A;  1I6X A;  3J81 K;  3DP7 A;  3P9I A;  1REP C;  1PDN C;  3QPT A;  2OU2 A;  3HTU A;  3HRM A;  1TLH B;  4RGU A;  2IP2 A;  3EYI A;  2DFI A;  1D5V A;  2RVC A;  2M5W A;  4IRG A;  1HW2 A;  4PCQ A;  1BOA A;  1MGT A;  4MGR A;  3VB2 A;  2K4J A;  2FEZ A;  1FT9 A;  3C18 A;  5D8K B;  1YG2 A;  1ON1 A;  3GEZ A;  1KU3 A;  1T6S A;  2QQB A;  3U1D A;  5CVI A;  2VT3 A;  4EJW A;  2NNY A;  1UST A;  2A68 F;  2KIF A;  3BRO A;  2HWV A;  3CTA A;  1XMK A;  2QBY A;  2QYO A;  2RC4 A;  4ZYE A;  4Q5S F;  1UCR A;  3HRT A;  4YFN F;  5F1R A;  3KP2 A;  1PUE E;  1XMA A;  2DO7 A;  2MBF A;  3GFJ A;  2HYF A;  4HLY A;  1TNT A;  1YW7 A;  1CF7 B;  2OA4 A;  4PGG A;  3HOT A;  2EA4 A;  1W5S A;  4BHB A;  1EH7 A;  1F9N A;  2DW4 A;  3R60 A;  5BOX A;  2GXB A;  2HDC A;  2J5O A;  1U3E M;  5BPD A;  2D1H A;  5FD6 A;  1HW1 A;  4YFK F;  4WCG A;  2O3F A;  2VBY A;  2PBI A;  3VFZ A;  3FX3 A;  4ZYD A;  3IRQ A;  4UVA A;  2MH2 A;  2L01 A;  3E97 A;  3WE3 A;  2F5F A;  1W7P D;  1USS A;  1HW5 A;  2GIV A;  1IF1 A;  4A0X A;  1Z9C A;  3CUQ A;  1T2K A;  1T0F A;  3COA C;  1YW9 A;  3WOD F;  3T8R A;  3K1N A;  5A2Q K;  1YFH A;  2IA0 A;  3F21 A;  1JGS A;  1ZRE A;  2XV4 S;  1FWZ A;  1RUO A;  3TDZ C;  3TDU C;  4ENN A;  2HS5 A;  1ZRF A;  2XRO A;  1XB4 A;  2VBW A;  3CO6 C;  5FGM A;  3ZPL A;  3F8F A;  1V3F A;  3W6K B;  2W85 A;  5CVJ A;  1BIB A;  3I71 A;  4KIC A;  2QUF A;  3F8B A;  3OV8 A;  2YX7 A;  4KIG A;  3QU6 A;  4ASN A;  2TDX A;  3IHU A;  1E17 A;  1YS6 A;  2KIM A;  5L3E A;  1IN5 A;  2G7U A;  2VOD A;  2P6S A;  4TV7 A;  3HIF A;  3RKX A;  5HLG A;  4M72 A;  4UUV A;  4JK1 X;  3EQL F;  1EH8 A;  1U2W A;  1MJA A;  4A5M A;  1OPC A;  5JR3 A;  2QLZ A;  5ILU A;  2XGX A;  5FB2 A;  3N4M A;  2FE3 A;  2M1B A;  3C3W A;  3H3U A;  4OMY A;  1MDM A;  1T39 A;  1I27 A;  1UHW A;  4H0E A;  4HX7 A;  1S7O A;  3F8M A;  3GLX A;  1ZG5 A;  2L02 A;  2F5C A;  3BDD A;  4MQV A;  1BI0 A;  3K1M A;  5K5Q A;  4KN7 X;  4HF2 A;  5CLS A;  1OR7 A;  4R1H A;  3CUO A;  3F22 A;  2MLG A;  1WSU A;  2Z99 A;  2ZME B;  3TO6 A;  3V7S A;  2PN6 A;  1EH6 A;  1T98 A;  3V8L A;  1LDK B;  3W6J B;  4KIB A;  3KP5 A;  3RDI A;  1WQ2 A;  1KGS A;  4P55 A;  3FF5 A;  1F4K A;  2A07 F;  1ZGJ A;  4OIP F;  1SFU A;  1R58 A;  4L9T A;  5AON A;  4MTE A;  1KU7 A;  2QQA A;  5J6X A;  1FC3 A;  4BXU A;  1R1V A;  2KRF A;  2V9V A;  2K27 A;  4EJV A;  2EK5 A;  5LGU A;  2K4B A;  1YW8 A;  5LGT A;  5HS9 A;  3F8C A;  3R6S A;  5TRD A;  2IVM A;  1R1U A;  5DUK A;  2DPD A;  2O61 A;  2VON A;  3RTR A;  4A12 A;  3SXY A;  4RGS A;  3BOQ A;  4AIK A;  4A2U A;  4IHS A;  1BBY A;  2DK5 A;  1WRJ A;  4KFC A;  1W7P A;  3RIR A;  1FBQ A;  5DCF A;  4KN4 X;  2Q8K A;  5ICF A;  1DPR A;  5ICC A;  4KT5 C;  3SFZ A;  5HDK A;  1O3R A;  1U6G A;  1QPM A;  2IW5 A;  1IN7 A;  2L4M A;  3O2P E;  1TQP A;  3ZQ7 A;  4BQA A;  1O3T A;  4P5O A;  1I5Z A;  4G9Y A;  4HF1 A;  3LA2 A;  3MZY A;  2LF7 A;  2YPR A;  2ZKZ A;  1FP1 D;  1FSH A;  3GO5 A;  2ZCW A;  2H09 A;  3V7R A;  1TBX A;  1YLF A;  1R5G A;  3FMR A;  3JAM K;  3ERE D;  1G3S A;  2M8E A;  3WTX C;  2G9W A;  1W4M A;  4AVP A;  2MA3 A;  5BMZ A; 
#chains in the Genus database with same CATH topology
 3QYF A;  4BJT A;  1X1D A;  2R7D A;  2HPI A;  3ASO H;  3K1P A;  2DFE A;  1W5T A;  4ZZL A;  2JQ7 A;  2OCE A;  3LSI A;  4GYI A;  3B73 A;  2GZW A;  4BUP A;  2LG4 A;  2OUM A;  3GZ5 A;  3ECO A;  2DDB A;  3DBL B;  4FX0 A;  4PUS A;  2VQL A;  3JSP A;  1IUY A;  4PSX A;  4BGD A;  3ZR8 X;  4R8H A;  1STZ A;  2GQQ A;  2PEX A;  4M3G A;  2JPC A;  1L0O C;  1OYW A;  2VQG A;  1WKM A;  3NRV A;  3SQN A;  3M1E A;  1I50 J;  1HA8 A;  1IUF A;  2GA2 A;  5LGN A;  3WGH A;  1XDS A;  1OCC H;  1C0W A;  5FKM A;  3GTJ J;  1P6R A;  3IH4 A;  2K9Q A;  2XAF A;  4PFO A;  1HST A;  3K2A A;  2EIN H;  2LFB A;  3G4S I;  1MSF C;  2ELJ A;  3M3Y J;  4E7K A;  2XGE A;  1JI8 A;  4B3A A;  3IAM 2;  2GIZ A;  3IV5 A;  1KQ8 A;  1YOV B;  4FET A;  1TNS A;  2DU9 A;  1D0Z A;  2GOM A;  3R4K A;  2OJE D;  4FE7 A;  4R79 A;  2DK8 A;  4UXN A;  2EFW A;  4CA0 A;  4FAS D;  5CYV A;  3PSI A;  4MNU A;  2F5E A;  3BJ6 A;  4XSZ F;  5TJJ A;  4BDZ A;  1E2X A;  2MH9 A;  2EFN A;  4YII A;  2XKO A;  4CIC A;  2L7M P;  3EUH A;  1J0R A;  2FBI A;  4E7Z A;  1R5H A;  2UZK A;  5LBQ A;  3ML6 A;  2DMT A;  4DZP A;  2JMW A;  2CS3 A;  3OS1 A;  2KZG A;  2E1O A;  2W4S A;  2M30 A;  2X6X A;  4A6E A;  1ZG1 A;  2V26 A;  2ZME A;  2VJJ A;  1WGX A;  3FIS A;  3AAF A;  1FZP B;  2ECC A;  4BE0 A;  1S72 I;  1MSE C;  2A6H F;  2FNA A;  2JTV A;  1JKP C;  4L0Z B;  5K7F A;  5EGO A;  4BY1 J;  4U0V A;  2NRA C;  4ZTJ A;  1T33 A;  1X2N A;  2VAS A;  3JW4 A;  4F92 B;  3KP7 A;  1BA5 A;  1MMG A;  4GRI A;  3H92 A;  1XMX A;  3DEE A;  1TQM A;  1JHF A;  2OBP A;  2ZFW A;  2FF4 A;  3H3Z A;  1MBE A;  1IDZ A;  4H4K C;  2V9P A;  3H9G A;  1R6R A;  2XB5 A;  2MD5 A;  1IN4 A;  2I8D A;  5DV5 A;  1YHQ I;  3E5U A;  4G12 A;  4LG0 A;  3M8F A;  3T5X A;  2QEN A;  4NC7 A;  4OIN F;  4IHT A;  3U21 A;  5EDN A;  1FPQ A;  1RIO H;  4BU2 A;  3WTT C;  2R7S A;  3C2H A;  3SZP A;  1WJ5 A;  3AKZ A;  1JKR C;  3GTG J;  1XGN A;  1P92 A;  2HQR A;  2ADU A;  2EWN A;  3ZQQ A;  3IRR A;  5LEJ A;  1ZTR A;  1A36 A;  4Y17 A;  2Y69 H;  3OOU A;  3KEO A;  3KE2 A;  1YTY A;  4WK8 F;  3RQI A;  4K2E A;  4UVC A;  2A5Y B;  3CC2 I;  4A3M J;  5EYR A;  3HB9 A;  2DJN A;  3RYR A;  1RR7 A;  2LD5 A;  3K2Z A;  3HOS A;  1QPI A;  1Z0X A;  4BJ6 C;  2JRT A;  1P7J A;  3SEQ A;  2HOT A;  3C2B A;  1O7L A;  5LLQ A;  3VOD A;  5LRS A;  1XGS A;  1NG7 A;  4HNV A;  3M9A A;  3UNG C;  4AU7 A;  3I0T A;  1GUU A;  4YG2 F;  2P0W A;  3G1M A;  1BR2 A;  2BXZ A;  4U7B A;  1SMY F;  3E6C C;  5M5X J;  3LSR A;  4FTH A;  3RI4 A;  2V1D A;  5JLX A;  1FOY A;  3A2K A;  4UVB A;  5FKL A;  3TQN A;  2M0M A;  3F72 A;  3S3M A;  5KVR A;  1XSX A;  2QQ9 A;  3OL3 A;  1MBJ A;  3ZN1 A;  4PJN A;  4BKX A;  4N9I A;  2KHM A;  3MWM A;  2YU3 A;  3OYD A;  4YIF A;  2JUG A;  2XRL A;  1GHC A;  3ELK A;  4XL9 A;  2CW8 A;  2JWT A;  2WY7 Q;  5LHG A;  2H27 A;  1J9I A;  1MNM C;  2NVY J;  3KX2 A;  5KAI C;  2LF8 A;  1RUN A;  1GVJ A;  2DAO A;  3JRI A;  1QVT A;  3D1N I;  1WJE A;  1B9M A;  3FDY A;  5C3E J;  2RN7 A;  2OAZ A;  1MH3 A;  3I54 A;  1ON2 A;  2LMD A;  3A0H C;  3MAJ A;  4G94 A;  4BS9 A;  1GVD A;  2OPT A;  1SD7 A;  2ACJ A;  1K78 B;  4CDG A;  4MHG A;  2NOG A;  2VOO A;  1R36 A;  3REO A;  5DD4 A;  3R0J A;  3QPL A;  1T56 A;  2H6C A;  2VXD A;  5FKO A;  1FIP A;  2FRH A;  3OYG A;  1X19 A;  4OOI A;  2BGC A;  2L5Q A;  5A2Q Z;  2E35 A;  3CCY A;  2EFP A;  3BZ6 A;  4I0B A;  4EAT A;  2FOK A;  2IJL A;  2OCC H;  1A5J A;  1RR8 C;  2L9V A;  1IRX A;  2BVM A;  3EET A;  2L4A A;  1QHG A;  2VXZ A;  1K6O A;  3I5U A;  2PMZ A;  4MIM A;  3HHH A;  1TL8 A;  1RES A;  3A4C A;  1RNL A;  3CP8 A;  4XON A;  4CZZ A;  5C4J J;  1Y1W J;  1F43 A;  2AXT C;  1HKS A;  4NDL A;  3BCB A;  2UV1 A;  2W24 A;  2KDZ A;  2IS4 A;  2VLA A;  4HQM A;  2V1N A;  2RAE A;  2UWM A;  1NG6 A;  1SFE A;  1NTC A;  2X48 A;  3W2V A;  5ERI A;  4BE2 A;  1SEU A;  4V19 K;  1B72 A;  3FXQ A;  1KQ9 A;  2GM4 A;  2EV6 A;  1WH7 A;  2KQR A;  1JTX A;  3PSF A;  1VQ5 I;  1SD4 A;  2HKX A;  3DTK A;  2VQH A;  4L9V A;  4W97 A;  1SAU A;  4IHX A;  4M3B A;  4L9N A;  3IH2 A;  3OMY A;  1TT5 B;  2ZXW H;  1U8R A;  4L5E A;  4A3G J;  1H8A C;  5DD8 A;  5HLI A;  2ZB9 A;  4RGX A;  4ON0 A;  5K7H A;  5EG0 A;  1BC8 C;  1TWA J;  3JTG A;  1HXD A;  1YIJ I;  4J00 A;  1SMT A;  5GTH C;  4P9U A;  2NVU B;  1MBF A;  3M1C A;  1XN7 A;  1TTY A;  3QQA A;  3CMA I;  3FM5 A;  5HOD A;  2OTJ I;  2ZNZ A;  2NVQ J;  1Q1H A;  3B6C A;  4XLN F;  2EJR A;  1ZR4 A;  4ANJ A;  2RV8 A;  2EIK H;  2HDW A;  2ZC2 A;  4D5C A;  1X3Z B;  1IZ1 A;  1U5T A;  2E2H J;  4WXD A;  2XAS A;  3MCZ A;  4S05 A;  2LBF B;  2JSP A;  2LOO A;  1B4A A;  1Y6I A;  4LD5 A;  4XKV A;  1I1S A;  2L2O A;  2L7K A;  2DFF A;  2WA0 A;  4RLF A;  2YU9 J;  4DBQ A;  4G7Z F;  2W84 A;  5GP9 A;  2JN6 A;  3JTH A;  3FM3 A;  1RI7 A;  5E8G A;  1MNE A;  3PFY A;  1S9H A;  3JRE A;  4V2G A;  2QKM B;  1KYW A;  3V42 A;  1FSE A;  1DGR M;  1JKO C;  2P5K A;  3MVP A;  1FYL A;  1W7P B;  2BHY A;  3MKZ A;  2BZT A;  3H5N A;  3JAM Z;  4G7H F;  3H0G J;  1MKM A;  1SFK A;  3K4J A;  1LVA A;  2HOE A;  3IH3 A;  3G1L A;  2M3A A;  1WJA A;  4AYB A;  2RRE A;  3CF5 F;  4IX7 A;  3HUG B;  3ERM A;  1QZY A;  2MGQ A;  2IPQ X;  1QA6 A;  1X3W B;  2KKO A;  2K7L A;  5E18 F;  4A0Y A;  2O8K A;  4FHT A;  3WU0 A;  5DM7 F;  4N0B A;  3O3K A;  1DU6 A;  1QO0 D;  3RKY A;  3Q0U A;  3E6B A;  4LLL A;  3GXO A;  4U7D A;  3GUD A;  3SZT A;  5CVU A;  2G7H A;  3F9K A;  1IRF A;  4HV6 A;  3HRU A;  5IT3 A;  2W7N A;  4PGH A;  3F3X A;  3PQK A;  4C9Y A;  5GAD J;  1G3T A;  2A6E F;  3ZN0 A;  2V4J C;  3VYU B;  3HM5 A;  4BDY A;  2FBH A;  4OAZ A;  3EDP A;  3CP2 A;  3ZQL A;  4M6X A;  3CCM I;  3WU1 B;  2PMU A;  4EGY A;  1R7J A;  2FQ3 A;  2YX4 A;  3TOA A;  2HOS A;  2F5V A;  2JK3 A;  2H94 A;  1J59 A;  3O6B B;  2B9S A;  1SVM A;  2R5Z B;  2JT1 A;  5FLX K;  5FO5 A;  3J7A Y;  3TO9 A;  3GZ6 A;  1JUM A;  1JE8 A;  4O3M A;  4RGR A;  2ZFU A;  2M45 A;  4BEH B;  4B47 A;  4X0G A;  2CV2 A;  4N9H A;  4EMS A;  1S8N A;  2EB7 A;  4A69 C;  1W0T A;  1JTY A;  3AL0 C;  2PI0 A;  3RZD J;  2NAZ A;  3TW6 A;  4ENJ A;  2QSF X;  4RB0 A;  1LB2 A;  2STT A;  1YE9 A;  3HRS A;  3BWG A;  3CDH A;  4G6Q A;  2O6G E;  4Y15 A;  4X6A J;  3C7J A;  1ETQ A;  3CLO A;  4HZF A;  4CYC A;  4LJZ F;  1DPU A;  3SHF A;  4WX9 A;  4EM0 B;  1LE8 B;  1X58 A;  1OYY A;  1SVO A;  2WV0 A;  1Y39 A;  5F64 A;  2R7R A;  5FD5 A;  3V7C A;  2YR2 A;  3Q5F A;  3CZ6 A;  4XLH A;  3E6M A;  3RSN A;  3HYI A;  4ITV A;  1JUS A;  4UV9 A;  1MJ9 A;  4CZC A;  2Y30 A;  5E3N A;  3S2H J;  1VQ9 I;  3H9Q A;  1EJ9 A;  1TWG J;  1VQ8 I;  3OYM A;  1WCM J;  1OKR A;  4QSH A;  4RS8 A;  2Z5U A;  1AOY A;  3CF2 A;  4O6J A;  3I59 B;  1OCR H;  2VT2 A;  1QQI A;  2ETH A;  5M3M J;  3G6E I;  4U0Y A;  3PO2 J;  4HNT A;  3A0B C;  3O8G A;  3QP5 A;  4XMY A;  1V5G A;  2Z3Y A;  5HVQ C;  4XSX F;  4A3C J;  3VSK A;  4GGG A;  1FBS A;  3QOP A;  1ZRC A;  3FXU A;  3E6D A;  3Q0W A;  3CCR I;  1IGN A;  1RPW A;  2QZ8 A;  2W57 A;  4OIO F;  1L3L A;  4Y4R A;  3QRF F;  3MEX A;  2WC2 A;  2VQC A;  3HHG A;  2EZI A;  1N25 A;  5H20 A;  2ZJQ F;  1R1T A;  1MDM B;  4MO7 A;  1EA3 A;  3ZXS A;  2LDU A;  4B8X A;  3K4N A;  1BC7 C;  4U87 A;  4KT6 A;  4OWR B;  3QU3 A;  4DGW B;  2G0E A;  1U9N A;  3KCC A;  4UUS A;  1LE8 A;  1B72 B;  4NB5 A;  1J2X A;  1P7I A;  1XCB A;  2KL4 A;  2W25 A;  3WTZ A;  1FNN A;  5IP7 J;  3PIP F;  5AIP A;  1IJW C;  4FX4 A;  3WE2 A;  3LSM A;  1IC8 A;  1HLV A;  2E1C A;  1UB9 A;  1B6A A;  1F5T A;  2WAF A;  3DKW A;  4C2T A;  2JSC A;  3QYB A;  1WJF A;  3CQZ J;  3ZQC A;  1YJW I;  3I55 I;  1ZQ3 P;  4D5F A;  5HS7 A;  4MTD A;  6PAX A;  2DT5 A;  4XRS A;  4QIW N;  2ISY A;  4HPQ A;  1WI9 A;  3ZP5 A;  1IN8 A;  5JVT A;  3LA3 A;  1O57 A;  2QSH X;  2LR8 A;  4AVZ A;  4LB5 A;  5LRR A;  5L3F A;  5B1A H;  4IVN A;  3S15 J;  2Y2Z A;  1X1A A;  4U0W A;  1JXS A;  2M9H A;  2MG4 A;  2IRF G;  5JHF A;  1TP4 A;  4KNY A;  3L9F A;  3S16 J;  3GW2 A;  3NAR A;  2CG4 A;  2D2W A;  3OS2 A;  4DYR A;  3BTL A;  2CQX A;  4Y33 A;  5HLH A;  1IN6 A;  3LFU A;  4ZJZ A;  2MC4 A;  1SFX A;  3S2W A;  3CLQ A;  2IGM A;  4IXA A;  4RB1 A;  4AM3 A;  3KLN A;  4ENM A;  4JBA A;  1AHD P;  1UMQ A;  3BR6 A;  2E5Z A;  5DM6 F;  3TOB A;  2QQ8 A;  4ZH4 F;  5FRN A;  4BHC A;  3IL2 A;  4IHY A;  2AQE A;  1SD6 A;  1Y8R B;  2FJ1 A;  2EFQ A;  4C3J J;  1BR4 A;  1XS9 A;  1GLN A;  5D8L B;  5EZH A;  3OY9 A;  2VBX A;  1YX3 A;  1HKT A;  3KIO A;  5JI6 A;  4EVI A;  2Y0S N;  5CQG A;  4XQF A;  2LKX A;  1K7A A;  2P7C B;  1H9T A;  1D0X A;  4EV0 A;  5L3C A;  1IRZ A;  1SC7 A;  3OYL A;  1WJB A;  3CUQ C;  4RM3 A;  1YQA A;  3QPH A;  3CMY A;  3TP0 A;  3V4G A;  5HNF A;  4F52 A;  4MLO A;  1QGP A;  5GAG J;  3FHN A;  2ISZ A;  1HQC A;  2RQP A;  4CYD A;  4IQJ A;  3DQV C;  2M8G X;  4YRV A;  1X2M A;  2JVG A;  3AG4 H;  3FXL A;  3T1B A;  5E17 F;  5FJ8 J;  1ZGW A;  4HG2 A;  3DV8 A;  2DA1 A;  2DA5 A;  3PFI A;  2CU7 A;  1ACI A;  4E70 A;  1E0E A;  3HPG A;  1VQ4 I;  4KUM A;  4CCL A;  2DOF A;  4F93 B;  1YJ9 I;  2FX0 A;  1MZB A;  2VKE A;  2EFO A;  1X3U A;  3GME A;  3K69 A;  2I10 A;  1PUF B;  1ZLJ A;  2DI3 A;  3OYH A;  5E8I A;  4QPO A;  1Z7L A;  3BPV A;  4RB3 C;  3HOX J;  4CGZ A;  2GWR A;  3BG3 A;  3GTL J;  1O3S A;  1FY7 A;  3VYS B;  2MC3 A;  1U0J A;  2WY8 Q;  3BR1 A;  2CQQ A;  4OU0 A;  2M87 A;  1D1C A;  2B0L A;  1TW2 A;  2FMY A;  2GA1 A;  2CW0 F;  4CYC B;  2NS8 A;  3S3O A;  2QWW A;  5DCM A;  2JVH A;  3DTI A;  5CVV A;  2VE8 A;  5JVG F;  1R71 A;  2DXI A;  2X6W A;  4M71 A;  5F27 A;  2DA7 A;  4XRS G;  5IPA A;  4HYE A;  2K9S A;  2CWE A;  4AC0 A;  2E19 A;  4EQQ A;  4KYW A;  2Z1D A;  3AFH A;  4XNF A;  1IXC A;  3JRF A;  4G6D A;  1Z6R A;  2OZ6 A;  1MMS A;  1XG1 A;  3IUO A;  4XLP F;  3EYY A;  4AD9 A;  2EA2 A;  3I3L A;  3PUB A;  3BLY A;  1KQ0 A;  2LY9 A;  5E1W A;  3V8K A;  2HZT A;  3OYE A;  1QU3 A;  2KFD A;  5CVR A;  3I64 A;  2R92 J;  1ZH5 A;  4UUS B;  4M9X A;  5EG0 B;  2XRN A;  5GPA A;  1D8K A;  2RKH A;  3U9G A;  5LHI A;  3FKI J;  1WHU A;  4MEX F;  2OC6 A;  5KK1 A;  1T08 B;  4ESJ A;  3LSK A;  1QRY A;  3CCS I;  1TZL A;  3S14 J;  1ODD A;  1V54 H;  4UB8 C;  2P6T A;  3IWZ A;  3I4N J;  1UG2 A;  4Y52 J;  2GXG A;  3DKX A;  3Q9S A;  4ZDL A;  4PDK A;  2VE9 A;  4LLG F;  4I09 A;  3GFM A;  2RNG A;  2V9K A;  4XM3 A;  3VYR B;  3N05 A;  4I0A A;  4EJO A;  1DUX C;  2EIM H;  1W5C C;  3LAJ A;  3BTI A;  1X1P A;  2LNB A;  1A04 A;  1LFB A;  3RPQ A;  4S04 A;  1ZAR A;  4CH7 A;  4B44 A;  1P4X A;  1V5E A;  1XSD A;  3GYH X;  4HX4 A;  4Z6Y A;  2K9N A;  2GOX B;  4L5I A;  3S1R J;  3H5R A;  2HYJ A;  1D0Y A;  1JHH A;  1VTN C;  1K78 A;  1BW5 A;  1OCO H;  3ASN H;  5FFZ A;  2XVC A;  5JHU A;  1ENH A;  2O5R A;  2AS5 F;  3HOW J;  3HTS B;  1R5I D;  5FLX Z;  2Y31 A;  4FQG A;  2Y48 A;  1SAN A;  2VN2 A;  3A01 A;  1VQM I;  1UFM A;  2DMU A;  3OL4 A;  4BXF A;  1BJA A;  2DT6 A;  3X2Q H;  1UJ8 A;  2O8X A;  4IRI A;  2QM3 A;  1HBX G;  1UEL B;  1S3J A;  2JZY A;  4G6T B;  3M8E A;  3L2C A;  3L2W A;  3ABT A;  2LRE A;  4XBF A;  4CCJ A;  4FCY A;  4DBR A;  5HOO A;  5ED4 A;  4F3Q A;  4XOP A;  3RZO J;  3LQR A;  2JA8 J;  4CHU A;  2FD5 A;  1QBJ A;  2LSO A;  2PX9 A;  3L2V A;  2LLK A;  2PJP A;  2FU4 A;  2BOL A;  3PIO F;  2L9R A;  1D8J A;  3HGG A;  1PP8 F;  1BI3 A;  1D1B A;  1OMI A;  2DN0 A;  3FKJ A;  5L3B A;  3HSE A;  1TWH J;  3T0Y A;  2RGV A;  2NNN A;  5E3M A;  2VL8 A;  2LY1 A;  3SYT A;  4HW0 A;  2W82 A;  1OIS A;  1XSV A;  5D5V B;  1TT0 A;  2M0C A;  3ZMZ A;  4GFB A;  2M7B A;  2UXN A;  4IRH A;  4P9F A;  4LG0 B;  3O8H A;  3HEF A;  2BYV E;  4BXX J;  4XKC A;  1UHS A;  2UUZ A;  4GO1 A;  1PP7 U;  4OIQ F;  1VFC A;  2FXA A;  3VOE A;  3ZMU A;  3GWZ A;  5ICE A;  2WBM A;  1IAW A;  1A6I A;  2E2I J;  1FBU A;  2Q0O A;  1BI1 A;  4E4H A;  1FX7 A;  3E5X A;  2QVO A;  4DIQ A;  4ZYG A;  3N97 A;  4P1W A;  5GTI C;  4UHT A;  4UUT A;  2PQ8 A;  5IT9 K;  3WG9 A;  3ZGK A;  1Y56 A;  2EBI A;  1EV7 A;  2IS6 A;  2XUB A;  4LG3 A;  2OQR A;  3WGG A;  1ZK8 A;  5M5Y J;  3S1Q J;  4BNC A;  3PJR A;  2HPM A;  4G7O F;  2RNJ A;  2X4H A;  2Y0M A;  3AG2 H;  4M3E A;  2M34 A;  4A5N A;  1UAA A;  4BBR J;  2EZL A;  5DEQ A;  2PLY A;  1MMD A;  3WGI A;  3P9K A;  4DYC A;  4DQ2 A;  4BQN A;  2HTJ A;  3H0D A;  1FOW A;  4DW6 A;  3V8J A;  1ZYR F;  3K7A J;  5LD2 C;  3JRA A;  3F6V A;  1AU7 A;  3A02 A;  5IP6 A;  1VQ7 I;  5IT9 Z;  2DPU A;  4GYG A;  2KIS A;  2N8G A;  4ENK A;  5FLV A;  2F5D A;  4WXH A;  2HI3 A;  4OMZ A;  2CRG A;  3JSO A;  1Y8Q B;  2M4K A;  3ABK H;  2D5V A;  3ABM H;  1ULY A;  3FXM A;  2DBB A;  5H6Q A;  2CSO A;  3E3V A;  5E3O A;  2ID6 A;  1A31 A;  4IZZ A;  3J7Z I;  1WFX A;  3VSL A;  1DP3 A;  1F36 A;  5FRO A;  4AUX A;  2ELH A;  4Z2Y A;  1LVK A;  2BY2 A;  1J75 A;  4PJJ A;  2P5V A;  3DKY A;  1UZC A;  5FKK A;  1XC5 A;  3DEU A;  2IBD A;  3BTJ A;  5FFX A;  3KZY A;  3LA7 A;  4NHJ A;  3PO3 J;  1KON A;  1IXR C;  3FZV A;  2WTE A;  1N78 A;  1IV8 A;  2K85 A;  3IWF A;  5E3L A;  2IEK A;  4JX4 A;  1FMW A;  4ZDP A;  3KET A;  3G1O A;  2IT0 A;  1DP7 P;  1Y0N A;  2KDO A;  2VPL A;  2JJ7 A;  1K79 A;  4ESB A;  3B02 A;  2CMP A;  1R22 A;  3BG7 A;  2H8R A;  4PK4 A;  3WTU C;  3E0J B;  4CXF A;  2VIX A;  2OZU A;  3Q9V A;  4M9S A;  4C3H J;  1YRN B;  1MJB A;  3BTC A;  4NQW A;  2FNP A;  2ID3 A;  2V79 A;  1MD0 A;  3MN2 A;  3CJR B;  2LKP A;  2FSW A;  2RDP A;  3HSR A;  3AG1 H;  3HPH A;  4JX6 A;  1ZG3 A;  1G3Y A;  3QYE A;  2E7X A;  4Y7N J;  3ROU A;  4DYQ A;  4D1Q A;  2VKD A;  3HSF A;  1VQK I;  4LFU A;  3ZMD A;  1HDP A;  3FK7 A;  2BE5 F;  3GLL A;  2VB6 A;  1E3P A;  3NQO A;  2ZBK A;  1S6L A;  4EEF G;  1G59 A;  3R61 A;  3FHZ A;  3GFL A;  5M3F J;  2AQF A;  3JRH A;  2K86 A;  3M7G A;  4IF4 A;  4KDP A;  4EGZ A;  3JR9 A;  3BR3 A;  2L9N A;  3KYD B;  1Z91 A;  4LIU A;  1B8I B;  2D1V A;  2ICW G;  2DOA A;  2AXL A;  3RJP A;  2BY1 A;  3BR5 A;  4LK0 F;  1KU2 A;  4IL6 C;  1S29 A;  1WWX A;  4HST A;  4L5J A;  1KYZ A;  1HSJ A;  3BG6 A;  5B66 C;  3I9V 2;  1G4D A;  2QEX I;  2BV6 A;  2JA7 J;  1LNW A;  5GAH J;  3RKW A;  4O5V A;  1CF7 A;  1IDY A;  4UV8 A;  2H6B A;  2EV0 A;  3J7Y J;  4HEA 2;  1YIT I;  3BQY A;  4ZZD A;  3LST A;  5DDG A;  3GBG A;  5IOY A;  3J80 K;  2HOA A;  3CJT B;  2E2J J;  2VUM J;  3KLO A;  4KIF A;  2CFX A;  3CDL A;  1K61 A;  3ECH A;  3L1P A;  2Z16 A;  5J1R A;  3PUF A;  1WH5 A;  5J40 A;  1O4X A;  5B5E C;  1T95 A;  2KPM A;  4BQO A;  2Y9Z A;  2L54 A;  1LDJ A;  2IAI A;  4ZTF A;  5C4X J;  1U78 A;  1GXP A;  1XDU A;  3OYF A;  2HR3 A;  2O03 A;  1ETW A;  3S3N A;  2DA6 A;  4PJ0 C;  4PFP A;  4WF2 A;  3MFK A;  2VOP A;  3A01 B;  1B8I A;  5ICG A;  2KLO A;  3OYJ A;  2F2E A;  1KA8 A;  1T38 A;  3F8N A;  2F6C A;  2R7F A;  1VQN I;  4LK1 F;  5F0F A;  1IXS B;  2XF6 A;  1NK2 P;  2OF7 A;  1F1Z A;  3ZMS A;  3QP6 A;  2Q2E A;  4F55 A;  4GCV A;  3DXJ F;  3GVA A;  1FP2 A;  2BW3 A;  2R3S A;  3PL8 A;  4NNJ A;  4LIV A;  1ZLK A;  2DMN A;  4P96 A;  4PZJ A;  2DQR A;  3H35 A;  5K5R A;  2P5L C;  1NK3 P;  3HXL A;  1J09 A;  4MEY F;  1VQ6 I;  4I2O A;  1X1B A;  3WTY C;  1JJ6 C;  2EIJ H;  1S5L C;  4KIS A;  3CUQ B;  2ZNY A;  1J7K A;  5EEA A;  1DQU A;  3K10 A;  4AIJ A;  2MSY A;  3DLL F;  3A03 A;  5HDN A;  2BEO A;  5F1J A;  3J81 Z;  2DMP A;  1ZAO A;  4QWQ A;  3VYT B;  1TC3 C;  2JPB A;  4U88 A;  2OV7 A;  3FXR A;  4HA8 A;  2BBY A;  4LIT A;  4IQ4 A;  1ZGA A;  3LMM A;  3HOV J;  4KMF A;  4Q48 A;  4I01 A;  1VQP I;  2KT0 A;  3TO7 A;  4E7J A;  4DOZ A;  1W36 D;  3OYI A;  4IJA A;  2ESH A;  1LEA A;  1BN5 A;  5BNG A;  4D9J A;  4C2U A;  5ILS A;  5EEG A;  5ILV A;  2CQN A;  4IO9 F;  2Q2E B;  1FJL A;  2KJC A;  2BY0 A;  2TCT A;  3BR2 A;  3I56 I;  1B59 A;  4I02 A;  3FBI B;  4M9Z A;  5BS6 A;  2OD5 A;  1I3Q J;  2LVS A;  3WU2 C;  4XRF A;  1FTZ A;  2JUC A;  3HUG A;  4RB2 C;  2DTR A;  3IKV A;  3OYN A;  2P7V B;  2XAH A;  2DYR H;  2HEO A;  2PMZ N;  1DGW Y;  2OQG A;  5TGT A;  4PSW A;  2HGC A;  3IC7 A;  2H1K A;  2O0Y A;  1IV6 A;  1PYV A;  3K4C A;  5IYD J;  4AIH A;  2EZK A;  1JT0 A;  3QWL A;  2L7Z A;  4OIR F;  5HS8 A;  4I98 B;  1ONV A;  2V1U A;  3FMS A;  1SD5 A;  4HDV A;  4UB6 C;  2J5P A;  2FQ4 A;  4B09 A;  3ABU A;  2WAQ N;  2GLO A;  4M6Y A;  4WWC A;  4JX5 A;  2V6C A;  1FYK A;  1U5T B;  1IW7 F;  1ETV A;  2CW7 A;  1CGP A;  3DPT A;  4ZYA A;  2XKP A;  3FMQ A;  1X1C A;  3NAU A;  2ZJP F;  1TW3 A;  2ZJ2 A;  1ITY A;  3NEU A;  2LTP A;  3LQQ A;  2CYY A;  4IOC F;  1S7A A;  4V2F A;  3FWE A;  1FLI A;  1UHM A;  4CCM A;  1LUJ B;  2R7U A;  1EKE A;  1K83 J;  1FOX A;  4ZDO A;  3KFW X;  1O7F A;  2XAJ A;  5F04 A;  1V4R A;  2NVT J;  2KIU A;  1POG A;  2PG4 A;  2XIG A;  3D5L A;  3KP3 A;  4ESF A;  2HNH A;  4L0Y B;  1BIA A;  3CCV I;  3DU5 A;  1Z67 A;  2QA4 I;  1G2H A;  3LFK A;  2ZJR F;  2LYC A;  3MZ8 A;  2FBK A;  1AWC A;  1XGO A;  2HTS A;  2Y9Y A;  2XAG A;  3PQJ A;  2R5Y B;  3HL2 A;  2CH0 A;  4KA4 A;  1MMA A;  3ZQH A;  3OYK A;  2ZXI A;  2A61 A;  2R93 J;  4QPQ A;  2BY3 A;  5CPR B;  4BAC A;  3DLA A;  1QZZ A;  2QF7 A;  3LSJ A;  3OS0 A;  5H6R A;  4XID A;  2RQQ A;  3BG9 A;  5F6F A;  3BJO A;  2A69 F;  2ZXH A;  5DYM A;  2XB0 X;  5KHD A;  3OOP A;  4HNU A;  4XLE A;  3HOZ J;  3I53 A;  2KZV A;  2XPW A;  3L00 A;  1RRJ A;  4A3F J;  2L3D A;  3WTW C;  1YIO A;  1Z1D A;  3BY6 A;  4I7H A;  3CO7 C;  4NC8 A;  2WAE A;  2CUF A;  3KP4 A;  3DPU A;  2IA2 A;  3K9T A;  2KRH A;  3UR3 C;  4XKW A;  1MBH A;  1BW6 A;  1MND A;  4IEJ A;  2HQ5 A;  3KPH A;  1R49 A;  2R7Z J;  4A6D A;  3LSP A;  1IRG A;  4B4C A;  2H1L A;  3K0L A;  2PMH A;  4OAY A;  4HSR A;  2XPU A;  3WHC A;  3NWT A;  5HDG A;  3BJA A;  5BPI A;  2HYG D;  5D5U B;  2Y0S A;  4HF0 A;  1FYM A;  2XF5 A;  1ETX A;  4XK4 A;  1A6Q A;  5D4R A;  3TGN A;  4LOC A;  1R00 A;  1P4W A;  4XOR A;  3GFI A;  1Y1V J;  1GXQ A;  2EIL H;  3HG9 A;  5D4S A;  1HOM A;  1ETY A;  4CSW A;  2K02 A;  1YS7 A;  3D5S C;  1YO5 C;  3CC4 I;  3K4L A;  5J8F A;  4I6Z A;  1MW7 A;  5E1Z B;  3TKY A;  3FXK A;  2OTL I;  1RKT A;  1ZRD A;  1R4M B;  5J4Y A;  1VND A;  4Q47 A;  1BI2 A;  4KIT B;  4AWX B;  2R7T A;  2A6T A;  1YX5 A;  1H89 C;  2IA1 A;  1OYI A;  3E5Q A;  2X9D A;  4HLX A;  4XN0 A;  5LEK A;  1DDN A;  2UXX A;  4BYY A;  4LMY A;  1KU9 A;  3J80 Z;  1LQ1 A;  3W2W A;  4BAY A;  2P4W A;  5J8C A;  5KCM A;  3MKW B;  2ZO4 A;  3I4P A;  2Z33 A;  4ZC3 A;  4RDU A;  1B1B A;  2R7Q A;  3OR1 C;  4D7N A;  1H0M A;  2Y75 A;  1SVL A;  1W1W E;  2TRT A;  4FT8 A;  4RLQ A;  5E1X A;  4CCN A;  4E6K G;  4ETS A;  1TWC J;  3I58 A;  4M74 A;  5L3G A;  3OR2 C;  2K3F A;  3F23 A;  4DNC A;  1T8I A;  3KEQ A;  2NVX J;  5K5O A;  2NXN B;  3ULQ B;  4G8X A;  2ZXJ A;  2VKV A;  4BH9 A;  2MW8 A;  2CO5 A;  2MLK A;  1N77 A;  1K6Y A;  2PJR A;  3P9C A;  1D1A A;  3AG3 H;  4D0P A;  3T8T A;  1SAX A;  3EUA A;  1GV5 A;  2VC1 A;  1JT6 A;  1ORK A;  1R4N B;  2E60 A;  3BZC A;  3QOE A;  1P4A A;  1XCV A;  2JA2 A;  2R4G A;  4Q4Z F;  3GX4 X;  3RCO A;  4MQ9 F;  3S1M J;  2LKS A;  3S1N J;  2GXA A;  1Z3Y A;  2XSJ C;  5E20 A;  4LGW A;  4XRM A;  3G3Z A;  2P8T A;  3IKT A;  3L09 A;  2K3P A;  3PNT A;  3ZRG A;  5EEH A;  1G6N A;  3CCJ I;  5LHH A;  1OQY A;  2LBF A;  2IGO A;  4WXC A;  3JCU C;  2ZSH B;  3U2R A;  4LLN A;  2BHZ A;  3MMY B;  4E7I A;  4J19 A;  1LPQ A;  1MBK A;  4MFE A;  4YEL A;  2MD0 A;  3BPX A;  1LJ9 A;  3Q0V A;  1B9N A;  3KEY A;  2COB A;  3R0A A;  4XR6 A;  2PFB A;  2R5Z A;  2KMU A;  3S2D J;  1VZ0 A;  3SJM A;  2MAB A;  2XAQ A;  4CUG A;  5D6E A;  4BHP A;  2VC0 A;  2YSR A;  5KNL A;  2Z2S B;  2GAU A;  4L18 B;  4HOB A;  5IP9 J;  2E1N A;  4XN3 A;  4RM2 A;  1MBG A;  5EZG A;  4EJU A;  2W48 A;  1QHH D;  3JRB A;  2IGK A;  3C1D A;  5EGO B;  2K5C A;  4KMU X;  2ESN A;  4CCO A;  4Y13 A;  3OSF A;  2CUZ A;  2CUJ A;  9ANT A;  3KZZ A;  2CGP A;  3WTS C;  3LAP A;  1TWF J;  3G71 I;  4MFD A;  1Q1V A;  4RBO A;  3TW7 A;  1I1G A;  2HFH A;  4YIR X;  2X1C A;  3RYP A;  3DFG A;  4HV5 A;  3D0S A;  4F7Z A;  1X4O A;  3U1K A;  1VQO I;  2CFO A;  5J1Y A;  4IKF A;  4IHW A;  2DA4 A;  4EJT A;  3DU6 A;  1XD7 A;  2VPR A;  3ISP A;  1KZH A;  3ZQI A;  1W0U A;  3GTQ J;  1ZN2 A;  3OIO A;  3OYC A;  2NYX A;  5D5W B;  3JRG A;  1NHA A;  2V7F A;  2STW A;  3P5J A;  4HAM A;  4CO8 A;  5CJ9 A;  3LSG A;  2ECB A;  2E34 A;  3L7W A;  4II2 A;  5J1U A;  5TIS C;  3KP6 A;  3FXO A;  2DDA A;  4NC6 A;  1YJN I;  1IG7 A;  3S17 J;  2X0L A;  3S32 A;  3OSG A;  4B48 A;  1YI2 I;  5DUI A;  1HF0 A;  3EUK L;  3F6O A;  3BP8 A;  1JGG A;  5D5X B;  2HDD A;  1YYV A;  2C6Y A;  1Y0U A;  2KJB A;  3CES A;  2DLL A;  3WTV C;  1P9Q C;  2COM A;  2FML A;  4M73 A;  5BQT A;  5AIQ A;  3SZG A;  4E7S A;  1V5F A;  1HDD C;  1D3Y A;  5DCM B;  1RZ4 A;  1OFC X;  3DF8 A;  1QNT A;  2I5U A;  3I59 A;  5IY5 H;  2DYS H;  4UNO A;  2EV5 A;  3MQ0 A;  5F0H A;  2E7W A;  1J5Y A;  4B43 A;  1OCZ H;  3IAS 2;  5K1Y A;  2LY2 A;  2LC2 A;  2W1O A;  1ERD A;  3GZN B;  3LWF A;  2V1X A;  3P7N A;  5L3D A;  2FA5 A;  1Z6T A;  4QLC U;  1T0F C;  1APL C;  4YFX F;  4IOA F;  1EF4 A;  5KAF C;  2D45 A;  3H36 A;  3W6V A;  1OR7 C;  2VBZ A;  3E7L A;  3GF2 A;  2NS0 A;  2Z9O A;  1ZHF A;  3BZK A;  4HBL A;  4PJM A;  4GXO A;  2E36 A;  2VJI A;  1XGM A;  2BVL A;  2CQ7 A;  3DPL C;  1VF9 A;  1PUF A;  2DQL A;  3H9J A;  2HQN A;  3PM1 A;  2VI6 A;  2FOW A;  4RMN A;  4HDU A;  4AYB N;  2WWY A;  1TQI A;  4A0Z A;  2X1E A;  1JUP A;  4HX8 A;  4LB6 B;  1ZEL A;  2V6E A;  3ZQF A;  4A3L J;  1HKQ A;  2ELK A;  4HQE A;  3K70 D;  2A3S A;  3DCF A;  4YEJ A;  4C30 A;  1H9G A;  4L9J A;  1CQT A;  3K6G A;  2NS7 A;  2IS2 A;  4JYK A;  3ZMT A;  4ZYH A;  1G3W A;  2K9L A;  3G73 A;  1OCT C;  2XHK A;  2XC7 A;  3L2R A;  3OIP A;  5EF6 A;  4JQF A;  2QBY B;  3VEP A;  1BM9 A;  4CCK A;  1VI0 A;  3Q3S A;  3ZMV A;  1FOK A;  5JFR A;  2MFZ A;  2ME6 A;  5D6F A;  3H1C A;  4RAZ A;  4EM2 A;  2HKO A;  1R23 A;  1Z05 A;  1U5T C;  3QAH A;  4RAY A;  2F48 A;  1XTA A;  1Z7U A;  2K9M A;  1LDD A;  1OLT A;  2CQK A;  1JJ8 C;  1P2F A;  3HKZ N;  4IPA A;  2DA3 A;  5HLT A;  2Q1Z B;  3LL7 A;  5GAE J;  1LEB A;  3CJN A;  3J7A O;  3MZH A;  1ZR2 A;  3FXJ A;  3BR0 A;  3C2G A;  3M07 A;  4EM1 A;  3RPU A;  1O3Q A;  1I6X A;  3J81 K;  1GT0 C;  3DP7 A;  2DOD A;  3DWL E;  3P9I A;  1REP C;  3ZOB A;  1PDN C;  2JRM A;  3QPT A;  2OU2 A;  3HTU A;  3KYC B;  2R0Q C;  2ZSI B;  4BBS J;  3HRM A;  1TLH B;  4RGU A;  3E1S A;  5F08 A;  1QVU A;  2XSD C;  4PJL A;  1MMN A;  2AO9 A;  2IP2 A;  3EYI A;  1YRN A;  2DFI A;  1UG0 A;  3B6A A;  1D5V A;  4NQW B;  3QPS A;  3KYL A;  1N75 A;  1WI3 A;  2RVC A;  2M5W A;  3ESW B;  4IRG A;  4C2M J;  2R7X A;  3K4K A;  1HW2 A;  2QSG X;  2R5Y A;  4A3K J;  4PCQ A;  4A3E J;  1BOA A;  1MGT A;  4MGR A;  2QKL B;  3VB2 A;  2K4J A;  2FEZ A;  1FT9 A;  1V55 H;  1SFO J;  2X6O A;  1WJC A;  2WV1 A;  3WG7 H;  3C18 A;  5D8K B;  1YG2 A;  1ON1 A;  1JKQ C;  3LNQ A;  3GEZ A;  1KU3 A;  1T6S A;  2QQB A;  3U1D A;  5CVI A;  2VT3 A;  4EJW A;  2NNY A;  2XDV A;  1G8X A;  1UST A;  3HDD A;  2A68 F;  2KIF A;  3BRO A;  2EQR A;  2HWV A;  3CTA A;  4XLA A;  2GBY A;  1XMK A;  2DFH A;  2QBY A;  2QYO A;  5E79 C;  3F0C A;  3SDB A;  4QTR A;  2RC4 A;  4ZYE A;  1RET A;  4Q5S F;  1UCR A;  3HRT A;  3MD2 A;  4YFN F;  5F1R A;  3KP2 A;  1PUE E;  2WB1 A;  1XMA A;  2DO7 A;  1Z77 A;  2MBF A;  3GFJ A;  2HYF A;  2HU9 A;  3ZQG A;  3HBL A;  4HLY A;  1TNT A;  1YW7 A;  1CF7 B;  2OA4 A;  4PGG A;  3EUH C;  3HOT A;  5HNH A;  3CC7 I;  1I39 A;  1QZE A;  2W00 A;  3DEW A;  2VKH A;  3TMO A;  4BQQ A;  5M5W J;  2O7O A;  2EA4 A;  1W5S A;  4BHB A;  2E5N A;  1MH4 A;  3W3C A;  1EH7 A;  1F9N A;  2E71 A;  2DW4 A;  3R60 A;  4JOM A;  2L7F P;  5BOX A;  3H5A A;  2GXB A;  1K4S A;  2XF7 A;  2HDC A;  2J5O A;  2NOJ B;  1U3E M;  5BPD A;  2D1H A;  5FD6 A;  1XX5 A;  4BY7 J;  1HW1 A;  4YFK F;  4WCG A;  1M1E B;  4DZJ A;  1ETO A;  2E1M C;  2O3F A;  2XGC A;  5J4V A;  2VBY A;  2PBI A;  1FIA A;  2L9S A;  3VFZ A;  3FX3 A;  4ZYD A;  2HVS A;  3IRQ A;  4UVA A;  2MH2 A;  3HC7 A;  1AKH B;  4XLC A;  3TP3 A;  2L01 A;  3FK6 A;  2M4G A;  3E97 A;  3WE3 A;  2P81 A;  2F5F A;  3WHB A;  2LP0 A;  1W7P D;  4A3D J;  1U9O A;  1LFP A;  1USS A;  1HW5 A;  2GIV A;  2CV0 A;  2F4I A;  1IF1 A;  3EPZ A;  4A0X A;  1Z9C A;  2M2E A;  1PVE A;  4M3D A;  3H3V K;  2WB1 N;  2F4O B;  3CUQ A;  3FBN B;  1T2K A;  2X6Y A;  3AL0 B;  4N4O B;  2JA6 J;  1T0F A;  2VJ4 A;  3W2A A;  3D5R C;  3COA C;  1YW9 A;  3WOD F;  3VWB A;  3T8R A;  3K1N A;  5A2Q K;  2YUS A;  1OJL A;  3TL4 X;  5C44 J;  1YFH A;  2IA0 A;  3BQZ A;  4ABZ A;  4N4N B;  3F21 A;  1JGS A;  1ZRE A;  4BEH A;  2CUE A;  4I99 C;  2DJI A;  2BW3 B;  2EH3 A;  4J01 A;  5LFA A;  3GTP J;  2XV4 S;  1AA7 A;  2VJ5 A;  1FWZ A;  1RUO A;  3M4O J;  3TDZ C;  3TDU C;  4ENN A;  3IP4 B;  2HS5 A;  1ZRF A;  2XRO A;  1XB4 A;  2VBW A;  3CO6 C;  1ZKG A;  5FGM A;  4BL0 B;  3F8F A;  1V3F A;  3BC8 A;  3S8P A;  3W6K B;  3ZPL A;  2W85 A;  3TBI A;  5B1B H;  5CVJ A;  2M7A A;  1BIB A;  1ETK A;  3I71 A;  5FLM J;  4KIC A;  4FE4 A;  2QUF A;  1WPK A;  3F8B A;  3SEZ A;  3OV8 A;  2YX7 A;  5H2F C;  4KIG A;  3ABL H;  3QU6 A;  4ASN A;  2TDX A;  3DBR B;  3IHU A;  1E17 A;  3LOC A;  1YS6 A;  2KIM A;  5J3L A;  3HJE A;  5L3E A;  4DJA A;  3JRC A;  2XAU A;  1IN5 A;  2G7U A;  4XIC A;  2VOD A;  2JA5 J;  2P6S A;  4TV7 A;  3HIF A;  3RKX A;  3CME I;  2IGN A;  1NH3 A;  3SFI A;  3HOY J;  1HC8 A;  5HLG A;  1LKX A;  4M72 A;  1GV2 A;  4UUV A;  4HRI A;  4JK1 X;  1AKH A;  3A1Y A;  3EQL F;  4A3I J;  1EH8 A;  5K7Z A;  2A5W A;  2E1M B;  2DOE A;  3RQ4 A;  4BJ5 C;  1U2W A;  1MJA A;  2X51 A;  2HZD A;  4A5M A;  2H8W A;  1OPC A;  5JR3 A;  2QLZ A;  4XOT A;  5ILU A;  5GPC A;  2XGX A;  3G2B A;  5FB2 A;  3DTE A;  3N4M A;  2FE3 A;  2M1B A;  3C3W A;  3CDI A;  3H3U A;  4X1E A;  4XKB A;  2QCO A;  3ZCO A;  4A3B J;  2AHQ A;  1HCR A;  4OMY A;  1MDM A;  3HKZ A;  1T39 A;  4BE1 A;  1I27 A;  1PJR A;  3GTO J;  1UHW A;  3CCQ I;  4H0E A;  1E3O C;  4HX7 A;  2WAQ A;  2EZH A;  1S7O A;  5IOZ A;  5EJC A;  3BCA A;  3F8M A;  3GLX A;  1E3H A;  1DU0 A;  1ZG5 A;  2L02 A;  5CQE A;  2F5C A;  3BDD A;  4MQV A;  1BI0 A;  1VQL I;  3K1M A;  4A93 J;  5K5Q A;  4KN7 X;  4HF2 A;  5DTD A;  5CLS A;  3FIW A;  3L2Q A;  2DA2 A;  4A3J J;  1OR7 A;  4R1H A;  4Y3O A;  1WVR A;  2QGU A;  3CUO A;  3L2U A;  3F22 A;  3OYB A;  2MLG A;  1WSU A;  1RKW A;  2Z99 A;  4XLF A;  3CJQ B;  2ZME B;  1D5Y A;  3TO6 A;  1WZ2 A;  3V7S A;  2B63 J;  3CMM A;  2PN6 A;  1WJD A;  1EH6 A;  2XGD A;  1S7E A;  1T98 A;  3V8L A;  3BT9 A;  1BR1 A;  4D7M A;  1LDK B;  1K4T A;  1BL0 A;  3K70 C;  2DMQ A;  3W6J B;  4KIB A;  3SDG A;  3KP5 A;  3RDI A;  1WQ2 A;  3CCU I;  4B3X A;  1KGS A;  2KIQ A;  3MKY B;  4P55 A;  2HXO A;  3FF5 A;  1I3A A;  1F4K A;  2BXY A;  3RPU D;  5IYC J;  2A07 F;  1ZGJ A;  2HVR A;  4OIP F;  1SFU A;  2X1D A;  3HOU J;  4C3I J;  1Z3X A;  2R7V A;  1R58 A;  3CCL I;  3TED A;  1BOB A;  2F4M B;  4L9T A;  5AON A;  4MTE A;  1KU7 A;  2QQA A;  1IO2 A;  5J6X A;  2O9L A;  1FC3 A;  2HVQ A;  4I76 A;  4BXU A;  5JLW A;  2ME0 A;  3I4M J;  5CKT A;  5FKN A;  4AID A;  3OWT A;  1R1V A;  3GCM A;  3DBH B;  1U8B A;  5B3S H;  1I6H J;  4RAF A;  2IXS A;  2KRF A;  3UKG A;  2V9V A;  2K27 A;  4FIS A;  4JP0 A;  2ZME C;  4M3F A;  4W1U A;  3OIQ A;  2EK5 A;  4EJV A;  2B7E A;  3GTK J;  2HQA A;  5LGU A;  2K4B A;  1YW8 A;  5LGT A;  5HS9 A;  2LRD A;  3F8C A;  4II3 A;  3R6S A;  5TRD A;  2LH9 A;  2IVM A;  1R1U A;  5DUK A;  2LK2 A;  1FEX A;  4S0H B;  4RA2 A;  5DS9 A;  2DPD A;  2O61 A;  1FTT A;  2VON A;  5F0C A;  1OCP A;  3RTR A;  4A12 A;  3SXY A;  1GDT A;  1RC9 A;  4RGS A;  3JRD A;  3CD6 I;  2XPV A;  3BOQ A;  3VPR A;  4AIK A;  4A2U A;  1A35 A;  1BBY A;  2DK5 A;  4IHS A;  1WRJ A;  4KFC A;  4RAG A;  2WAD A;  1W7P A;  3RIR A;  1FBQ A;  3MKL A;  3CCE I;  2DTZ A;  5DCF A;  2L0K A;  3M8J A;  4KN4 X;  2Q8K A;  5J47 A;  1MIJ A;  2FUG 2;  2KRC A;  2CJJ A;  1XPX A;  4E7L A;  1R9T J;  5ICF A;  1DPR A;  5ICC A;  4F91 B;  2CV1 A;  4KT5 C;  3SFZ A;  3HGY A;  3K4M A;  5HDK A;  4B1R A;  2IS1 A;  1O3R A;  1U6G A;  1QPM A;  4GDF A;  3PNY A;  2IW5 A;  1IN7 A;  2L4M A;  3O2P E;  1H88 C;  1TQP A;  4M6V A;  2R7O A;  5IYB J;  3ZQ7 A;  3K4B A;  3OYA A;  4BQA A;  4IHV A;  1O3T A;  3RKQ A;  4E7H A;  3LSH A;  4NUB A;  4P5O A;  3BG5 A;  1I5Z A;  3HZJ A;  4G9Y A;  4HF1 A;  3LA2 A;  3GTM J;  3PNV A;  2DT7 B;  2KP6 A;  2A05 A;  3MZY A;  3KZI C;  2LF7 A;  3ONQ A;  2YPR A;  1FMV A;  2ZKZ A;  4UY8 I;  1FP1 D;  1LFU P;  1FSH A;  2MYS A;  3GO5 A;  2ZCW A;  2YS9 A;  2H09 A;  3QOD A;  3V7R A;  5FRM A;  2R7W A;  1TBX A;  1YLF A;  1R5G A;  1W36 C;  4KJZ A;  2PJR B;  3FMR A;  3JAM K;  1X4P A;  3ERE D;  1G3S A;  3VDX A;  2M8E A;  3S93 A;  1Z21 A;  2HXI A;  2X85 A;  2EPF A;  1BJZ A;  4NBQ A;  3WTX C;  2G9W A;  3NWS A;  1W4M A;  2DCE A;  4AVP A;  2MA3 A;  5BMZ A;  2K40 A; 
#chains in the Genus database with same CATH homology
 2R7D A;  3K1P A;  1W5T A;  4ZZL A;  4GYI A;  3B73 A;  2GZW A;  3GZ5 A;  3ECO A;  4FX0 A;  3JSP A;  1IUY A;  4R8H A;  1STZ A;  2GQQ A;  2PEX A;  2JPC A;  1L0O C;  1OYW A;  1WKM A;  3NRV A;  3SQN A;  3M1E A;  2GA2 A;  5LGN A;  3WGH A;  1XDS A;  1C0W A;  1P6R A;  2XAF A;  1HST A;  1KQ8 A;  1TNS A;  2DU9 A;  4R79 A;  3R4K A;  2DK8 A;  4UXN A;  2EFW A;  5CYV A;  4MNU A;  2F5E A;  3BJ6 A;  4XSZ F;  5TJJ A;  1E2X A;  2MH9 A;  2EFN A;  4YII A;  2XKO A;  4CIC A;  3EUH A;  1J0R A;  2FBI A;  1R5H A;  2UZK A;  5LBQ A;  3ML6 A;  4A6E A;  2M30 A;  1ZG1 A;  2ZME A;  3AAF A;  1FZP B;  2A6H F;  2FNA A;  2JTV A;  4L0Z B;  4U0V A;  2NRA C;  3JW4 A;  3KP7 A;  3H92 A;  1TQM A;  1JHF A;  2OBP A;  2ZFW A;  2FF4 A;  3H3Z A;  2MD5 A;  1IN4 A;  5DV5 A;  3E5U A;  4LG0 A;  3M8F A;  3T5X A;  2QEN A;  4OIN F;  4IHT A;  1FPQ A;  1RIO H;  3WTT C;  3SZP A;  1XGN A;  1P92 A;  2HQR A;  2ADU A;  2EWN A;  3IRR A;  5LEJ A;  4Y17 A;  3KEO A;  3KE2 A;  1YTY A;  4WK8 F;  4K2E A;  4UVC A;  2A5Y B;  3RYR A;  3K2Z A;  3HOS A;  2JRT A;  1O7L A;  5LLQ A;  3VOD A;  5LRS A;  1XGS A;  3M9A A;  3I0T A;  4YG2 F;  4U7B A;  1SMY F;  3E6C C;  3RI4 A;  2V1D A;  4UVB A;  3TQN A;  3F72 A;  5KVR A;  1XSX A;  2QQ9 A;  3ZN1 A;  4N9I A;  3MWM A;  2YU3 A;  4YIF A;  1GHC A;  3ELK A;  5LHG A;  2H27 A;  1J9I A;  1RUN A;  2LF8 A;  1GVJ A;  2DAO A;  1B9M A;  2RN7 A;  2OAZ A;  3I54 A;  1ON2 A;  3MAJ A;  4G94 A;  2ACJ A;  1SD7 A;  1K78 B;  4CDG A;  4MHG A;  2VOO A;  1R36 A;  3REO A;  5DD4 A;  3R0J A;  2H6C A;  2FRH A;  4OOI A;  2BGC A;  5A2Q Z;  2EFP A;  3BZ6 A;  4I0B A;  2FOK A;  2IJL A;  3EET A;  2L4A A;  2VXZ A;  1K6O A;  3I5U A;  3HHH A;  1RNL A;  4CZZ A;  1HKS A;  2W24 A;  4HQM A;  2UWM A;  1SFE A;  5ERI A;  3FXQ A;  1KQ9 A;  2EV6 A;  1SD4 A;  2HKX A;  4L9V A;  4L9N A;  1U8R A;  5DD8 A;  5HLI A;  4RGX A;  4ON0 A;  1BC8 C;  3JTG A;  1HXD A;  1SMT A;  4P9U A;  1XN7 A;  1TTY A;  3FM5 A;  2ZNZ A;  1Q1H A;  4XLN F;  2EJR A;  2RV8 A;  1IZ1 A;  1U5T A;  4WXD A;  2XAS A;  3MCZ A;  4S05 A;  4LD5 A;  1B4A A;  1I1S A;  4G7Z F;  2W84 A;  3JTH A;  3FM3 A;  1RI7 A;  5E8G A;  1KYW A;  1FSE A;  2P5K A;  1FYL A;  1W7P B;  3JAM Z;  4G7H F;  1MKM A;  1LVA A;  2HOE A;  1QZY A;  2IPQ X;  2KKO A;  2K7L A;  5E18 F;  4A0Y A;  4FHT A;  3WU0 A;  4N0B A;  3O3K A;  1QO0 D;  3RKY A;  3E6B A;  4LLL A;  4U7D A;  3GXO A;  3GUD A;  3SZT A;  5CVU A;  2G7H A;  1IRF A;  4HV6 A;  3HRU A;  5IT3 A;  4PGH A;  3F3X A;  3PQK A;  1G3T A;  2A6E F;  3ZN0 A;  2FBH A;  3EDP A;  4M6X A;  3WU1 B;  2PMU A;  4EGY A;  2FQ3 A;  1R7J A;  2YX4 A;  3TOA A;  1J59 A;  2H94 A;  3O6B B;  2JT1 A;  5FLX K;  5FO5 A;  3TO9 A;  3GZ6 A;  4O3M A;  1JE8 A;  4RGR A;  2M45 A;  4N9H A;  4EMS A;  1S8N A;  2EB7 A;  2PI0 A;  2NAZ A;  4ENJ A;  4RB0 A;  1LB2 A;  2STT A;  3HRS A;  3BWG A;  2O6G E;  3CDH A;  4G6Q A;  4Y15 A;  3C7J A;  3CLO A;  1DPU A;  4HZF A;  4LJZ F;  3SHF A;  4WX9 A;  4EM0 B;  1OYY A;  2WV0 A;  5F64 A;  5FD5 A;  3V7C A;  2YR2 A;  3Q5F A;  3E6M A;  3HYI A;  4UV9 A;  1MJ9 A;  1OKR A;  4RS8 A;  2Z5U A;  1AOY A;  4O6J A;  3I59 B;  2VT2 A;  1QQI A;  2ETH A;  4U0Y A;  3QP5 A;  5HVQ C;  2Z3Y A;  4XSX F;  4GGG A;  1FBS A;  3QOP A;  1ZRC A;  3FXU A;  3E6D A;  2W57 A;  4OIO F;  2QZ8 A;  1L3L A;  3QRF F;  3MEX A;  2WC2 A;  3HHG A;  5H20 A;  1R1T A;  1MDM B;  2LDU A;  4B8X A;  1BC7 C;  3QU3 A;  3KCC A;  4NB5 A;  1J2X A;  1XCB A;  2W25 A;  3WTZ A;  1FNN A;  5AIP A;  4FX4 A;  3WE2 A;  2E1C A;  1UB9 A;  1B6A A;  1F5T A;  3DKW A;  2JSC A;  6PAX A;  5HS7 A;  4MTD A;  2DT5 A;  2ISY A;  1WI9 A;  3ZP5 A;  1IN8 A;  5JVT A;  3LA3 A;  1O57 A;  4LB5 A;  5LRR A;  5L3F A;  4IVN A;  4U0W A;  1JXS A;  2IRF G;  4KNY A;  3L9F A;  3GW2 A;  2CG4 A;  2D2W A;  5HLH A;  1IN6 A;  1SFX A;  3S2W A;  4IXA A;  4RB1 A;  3KLN A;  4ENM A;  4JBA A;  3TOB A;  4ZH4 F;  4BHC A;  3IL2 A;  1SD6 A;  2EFQ A;  5D8L B;  2VBX A;  1HKT A;  5JI6 A;  4EVI A;  1K7A A;  2P7C B;  1H9T A;  4EV0 A;  5L3C A;  3CUQ C;  1YQA A;  3QPH A;  3V4G A;  1QGP A;  2ISZ A;  1HQC A;  2RQP A;  4CYD A;  3DQV C;  3T1B A;  5E17 F;  3DV8 A;  3PFI A;  4E70 A;  4KUM A;  1MZB A;  2EFO A;  1X3U A;  3K69 A;  1ZLJ A;  2DI3 A;  5E8I A;  3BPV A;  4RB3 C;  4CGZ A;  2GWR A;  1O3S A;  1FY7 A;  2MC3 A;  4OU0 A;  2M87 A;  2B0L A;  1TW2 A;  2FMY A;  2GA1 A;  2CW0 F;  2QWW A;  5DCM A;  5CVV A;  2VE8 A;  4M71 A;  4HYE A;  2CWE A;  4EQQ A;  4KYW A;  1IXC A;  4G6D A;  1Z6R A;  2OZ6 A;  4XLP F;  3EYY A;  4AD9 A;  2EA2 A;  1KQ0 A;  5E1W A;  3V8K A;  2HZT A;  5CVR A;  3I64 A;  1ZH5 A;  4M9X A;  2XRN A;  1D8K A;  2RKH A;  3U9G A;  5LHI A;  4MEX F;  5KK1 A;  4ESJ A;  1ODD A;  2P6T A;  3IWZ A;  2GXG A;  3Q9S A;  4PDK A;  2VE9 A;  4LLG F;  4I09 A;  3GFM A;  4I0A A;  4EJO A;  1DUX C;  3LAJ A;  2LNB A;  1A04 A;  3RPQ A;  4S04 A;  1ZAR A;  1P4X A;  1XSD A;  3GYH X;  4HX4 A;  4L5I A;  1JHH A;  1VTN C;  1K78 A;  5FFZ A;  2XVC A;  5JHU A;  2AS5 F;  3HTS B;  5FLX Z;  2Y48 A;  2VN2 A;  1UFM A;  1BJA A;  2O8X A;  4IRI A;  2QM3 A;  1HBX G;  1S3J A;  2JZY A;  3M8E A;  3L2C A;  3ABT A;  4XBF A;  5HOO A;  5ED4 A;  3LQR A;  4CHU A;  1QBJ A;  2LSO A;  2PJP A;  2FU4 A;  1D8J A;  1PP8 F;  1BI3 A;  1OMI A;  5L3B A;  3HSE A;  3T0Y A;  2RGV A;  2NNN A;  4HW0 A;  5D5V B;  1XSV A;  3ZMZ A;  2UXN A;  4IRH A;  4P9F A;  4LG0 B;  2BYV E;  4GO1 A;  1PP7 U;  4OIQ F;  2FXA A;  3VOE A;  3ZMU A;  3GWZ A;  1IAW A;  5ICE A;  1FBU A;  2Q0O A;  1BI1 A;  1FX7 A;  3E5X A;  2QVO A;  4ZYG A;  3N97 A;  4UHT A;  2PQ8 A;  5IT9 K;  3WG9 A;  1EV7 A;  2XUB A;  2OQR A;  3WGG A;  4BNC A;  4G7O F;  2RNJ A;  2X4H A;  2Y0M A;  4A5N A;  5DEQ A;  2PLY A;  3WGI A;  3P9K A;  4DQ2 A;  2HTJ A;  3V8J A;  1ZYR F;  3F6V A;  5IT9 Z;  2DPU A;  4GYG A;  4ENK A;  2F5D A;  4WXH A;  4OMZ A;  3JSO A;  1ULY A;  2DBB A;  5H6Q A;  2CSO A;  3E3V A;  2ELH A;  4Z2Y A;  1J75 A;  2P5V A;  3DEU A;  5FFX A;  3KZY A;  3LA7 A;  4NHJ A;  3FZV A;  1IXR C;  2WTE A;  3IWF A;  3KET A;  2IT0 A;  1DP7 P;  1K79 A;  4ESB A;  3B02 A;  1R22 A;  3WTU C;  4CXF A;  2OZU A;  3Q9V A;  4M9S A;  1MJB A;  4NQW A;  2FNP A;  2V79 A;  1MD0 A;  2LKP A;  2FSW A;  2RDP A;  3HSR A;  1ZG3 A;  1G3Y A;  2E7X A;  3ROU A;  3HSF A;  4LFU A;  3ZMD A;  3NQO A;  2BE5 F;  2ZBK A;  1S6L A;  3R61 A;  3FHZ A;  3GFL A;  2K86 A;  3M7G A;  4IF4 A;  4KDP A;  4EGZ A;  1Z91 A;  2D1V A;  2AXL A;  3RJP A;  4LK0 F;  1KU2 A;  1S29 A;  1WWX A;  4L5J A;  1KYZ A;  1HSJ A;  1G4D A;  2BV6 A;  1LNW A;  3RKW A;  4O5V A;  1CF7 A;  4UV8 A;  2H6B A;  2EV0 A;  4ZZD A;  3LST A;  5DDG A;  3J80 K;  3KLO A;  4KIF A;  2CFX A;  3ECH A;  2L54 A;  1LDJ A;  1U78 A;  1GXP A;  1XDU A;  2HR3 A;  2O03 A;  3MFK A;  4WF2 A;  2VOP A;  5ICG A;  2F2E A;  1T38 A;  1KA8 A;  3F8N A;  2R7F A;  4LK1 F;  1IXS B;  1F1Z A;  3ZMS A;  3QP6 A;  2Q2E A;  4GCV A;  3DXJ F;  3GVA A;  1FP2 A;  2R3S A;  1ZLK A;  4P96 A;  4PZJ A;  2DQR A;  5K5R A;  2P5L C;  4MEY F;  4I2O A;  3WTY C;  3CUQ B;  2ZNY A;  1J7K A;  4AIJ A;  5HDN A;  2BEO A;  3J81 Z;  1ZAO A;  4QWQ A;  2JPB A;  4U88 A;  3FXR A;  4HA8 A;  2BBY A;  1ZGA A;  4KMF A;  4Q48 A;  4I01 A;  3TO7 A;  4IJA A;  2ESH A;  1LEA A;  1BN5 A;  5ILS A;  5EEG A;  5ILV A;  2KJC A;  1B59 A;  4I02 A;  4M9Z A;  5BS6 A;  2OD5 A;  4XRF A;  3HUG A;  4RB2 C;  2DTR A;  3IKV A;  2P7V B;  2XAH A;  2HEO A;  2OQG A;  2HGC A;  3IC7 A;  2O0Y A;  4AIH A;  4OIR F;  5HS8 A;  4I98 B;  1ONV A;  2V1U A;  3FMS A;  1SD5 A;  4HDV A;  2J5P A;  4B09 A;  3ABU A;  4M6Y A;  4WWC A;  2V6C A;  1FYK A;  1U5T B;  1IW7 F;  1CGP A;  3DPT A;  2XKP A;  3FMQ A;  1TW3 A;  2ZJ2 A;  3NEU A;  3LQQ A;  2CYY A;  1S7A A;  3FWE A;  1FLI A;  1UHM A;  3KFW X;  1O7F A;  2XAJ A;  1V4R A;  2KIU A;  2PG4 A;  2XIG A;  3D5L A;  3KP3 A;  4ESF A;  4L0Y B;  1BIA A;  3LFK A;  2FBK A;  1AWC A;  1XGO A;  2HTS A;  2XAG A;  3PQJ A;  4KA4 A;  2A61 A;  1QZZ A;  5H6R A;  5F6F A;  3BJO A;  2A69 F;  5DYM A;  3OOP A;  3I53 A;  3L00 A;  2L3D A;  3WTW C;  1YIO A;  1Z1D A;  3BY6 A;  4I7H A;  3CO7 C;  3KP4 A;  2IA2 A;  3K9T A;  4A6D A;  1IRG A;  3K0L A;  2PMH A;  5HDG A;  3BJA A;  5BPI A;  2HYG D;  5D5U B;  1FYM A;  4HF0 A;  5D4R A;  3TGN A;  1R00 A;  1P4W A;  3GFI A;  1GXQ A;  5D4S A;  2K02 A;  1YS7 A;  1YO5 C;  5J8F A;  5E1Z B;  3TKY A;  1ZRD A;  4Q47 A;  1BI2 A;  4AWX B;  2IA1 A;  1OYI A;  3E5Q A;  4HLX A;  5LEK A;  1DDN A;  2UXX A;  4BYY A;  4LMY A;  1KU9 A;  3J80 Z;  1LQ1 A;  4BAY A;  2P4W A;  5J8C A;  2ZO4 A;  3I4P A;  2Z33 A;  1B1B A;  1H0M A;  2Y75 A;  4FT8 A;  5E1X A;  4ETS A;  3I58 A;  4M74 A;  5L3G A;  3F23 A;  4DNC A;  3KEQ A;  5K5O A;  3ULQ B;  4G8X A;  2ZXJ A;  4BH9 A;  2CO5 A;  2MLK A;  3P9C A;  4D0P A;  3T8T A;  1SAX A;  2VC1 A;  1P4A A;  1XCV A;  4Q4Z F;  3GX4 X;  4MQ9 F;  5E20 A;  4LGW A;  3G3Z A;  2P8T A;  3IKT A;  3L09 A;  5EEH A;  1G6N A;  5LHH A;  4WXC A;  3U2R A;  4LLN A;  3BPX A;  1LJ9 A;  1B9N A;  3R0A A;  2PFB A;  2XAQ A;  5D6E A;  4BHP A;  2VC0 A;  2YSR A;  2GAU A;  4L18 B;  4HOB A;  2E1N A;  4EJU A;  3C1D A;  4KMU X;  2ESN A;  4Y13 A;  3KZZ A;  2CGP A;  3WTS C;  3LAP A;  1I1G A;  2HFH A;  3RYP A;  3DFG A;  4HV5 A;  3D0S A;  4F7Z A;  4EJT A;  1XD7 A;  3ISP A;  1ZN2 A;  2NYX A;  5D5W B;  1NHA A;  2STW A;  4HAM A;  4CO8 A;  5CJ9 A;  3L7W A;  3KP6 A;  2X0L A;  5DUI A;  3F6O A;  3BP8 A;  5D5X B;  1YYV A;  2C6Y A;  1Y0U A;  2KJB A;  2DLL A;  3WTV C;  2COM A;  2FML A;  4M73 A;  5BQT A;  5AIQ A;  1D3Y A;  5DCM B;  1RZ4 A;  3DF8 A;  1QNT A;  3I59 A;  4UNO A;  2EV5 A;  3MQ0 A;  2E7W A;  1J5Y A;  5K1Y A;  3LWF A;  5L3D A;  2V1X A;  3P7N A;  4QLC U;  2FA5 A;  1Z6T A;  4YFX F;  2D45 A;  2VBZ A;  3GF2 A;  2NS0 A;  2Z9O A;  1ZHF A;  4HBL A;  4GXO A;  1XGM A;  3DPL C;  2DQL A;  2HQN A;  4HDU A;  2WWY A;  1TQI A;  4A0Z A;  4HX8 A;  4LB6 B;  1HKQ A;  4HQE A;  2A3S A;  1H9G A;  4L9J A;  3ZMT A;  4ZYH A;  1G3W A;  3G73 A;  2XHK A;  4JQF A;  2QBY B;  3VEP A;  1BM9 A;  3ZMV A;  1FOK A;  5JFR A;  5D6F A;  4RAZ A;  4EM2 A;  2HKO A;  1R23 A;  1Z05 A;  1U5T C;  3QAH A;  4RAY A;  1Z7U A;  1LDD A;  2CQK A;  1P2F A;  4IPA A;  1LEB A;  3CJN A;  3J7A O;  3MZH A;  4EM1 A;  3RPU A;  1O3Q A;  1I6X A;  3J81 K;  3DP7 A;  3P9I A;  1REP C;  1PDN C;  3QPT A;  2OU2 A;  3HTU A;  3HRM A;  1TLH B;  4RGU A;  2IP2 A;  3EYI A;  2DFI A;  1D5V A;  2RVC A;  2M5W A;  4IRG A;  1HW2 A;  4PCQ A;  1BOA A;  1MGT A;  4MGR A;  3VB2 A;  2K4J A;  2FEZ A;  1FT9 A;  3C18 A;  5D8K B;  1YG2 A;  1ON1 A;  3GEZ A;  1KU3 A;  1T6S A;  2QQB A;  3U1D A;  5CVI A;  2VT3 A;  4EJW A;  2NNY A;  1UST A;  2A68 F;  2KIF A;  3BRO A;  2HWV A;  3CTA A;  1XMK A;  2QBY A;  2QYO A;  2RC4 A;  4ZYE A;  4Q5S F;  1UCR A;  3HRT A;  4YFN F;  5F1R A;  3KP2 A;  1PUE E;  1XMA A;  2DO7 A;  2MBF A;  3GFJ A;  2HYF A;  4HLY A;  1TNT A;  1YW7 A;  1CF7 B;  2OA4 A;  4PGG A;  3HOT A;  2EA4 A;  1W5S A;  4BHB A;  1EH7 A;  1F9N A;  2DW4 A;  3R60 A;  5BOX A;  2GXB A;  2HDC A;  2J5O A;  1U3E M;  5BPD A;  2D1H A;  5FD6 A;  1HW1 A;  4YFK F;  4WCG A;  2O3F A;  2VBY A;  2PBI A;  3VFZ A;  3FX3 A;  4ZYD A;  3IRQ A;  4UVA A;  2MH2 A;  2L01 A;  3E97 A;  3WE3 A;  2F5F A;  1W7P D;  1USS A;  1HW5 A;  2GIV A;  1IF1 A;  4A0X A;  1Z9C A;  3CUQ A;  1T2K A;  1T0F A;  3COA C;  1YW9 A;  3WOD F;  3T8R A;  3K1N A;  5A2Q K;  1YFH A;  2IA0 A;  3F21 A;  1JGS A;  1ZRE A;  2XV4 S;  1FWZ A;  1RUO A;  3TDZ C;  3TDU C;  4ENN A;  2HS5 A;  1ZRF A;  2XRO A;  1XB4 A;  2VBW A;  3CO6 C;  5FGM A;  3ZPL A;  3F8F A;  1V3F A;  3W6K B;  2W85 A;  5CVJ A;  1BIB A;  3I71 A;  4KIC A;  2QUF A;  3F8B A;  3OV8 A;  2YX7 A;  4KIG A;  3QU6 A;  4ASN A;  2TDX A;  3IHU A;  1E17 A;  1YS6 A;  2KIM A;  5L3E A;  1IN5 A;  2G7U A;  2VOD A;  2P6S A;  4TV7 A;  3HIF A;  3RKX A;  5HLG A;  4M72 A;  4UUV A;  4JK1 X;  3EQL F;  1EH8 A;  1U2W A;  1MJA A;  4A5M A;  1OPC A;  5JR3 A;  2QLZ A;  5ILU A;  2XGX A;  5FB2 A;  3N4M A;  2FE3 A;  2M1B A;  3C3W A;  3H3U A;  4OMY A;  1MDM A;  1T39 A;  1I27 A;  1UHW A;  4H0E A;  4HX7 A;  1S7O A;  3F8M A;  3GLX A;  1ZG5 A;  2L02 A;  2F5C A;  3BDD A;  4MQV A;  1BI0 A;  3K1M A;  5K5Q A;  4KN7 X;  4HF2 A;  5CLS A;  1OR7 A;  4R1H A;  3CUO A;  3F22 A;  2MLG A;  1WSU A;  2Z99 A;  2ZME B;  3TO6 A;  3V7S A;  2PN6 A;  1EH6 A;  1T98 A;  3V8L A;  1LDK B;  3W6J B;  4KIB A;  3KP5 A;  3RDI A;  1WQ2 A;  1KGS A;  4P55 A;  3FF5 A;  1F4K A;  2A07 F;  1ZGJ A;  4OIP F;  1SFU A;  1R58 A;  4L9T A;  5AON A;  4MTE A;  1KU7 A;  2QQA A;  5J6X A;  1FC3 A;  4BXU A;  1R1V A;  2KRF A;  2V9V A;  2K27 A;  4EJV A;  2EK5 A;  5LGU A;  2K4B A;  1YW8 A;  5LGT A;  5HS9 A;  3F8C A;  3R6S A;  5TRD A;  2IVM A;  1R1U A;  5DUK A;  2DPD A;  2O61 A;  2VON A;  3RTR A;  4A12 A;  3SXY A;  4RGS A;  3BOQ A;  4AIK A;  4A2U A;  4IHS A;  1BBY A;  2DK5 A;  1WRJ A;  4KFC A;  1W7P A;  3RIR A;  1FBQ A;  5DCF A;  4KN4 X;  2Q8K A;  5ICF A;  1DPR A;  5ICC A;  4KT5 C;  3SFZ A;  5HDK A;  1O3R A;  1U6G A;  1QPM A;  2IW5 A;  1IN7 A;  2L4M A;  3O2P E;  1TQP A;  3ZQ7 A;  4BQA A;  1O3T A;  4P5O A;  1I5Z A;  4G9Y A;  4HF1 A;  3LA2 A;  3MZY A;  2LF7 A;  2YPR A;  2ZKZ A;  1FP1 D;  1FSH A;  3GO5 A;  2ZCW A;  2H09 A;  3V7R A;  1TBX A;  1YLF A;  1R5G A;  3FMR A;  3JAM K;  3ERE D;  1G3S A;  2M8E A;  3WTX C;  2G9W A;  1W4M A;  4AVP A;  2MA3 A;  5BMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...