2LF8A

Intramolecular regulation of the ets domain within etv6 sequence r335 to r458
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor ETV6
molecule tags Transcription
source organism Mus musculus
publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf8A01
3ABTA 4YIIA 5J6XA 2ACJA 4WWCA 2HTSA 4HDUA 2IA2A 4I0AA 1ZYRF 2EFNA 2ESHA 1FNNA 2A3SA 1P6RA 2RC4A 1ZAOA 4KIGA 4XSZF 5D5XB 1P4XA 1TQMA 4EGYA 3WE2A 1EH6A 4EV0A 4HV5A 1C0WA 2IP2A 3U1DA 1WQ2A 2RKHA 3HSEA 1YO5C 1RUOA 4P5OA 1XGMA 3TOBA 3ZMTA 3CUQC 4K2EA 1FBQA 2XASA 4HLYA 1BOAA 3ZP5A 2OAZA 3F21A 4L9VA 3TOAA 4ENKA 5FB2A 2IPQX 3ECHA 3Q9SA 4A2UA 3ZMVA 2NYXA 3BDDA 3KP5A 2AS5F 4M9SA 4YG2F 2MLGA 2D1VA 1Y0UA 4HF1A 4ASNA 3V4GA 4L5IA 1JGSA 1TQIA 2VBYA 2VOPA 1FLIA 1Z6RA 5BQTA 1R23A 1HSJA 4BYYA 2FOKA 1IN6A 2HOEA 3E5UA 5ERIA 4EQQA 3L2CA 3G73A 3DXJF 5DUIA 3WODF 2G9WA 1S7AA 4JBAA 1R7JA 4BHCA 1MGTA 3RKYA 1W5TA 3ROUA 1V4RA 5IT3A 4KUMA 4M71A 3GZ6A 3WGHA 3LSTA 3WGGA 1XMKA 2DI3A 2E7WA 4Q48A 3BPVA 5BPDA 2EFPA 3HRMA 2RGVA 1QPMA 3WG9A 5BS6A 3JTGA 3CO6C 3HHHA 1K7AA 2GA2A 1IN4A 4OOIA 3WU0A 2WV0A 1GXPA 2CWEA 3JW4A 3R60A 2BBYA 5HDNA 1KA8A 4MEXF 4MQ9F 5FD5A 1SFEA 3R6SA 2V79A 4GYGA 5A2QZ 4RGRA 4A5NA 4AIKA 4IHSA 3K0LA 3F22A 1GXQA 3GLXA 5LGNA 1UHWA 1IF1A 2J5PA 4RS8A 2K7LA 3GEZA 2XAJA 5L3FA 5DCMB 1NHAA 1DDNA 1WSUA 5FLXZ 3I59B 1B1BA 3I54A 3FXUA 2DBBA 3MFKA 3ELKA 2VC1A 5LGUA 3KEOA 2XKPA 4HLXA 4M9ZA 2E1NA 4HDVA 1BIBA 5ICEA 3ZMUA 3KFWX 1PP7U 2RQPA 2OBPA 4RGXA 2OA4A 2KKOA 1ON1A 1I1GA 2IA1A 2PQ8A 4OMYA 4MNUA 1U5TA 3KLOA 4IF4A 4KA4A 4LG0A 2H09A 1SAXA 1QQIA 4U0VA 3CO7C 5DEQA 4S05A 2CFXA 2P7CB 4OMZA 4RAZA 2JT1A 4L0ZB 2DO7A 2HGCA 3MEXA 4KT5C 1U5TB 4XRFA 4ENNA 3FWEA 5FD6A 4JQFA 3K1PA 1XCVA 2VBXA 5LHIA 5ED4A 4Y17A 4FX4A 5ILVA 1IRFA 4PDKA 2XAGA 3JSOA 2FF4A 3V8KA 1YLFA 3NQOA 4YFXF 2CYYA 2K86A 2O03A 2FA5A 2GQQA 3GFJA 3RJPA 2ZCWA 2XAFA 1YG2A 4DNCA 1YW7A 2IRFG 4G94A 1AOYA 2ZJ2A 2HKOA 1O57A 2EA2A 2ZNYA 1ON2A 1JHFA 2PN6A 2ETHA 5L3EA 1T38A 3KZZA 2DU9A 3F8MA 5KVRA 2WC2A 1U6GA 2Z9OA 1RUNA 1TQPA 1LQ1A 1RIOH 1HSTA 4MHGA 3J7AO 2HZTA 4HYEA 2O0YA 1O7LA 5DD8A 5K5RA 1TNSA 2Z33A 5DUKA 4WCGA 3VB2A 3U9GA 1FBUA 2WTEA 3BP8A 2STTA 4U88A 4RGUA 4RB1A 1ZRDA 5CVVA 3V7RA 1R5GA 2YPRA 4BXUA 2R7FA 3W6KB 2NNNA 6PAXA 1HKSA 5IT9K 1QO0D 1T39A 2KIFA 1Z9CA 5HDGA 1DPRA 2EWNA 1IW7F 5FFXA 3CLOA 4U0YA 1HQCA 4G8XA 1FSHA 4HF0A 3IC7A 3JAMK 2LSOA 4WXDA 4UV9A 2H94A 1O3SA 4AVPA 2NNYA 1MDMB 5AIQA 4LLNA 3E6BA 2HDCA 1I1SA 2XKOA 3RYPA 3IRQA 1OYIA 2LF8A 2YX7A 3KETA 2VONA 4HAMA 5BMZA 1W7PD 1I27A 1JXSA 1XGNA 3PQJA 5JR3A 1SD5A 2FEZA 1XN7A 4G7HF 2JPCA 3EYYA 3FM3A 4RB3C 3NRVA 4E70A 2NAZA 2OQGA 1FZPB 1SD4A 2FNAA 1ZRCA 2DLLA 2UZKA 3B02A 1U3EM 3GWZA 1D3YA 4EMSA 1S7OA 1R1TA 4NQWA 4OIQF 2KJBA 3GF2A 2LF7A 1BC7C 4O3MA 2GAUA 5D6EA 4M9XA 5L3DA 3TO9A 4OIOF 2Y75A 4CXFA 3BJAA 2ISYA 2EV5A 4CYDA 1R36A 4UHTA 4LFUA 1G4DA 3FX3A 1QGPA 4FT8A 3WTXC 2QWWA 2K4BA 3ZN1A 3V8JA 5HLHA 5H6RA 4MTEA 5EEGA 2EFQA 4IRHA 2XVCA 2GXGA 2O8XA 2E1CA 2TDXA 1K78B 4EJTA 2VOOA 2CQKA 3ECOA 2IA0A 2M30A 4L18B 3H3UA 4LG0B 5D6FA 4WK8F 3WTTC 3HYIA 1MZBA 4WX9A 3SQNA 4A0ZA 5F64A 1BI1A 3BZ6A 4KN4X 3ZQ7A 2A68F 1HKTA 4ZH4F 2HQNA 1IN8A 3HOTA 3I4PA 2LNBA 1XMAA 1K79A 3IKTA 1F1ZA 4KNYA 4ZYEA 4LK0F 5J8CA 1G3YA 3HSFA 4A6EA 3HHGA 1KU3A 1R58A 4EJWA 2IT0A 1DUXC 2F5FA 4D0PA 4KMUX 1UFMA 3E5QA 2XIGA 3M8FA 1IRGA 3KP6A 3F72A 2F5DA 5CVIA 1G3SA 2CW0F 2EJRA 1WI9A 3C7JA 1Z1DA 3JTHA 3KEQA 2STWA 4EM0B 3C18A 3HSRA 1XGOA 3IHUA 2VE8A 4I09A 2NS0A 3RDIA 3GFIA 1HBXG 3R61A 2K4JA 4PGGA 2PMHA 2PBIA 4KMFA 1G3WA 5CLSA 2IVMA 3BJOA 1EH8A 2XROA 1K6OA 2FQ3A 3U2RA 1FSEA 1O3TA 1YS6A 3I71A 2G7UA 3QOPA 4O6JA 1BN5A 4MQVA 3LFKA 4KDPA 4Z2YA 3DPTA 5JVTA 5H6QA 1L3LA 5D5VB 3CJNA 3TDUC 2DQRA 2A5YB 3WTZA 2Q8KA 2EB7A 3D0SA 4YIFA 2GXBA 2ZMEB 3WTVC 1FP2A 1JE8A 3VOEA 1J9IA 1I5ZA 2D2WA 4N0BA 5FLXK 3F8FA 3IWFA 1HXDA 1U8RA 3KCCA 2PFBA 3RYRA 4PCQA 3BWGA 5JFRA 2P5LC 1VTNC 3MWMA 5ICFA 3GZ5A 1WKMA 4LJZF 2ZXJA 1FX7A 1ZG3A 3FHZA 3DF8A 3QU6A 2DW4A 1B4AA 5E8GA 4HX7A 3FMSA 2EFWA 1BI2A 4ETSA 1RNLA 1XB4A 1REPC 3F3XA 2FNPA 1KQ9A 3KLNA 1CGPA 1Z91A 1W7PB 2HTJA 4CO8A 1HW1A 5D8LB 4XLNF 1OMIA 3WTWC 3EQLF 2XGXA 3ERED 3N97A 1X3UA 1MJBA 4MEYF 4OINF 2QVOA 2DQLA 3RKWA 4G6QA 2C6YA 1ZRFA 3BY6A 3GO5A 5LRSA 5HDKA 3HOSA 5E17F 3LWFA 5K1YA 5AIPA 2UWMA 2A69F 3N4MA 3EDPA 2RDPA 2NRAC 1BI3A 4KYWA 4IHTA 3F23A 5DCMA 3P9KA 2A07F 1KQ8A 2FU4A 4QLCU 5L3BA 1HW2A 5KK1A 1B59A 4EM2A 2WWYA 2ZNZA 2DAOA 2VXZA 3CUOA 2JZYA 3SZPA 2EV0A 4EM1A 3BOQA 4U7DA 1YTYA 1G6NA 1XDSA 2GIVA 1T6SA 1LNWA 3HUGA 4RAYA 4UVCA 3HIFA 3KP4A 1IUYA 2JSCA 2XRNA 3FMQA 2R3SA 3EYIA 1S6LA 3LQQA 4OIPF 4UVBA 5HLIA 3GXOA 5LLQA 1YFHA 1DPUA 3OOPA 1H9GA 4A12A 2O6GE 2M87A 2PEXA 1TBXA 2VN2A 3T8TA 2BGCA 1XD7A 1ZHFA 1F5TA 3FZVA 5JI6A 2FBHA 5E8IA 2QYOA 1ZN2A 1LJ9A 2P8TA 3COAC 4Y15A 5ILSA 2W84A 5K5QA 3QPTA 3RPUA 2MD5A 1FOKA 4AWXB 1U5TC 1DP7P 3LA3A 2PG4A 2DFIA 4A5MA 2DK8A 2FMYA 5E20A 1U78A 5LBQA 2G7HA 1W4MA 2DT5A 3IL2A 3SXYA 1ZGJA 5FGMA 3MAJA 4CICA 4AIHA 4HX4A 2ADUA 2CGPA 1HW5A 4R8HA 1YIOA 3TO7A 3Q5FA 5K5OA 3W6JB 3V8LA 4U0WA 1FC3A 3TO6A 3ML6A 3G3ZA 4RGSA 2VODA 1J59A 2VT3A 3ABUA 2CG4A 5LEJA 1TLHB 5D4RA 2QENA 5DV5A 1G3TA 2HQRA 1YS7A 2RNJA 4IPAA 5HOOA 3IWZA 1FT9A 2QBYB 4IXAA 2P7VB 5J8FA 5DD4A 4CZZA 4ESJA 4A0YA 3JSPA 3V7CA 3ZN0A 2KIUA 1IZ1A 4I0BA 5CYVA 2O3FA 4N9HA 2L3DA 2P5VA 1OR7A 3Q9VA 4L9TA 1ZGAA 2XUBA 3WTSC 4UVAA 2M45A 3E5XA 2V6CA 4Q5SF 2GA1A 2HR3A 4OIRF 3RTRA 5FFZA 4ENJA 2DPDA 1IXCA 2LKPA 4EVIA 3C3WA 1FPQA 2BYVE 3T5XA 4EJVA 3FXRA 5DCFA 3I64A 4IJAA 3QAHA 5FO5A 4ESBA 1KQ0A 2YR2A 4ON0A 5AONA 4JK1X 2ELHA 1KYWA 4KFCA 5D5UB 4EJUA 2IW5A 5F6FA 4A0XA 1J7KA 3WTYC 1XCBA 2BE5F 4P55A 1QBJA 1BM9A 1TNTA 4U7BA 1R1UA 3K2ZA 5EEHA 1P2FA 1KGSA 2Y0MA 3QRFF 1USSA 4F7ZA 5F1RA 4GGGA 1LVAA 1E17A 4NB5A 1PDNC 1OPCA 2LDUA 3I5UA 4KIFA 4HX8A 3KP2A 2GWRA 1H9TA 2DPUA 2MH9A 4P9UA 4M6YA 2QLZA 5D4SA 1SFUA 4N9IA 4M6XA 4HV6A 3LQRA 4BAYA 3JAMZ 2JRTA 4UUVA 1W7PA 2VBWA 1F9NA 3RPQA 3M1EA 2D45A 1ZREA 1SMYF 3O6BB 3K9TA 4BHBA 2H27A 3FF5A 3J80Z 3LAJA 3F8NA 3KP3A 3QP5A 1FP1D 2OZUA 2PMUA 1CF7B 5CVRA 1MD0A 5IT9Z 4UNOA 4AIJA 3CUQA 1S8NA 1LB2A 1S29A 4OU0A 5LRRA 3WTUC 1BIAA 4EGZA 1I6XA 3ZMDA 5TRDA 3L7WA 1IAWA 2GZWA 3NEUA 1STZA 5D8KB 3M8EA 3CUQB 5CVJA 1ONVA 2YU3A 4I2OA 1HKQA 2Y48A 4HOBA 4ZYGA 3E6CC 4LMYA 1XSVA 2CSOA 4R79A 5LHGA 3MZYA 2DK5A 2EK5A 3M9AA 3MZHA 3DFGA 4BH9A 2J5OA 5DYMA 1OYWA 4WXHA 2H6BA 2V1UA 1FWZA 5E1XA 2O61A 4EJOA 2MC3A 3V7SA 4GYIA 4S04A 2Q0OA 4L9NA 3MCZA 4CDGA 3QP6A 2XHKA 3CTAA 2FXAA 2HYGD 2ZMEA 3J81K 2QZ8A 4M72A 3EUHA 1R1VA 1FBSA 1MJAA 4O5VA 2PLYA 2MLKA 2FMLA 3RIRA 5ILUA 2M1BA 4ESFA 1ZLKA 2HKXA 3F6VA 4P96A 1S3JA 1BI0A 3REOA 1MJ9A 4LB5A 5E1ZB 2F2EA 1W5SA 1BC8C 2QQ9A 2XAHA 4M73A 3VODA 3F8BA 4HQEA 5LEKA 4GXOA 1R5HA 1IXRC 3DP7A 1LEBA 3J80K 1Z7UA 4HF2A 1RI7A 1T0FA 2RVCA 1GHCA 2P5KA 3T0YA 1TTYA 4HA8A 1XSDA 1Z6TA 2OQRA 1A04A 3K1NA 1D5VA 3KP7A 3R0JA 3L9FA 3WGIA 1ZG5A 3HRTA 4PZJA 4WXCA 3E6DA 4BHPA 4I01A 2FE3A 2X4HA 1TW3A 1SFXA 2L54A 2FSWA 1ZG1A 5L3GA 1GVJA 5E1WA 1LDDA 3I58A 2V1DA 3MQ0A 4LK1F 5HS9A 2RN7A 3H92A 5CVUA 2XAQA 3B73A 4IRIA 1WWXA 2RV8A 3F8CA 3SZTA 4XSXF 1D8KA 1O3QA 2L01A 4TV7A 4BNCA 2A6HF 4G7ZF 5ICCA 1KU9A 1KU2A 1QZYA 5JHUA 3ISPA 1YQAA 2L4MA 2QM3A 4MGRA 2W85A 4LD5A 4LLGF 4AD9A 3WE3A 2X0LA 1YW8A 4LB6B 1QNTA 4YFKF 2MA3A 3VFZA 1ZH5A 2OD5A 3HTUA 1P4WA 1P4AA 1ZARA 2MH2A 1ZLJA 1EV7A 3LA7A 4KIBA 3GFLA 4CHUA 1FYLA 3M7GA 3SFZA 2A61A 1B9MA 5DDGA 3WU1B 4G7OF 2M8EA 4L5JA 3DV8A 4PGHA 4P9FA 1TW2A 1FYMA 4G9YA 2JTVA 4HW0A 1QZZA 3LA2A 1MDMA 3F6OA 3K69A 4G6DA 2ZO4A 2BEOA 1J2XA 2K02A 1BBYA 3HTSB 3H3ZA 3FMRA 2VC0A 3O2PE 3FM5A 1Z05A 4LGWA 2D1HA 3S2WA 1Q1HA 1LDJA 5HVQC 3O3KA 4FHTA 4CGZA 3IKVA 3E3VA 3GX4X 4HQMA 2W25A 2KJCA 1EH7A 3R4KA 1IN5A 4IRGA 1UHMA 2VT2A 1OKRA 4KN7X 3BROA 1V3FA 2L02A 1SD6A 1F4KA 1JHHA 2QQBA 2P6SA 4WF2A 2F5EA 3L09A 3OV8A 2M5WA 1FYKA 3HRUA 3RI4A 4UV8A 1P92A 1B9NA 2Z5UA 3QPHA 2Q2EA 2DTRA 2F5CA 3GW2A 1KU7A 2COMA 2EV6A 3RKXA 3T8RA 2EA4A 1AWCA 2P4WA 2IJLA 3KZYA 4M74A 1UB9A 3DPLC 2ZFWA 5E18F 2QBYA 3E97A 3GFMA 3TDZC 3DKWA 3ZMSA 5HLGA 3AAFA 3GUDA 2OU2A 1XSXA 2ZKZA 2Z3YA 4YFNF 4ZYHA 4ENMA 5ICGA 1O7FA 4B8XA 4BQAA 3ZMZA 2H6CA 5LHHA 1SD7A 4DQ2A 1USTA 2JPBA 3L00A 3SHFA 4RB0A 3EETA 1LDKB 3J81Z 3ULQB 4MTDA 3CDHA 4L9JA 2HWVA 1LEAA 2MBFA 1YW9A 2EFOA 1BJAA 1U2WA 4L0YB 1K78A 2KRFA 1D8JA 3PQKA 5A2QK 1E2XA 3IRRA 1L0OC 2CO5A 5HS8A 1KYZA 2VBZA 3FXQA 1O3RA 3P7NA 2HEOA 4IVNA 4Q4ZF 1XDUA 4ZZDA 1J5YA 4Y13A 4UXNA 4HBLA 4RB2C 1XGSA 2ISZA 3HRSA 4ZZLA 1YYVA 2K27A 2HFHA 4ZYDA 3E6MA 3I59A 3ZPLA 1PP8F 4HZFA 5CJ9A 1T2KA 1R22A 1MKMA 4B09A 2FBKA 3KE2A 2HS5A 1J0RA 3DEUA 5LGTA 4Q47A 2BV6A 2YSRA 4GCVA 2W24A 3TQNA 3PFIA 2OZ6A 2KIMA 1OYYA 1WRJA 2HYFA 3BPXA 3TKYA 1CF7A 2P6TA 5BOXA 2FBIA 2UXNA 2R7DA 2FRHA 4A6DA 2PI0A 1RZ4A 4QWQA 4H0EA 2QUFA 2QQAA 2VE9A 2V9VA 3P9IA 3K1MA 3QU3A 5H20A 3R0AA 4I02A 2YX4A 3LAPA 3C1DA 2V1XA 2B0LA 5L3CA 1IXSB 1SMTA 4NHJA 4XLPF 4KICA 4I7HA 3D5LA 1ULYA 4R1HA 2E7XA 1T98A 1H0MA 3GVAA 1B6AA 5D5WB 1J75A 4XBFA 2AXLA 4I98B 3GYHX 2A6EF 2PJPA 3TGNA 2XV4S 2ESNA 3VEPA 3DQVC 1ODDA 2W57A 5BPIA 1PUEE 2UXXA 2L4AA 3P9CA 1UCRA 1FY7A 4FX0A 4GO1A 2Z99A 2ZBKA 5HS7A 3BJ6A 3I53A 3T1BA 1R00A 4LLLA 1IN7A 5TJJA 3I0TA
chains in the Genus database with same CATH superfamily
2EIMH 1U8BA 2IAIA 4DYCA 4BU2A 1B72B 3ABTA 4KITB 4YIIA 4YELA 5J6XA 3HOUJ 2ACJA 3M3YJ 2QF7A 4WWCA 2DA7A 2HTSA 4HDUA 5J3LA 2IA2A 1E3PA 4OWRB 4I0AA 3VYUB 2ICWG 1ZYRF 2EFNA 2MGQA 2ESHA 1X3ZB 2V7FA 3K6GA 2Y31A 3RQ4A 1FNNA 4XR6A 2A3SA 4ZTJA 1P6RA 2DDAA 1RPWA 1S5LC 1ZAOA 2RC4A 2CQXA 2KFDA 2M4GA 3B6AA 4XRSA 4KIGA 2B63J 3NARA 4UY8I 2EINH 3K4BA 4XSZF 3BLYA 5D5XB 1P4XA 1TQMA 4NQWB 4EGYA 3WU2C 3WE2A 1EH6A 4EV0A 3K70D 1FMVA 4HV5A 1C0WA 3BTLA 2IP2A 3U1DA 2VKEA 1WQ2A 1B72A 1MBJA 2QKMB 4C3IJ 3GTMJ 4CA0A 2RKHA 3HSEA 1NK2P 2DA4A 3BTCA 1XC5A 4PFPA 1YO5C 1RUOA 1VQ4I 4P5OA 1XGMA 3VPRA 3TOBA 3ZMTA 4BDZA 4II2A 3CUQC 4K2EA 1FBQA 3CC2I 2JSPA 1TWAJ 2DTZA 2XASA 1JTYA 2EH3A 4HLYA 3S17J 2Z1DA 1BR1A 1BOAA 2KDZA 3ZP5A 3AKZA 3HBLA 4QTRA 2OAZA 2DFHA 1X4OA 3F21A 2HVQA 4L9VA 3TOAA 4ENKA 5FB2A 2IPQX 3ECHA 3Q9SA 1JUSA 4A2UA 3G1LA 3PUFA 3OYKA 3G1OA 5FKMA 3ZMVA 2XPWA 3J7ZI 5CPRB 2NYXA 3BDDA 3KP5A 3HGYA 3TEDA 2AS5F 1QPIA 1V5FA 4IQ4A 2DT6A 4M9SA 2MLGA 2VQHA 4YG2F 2D1VA 4MIMA 1U9NA 3K7AJ 1Y0UA 3OYHA 3BR6A 4HF1A 2H1LA 4QPOA 2ZSHB 4XONA 4FE4A 5FJ8J 2NVYJ 4ASNA 3V4GA 4L5IA 1JGSA 1TQIA 5TISC 2E2HJ 2VBYA 3G4SI 2VOPA 1FLIA 2VKDA 1Z6RA 4EEFG 3K4CA 1JUPA 4LIVA 5BQTA 1R23A 4NUBA 1HSJA 2VQLA 2FOKA 2LYCA 2Z16A 1IN6A 4BYYA 2HOEA 3E5UA 3CCEI 5ERIA 4EQQA 2DOAA 3L2CA 4XN0A 3G73A 3DXJF 4A3FJ 5FKNA 2VJ4A 2XPVA 5DUIA 3WODF 3KYDB 3OYGA 2G9WA 1YE9A 1S7AA 3FXLA 1Y56A 4JBAA 1JJ8C 4ZDPA 1R7JA 4BHCA 1MGTA 3RKYA 5CQGA 1ETOA 1W5TA 4B47A 2ZJRF 2L9VA 2X1EA 3GTLJ 3ROUA 1V4RA 3S8PA 5IT3A 1OCOH 2Z2SB 4IOCF 4E7ZA 4KUMA 4M71A 3GZ6A 1GT0C 3WGHA 3OSFA 2M9HA 1Z67A 2XAUA 3LSTA 3WGGA 1XMKA 3VSLA 2DI3A 1DGWY 2E7WA 2OCEA 4Q48A 3BPVA 5BPDA 2EFPA 3S2DJ 3HRMA 4KJZA 2RGVA 4XIDA 1QPMA 5GPAA 3WG9A 5BS6A 3VWBA 2CV0A 3JTGA 3CO6C 3HHHA 1K7AA 2GA2A 2COBA 3B6CA 2HYJA 1OCZH 3Q0UA 1IN4A 4OOIA 3WU0A 4ZDOA 2WV0A 1Z7LA 3W2VA 4F93B 1GXPA 3H9QA 2K9MA 3LSJA 2W1OA 2CWEA 2M0MA 4HEA2 3JW4A 3IH4A 3R60A 5IP9J 2BBYA 1K6YA 5HDNA 1KA8A 4MEXF 4MQ9F 5FD5A 1SFEA 2LLKA 3R6SA 2E36A 2V79A 3BQZA 4GYGA 2CQNA 1R4MB 5A2QZ 2AQEA 4RGRA 4A5NA 5HNHA 2JA2A 4AIKA 4IHSA 3K0LA 3F22A 1GXQA 3GLXA 3W2AA 5LGNA 1UHWA 1IF1A 2J5PA 4RS8A 5JLWA 1IC8A 2K7LA 2RREA 3GEZA 3S93A 2IGOA 2XAJA 4MO7A 5L3FA 5DCMB 1NHAA 1DDNA 2X1DA 1WSUA 5FLXZ 5EG0B 2VJIA 3D5SC 4D7NA 1J09A 3I59B 5DS9A 1B1BA 2XRLA 3I54A 2F4OB 3FXUA 2DBBA 2X6OA 1JI8A 9ANTA 3MFKA 3ELKA 2VC1A 5F08A 2JMWA 2FD5A 5LGUA 3ZQHA 2YU9J 2MABA 2V6EA 3TP0A 3KEOA 2XKPA 2CQ7A 1EF4A 4HLXA 5EGOA 4M9ZA 2E1NA 4HDVA 1BIBA 5ICEA 3ZMUA 3KFWX 4Y52J 4J01A 1PP7U 2RQPA 2OBPA 4RGXA 2ZXWH 5GAHJ 2OA4A 2KKOA 1ON1A 5M3MJ 3OYDA 1I1GA 2IA1A 2PQ8A 4OMYA 4MNUA 3FBIB 1U5TA 3CCYA 3KLOA 2HI3A 2KLOA 4IF4A 4KA4A 1MH3A 1WI3A 2H09A 4LG0A 4BUPA 1SAXA 1QQIA 4UB6C 1LFBA 4U0VA 3CO7C 5DEQA 4S05A 2CFXA 1R9TJ 2I10A 2P7CB 4OMZA 4RAZA 4BEHA 2JT1A 1GV5A 4L0ZB 2DO7A 2QEXI 2HGCA 3MEXA 4BACA 2H1KA 3S3OA 1TWGJ 1U5TB 4KT5C 4XRFA 4ENNA 3S1QJ 3FWEA 5FD6A 2L9NA 4JQFA 3D5RC 3K1PA 3Q0WA 1XCVA 2DA1A 2VBXA 5LHIA 3QPLA 3VYRB 5EGOB 3AL0B 5ED4A 5GTIC 4Y17A 5EZHA 4FX4A 5ILVA 1IRFA 5EYRA 4PDKA 3RPUD 1S72I 4DIQA 2XAGA 2IXSA 3DLAA 5CKTA 3J7AY 2DA6A 2QKLB 2FF4A 3V8KA 3JSOA 1YLFA 3NQOA 4YFXF 2CYYA 3PM1A 2K86A 2O03A 3ZXSA 2FA5A 2GQQA 2VKHA 3GFJA 2PX9A 5EG0A 4XN3A 3RJPA 2ZCWA 2XAFA 3CMYA 1YG2A 4DNCA 1YW7A 4BEHB 1ZK8A 2IRFG 1BA5A 3JRIA 4G94A 1AOYA 3G2BA 1P7IA 2ZJ2A 2HKOA 3QPSA 3D1NI 1O57A 3HPHA 2DMPA 2EA2A 2ZNYA 1W1WE 1ON2A 1HCRA 5FRNA 1JHFA 1XS9A 2PN6A 2ETHA 1ENHA 5L3EA 2R7UA 1T38A 5B3SH 3KZZA 1ZR4A 2DU9A 2XGEA 3BG3A 4FISA 4IL6C 4LITA 3HGGA 1K61A 1XMXA 1TP4A 2F4MB 3F8MA 3ONQA 5KVRA 2Y9ZA 1DU0A 1IDYA 2WC2A 2CRGA 1U6GA 2L7KA 1X2NA 2ECBA 2Z9OA 1RUNA 4M3GA 4ABZA 1TQPA 1LQ1A 3OYEA 2YUSA 1RIOH 1HSTA 4MHGA 3J7AO 5J4VA 2HZTA 1LVKA 1RRJA 1JT6A 4HYEA 2O0YA 2LKSA 4E7JA 3M8JA 1O7LA 5DD8A 5K5RA 3CF2A 4XNFA 1P7JA 1TNSA 3K70C 4B4CA 2Z33A 2VQCA 5DUKA 4C2TA 3A01A 4WCGA 4KISA 3VB2A 2K3PA 2V4JC 1FBUA 2WTEA 3BP8A 3U9GA 2L0KA 2JK3A 3ABKH 2STTA 4J00A 2KL4A 3H35A 1VFCA 4U88A 4RGUA 4RB1A 1ZRDA 5CVVA 3V7RA 1F43A 1R5GA 2DMQA 3QYFA 2YPRA 4LOCA 4BXUA 2XSDC 2R7FA 3W6KB 2NNNA 6PAXA 2BXZA 2Q2EB 1HKSA 5IT9K 1QO0D 5FROA 1T39A 2KIFA 1Z9CA 3CESA 5HDGA 1DPRA 3GLLA 1W36D 2LR8A 1W0TA 2IS6A 2EWNA 1WZ2A 4XK4A 1IW7F 3HPGA 5FFXA 2JQ7A 3CLOA 4U0YA 1HQCA 2BY1A 1PUFB 4G8XA 2FQ4A 1FSHA 3MKYB 2MFZA 1ETXA 2E60A 3JRDA 3A4CA 4HF0A 4W1UA 2CW7A 3BR1A 3BQYA 3IC7A 3JAMK 4D5FA 5J1UA 1GV2A 2LSOA 4WXDA 3AG3H 2LOOA 4UV9A 2H94A 1O3SA 1RKWA 1YJNI 4AVPA 2NNYA 1MDMB 3KIOA 2ID6A 4RMNA 5AIQA 3AG2H 4LLNA 3E6BA 3MN2A 1Z0XA 4D7MA 2HDCA 4DOZA 1X19A 1I1SA 2XKOA 3RYPA 2VONA 3IRQA 1SAUA 1OYIA 3CJQB 2LF8A 2YX7A 4CCOA 1D1AA 3KETA 3L1PA 3CLQA 3LSHA 1K4TA 2CV2A 4HAMA 5BMZA 3OR2C 1W7PD 1MBEA 1FTZA 1Z77A 2KIQA 1I27A 3PO3J 2KP6A 1JXSA 1XGNA 3PQJA 5JR3A 3IUOA 1SD5A 3GTQJ 2FEZA 2V26A 2E35A 1XN7A 4XKBA 4G7HF 1NG7A 2JPCA 3EYYA 3FM3A 1MW7A 4F91B 4RB3C 2DA5A 3NRVA 1JKOC 3X2QH 2G0EA 1WVRA 4BKXA 4P1WA 4E70A 2NAZA 2OQGA 1D1CA 1FZPB 3TW7A 4MLOA 1SD4A 3P5JA 1SEUA 2FNAA 1ZRCA 1V54H 2L9RA 2DLLA 1YJWI 2UZKA 1Z3XA 3B02A 5IP6A 2CU7A 1U3EM 4BQOA 3CDIA 3GWZA 1D3YA 3HOWJ 3CMMA 4EMSA 1R71A 1S7OA 4PSXA 1R1TA 2CH0A 4GFBA 3OOUA 4NQWA 4OIQF 2KJBA 3QODA 3GF2A 3SYTA 2LF7A 1BC7C 5HNFA 3U21A 2EIKH 2GAUA 5D6EA 4O3MA 4M9XA 2E1MB 4CCKA 2E5NA 5L3DA 2E1OA 3TO9A 4OIOF 1VQLI 2MG4A 2H8RA 2Y75A 4CXFA 3GTPJ 2BXYA 3BJAA 2M7AA 2ISYA 1A5JA 2EV5A 2BY2A 2E2IJ 4DBRA 1ZELA 4CYDA 3HDDA 1R36A 4B43A 5F27A 4UHTA 2E34A 4LFUA 2AO9A 2K9LA 1G4DA 2DMTA 4C3HJ 3DKXA 3FX3A 2DMNA 1QGPA 4FT8A 4AVZA 4BY1J 3WTXC 1H8AC 2KRCA 2R0QC 3KPHA 2QWWA 2K4BA 3ZN1A 4C3JJ 1MMGA 3V8JA 4RLFA 4UUSA 1OJLA 3PL8A 5HLHA 2CUZA 5H6RA 1IRZA 4F3QA 4ZYAA 2JVHA 4MTEA 5EEGA 3HKZA 2IEKA 3H1CA 2EFQA 4IRHA 2XVCA 1Y6IA 2GXGA 2BVMA 2O8XA 2WB1A 4D1QA 2E1CA 2TDXA 5DTDA 1K78B 3TBIA 4EJTA 4BQQA 2VOOA 4FETA 3JRFA 2QCOA 3S15J 2CQKA 3ECOA 2IA0A 2M30A 4L18B 3H3UA 4LG0B 3C2HA 5D6FA 4IZZA 2R7VA 4WK8F 3ABMH 3J7YJ 3WTTC 4W97A 3HZJA 3HYIA 1MZBA 4WX9A 3SQNA 2CMPA 4A0ZA 1CQTA 5F64A 1BI1A 3BZ6A 4KN4X 4F92B 3ZQ7A 2IGNA 2A68F 3ZQFA 2TRTA 2HDDA 3H5NA 2D5VA 1HKTA 4ZH4F 2HQNA 4XICA 1IN8A 3HOTA 4B44A 3I4PA 2LNBA 1XMAA 1K79A 3IKTA 1F1ZA 2VJ5A 3DBHB 3ESWB 3LSKA 5EF6A 4KNYA 4ZYEA 2KQRA 2L5QA 4LK0F 5J8CA 1G3YA 3HSFA 3OL4A 4A6EA 5IP7J 3HHGA 1KU3A 3CCUI 4BJTA 1R58A 4EJWA 2IT0A 3OYAA 5E3MA 1DUXC 2F5FA 3M1CA 4D0PA 2LD5A 3AG4H 4KMUX 1LE8A 1UFMA 3E5QA 2XIGA 1W0UA 3M8FA 3S16J 1IRGA 4RA2A 4A3BJ 3KP6A 3F72A 2F5DA 2JJ7A 1M1EB 5CVIA 1K83J 1G3SA 2CW0F 2EJRA 1WI9A 4HNVA 3C7JA 1E3HA 1Z1DA 3JTHA 3KEQA 2UUZA 1D0YA 1LE8B 5KNLA 4E7IA 3I55I 2N8GA 2STWA 4EM0B 3C18A 3HSRA 1XGOA 4MFDA 3IHUA 2LVSA 2VE8A 4I09A 2DXIA 4A3IJ 1R6RA 2NS0A 3RDIA 1RC9A 4CZCA 4BE0A 3GFIA 2FUG2 1HBXG 3SEQA 2KHMA 3R61A 3I56I 2ECCA 3Q3SA 2K4JA 5GAEJ 1ETYA 4PGGA 2PMHA 2PBIA 2HOSA 4KMFA 3A03A 1JJ6C 1G3WA 3JCUC 1T0FC 3BCAA 1YRNB 1WCMJ 5CLSA 1LFUP 4JX5A 1SVLA 2IVMA 3OS2A 3PNYA 3BJOA 3H36A 1RESA 1EH8A 1UELB 2XROA 1K6OA 1HLVA 1FIPA 2FQ3A 4CUGA 3U2RA 1ETWA 4FCYA 1AKHA 1BR2A 3JRGA 1FSEA 1APLC 4PSWA 2NVXJ 3GBGA 1O3TA 1YS6A 3I71A 2G7UA 3QOPA 4M3BA 4O6JA 1BN5A 3M4OJ 4MQVA 5FKLA 3LFKA 4KDPA 3UR3C 4Z2YA 1TWCJ 4M3DA 1P9QC 1TWFJ 3DPTA 5JVTA 4I76A 4AU7A 5H6QA 1IV8A 1L3LA 2LREA 3FIWA 5D5VB 3CJNA 2X51A 3TDUC 2DQRA 2A5YB 2XPUA 3C2BA 5F0FA 3SFIA 3WTZA 2Q8KA 2EB7A 3D0SA 2Y69H 2KMUA 4YIFA 1WJDA 1Y0NA 2W82A 2GXBA 5KAIC 2ZMEB 3HOYJ 1D0XA 2O8KA 2M34A 3WTVC 1FP2A 1JE8A 3HJEA 3VOEA 1SC7A 1I5ZA 2D2WA 4N0BA 1J9IA 3CDLA 4AM3A 3CCJI 5FLXK 1E0EA 3RZOJ 4BJ6C 1AU7A 3F8FA 3IWFA 1HXDA 2P0WA 1U8RA 3KCCA 5E79C 4PFOA 2PFBA 3RYRA 2NVQJ 4PCQA 3U1KA 3BWGA 5JFRA 2P5LC 2KT0A 3MWMA 5ICFA 1VTNC 1FEXA 3GZ5A 4PJ0C 1WKMA 3LSMA 4LJZF 2ZXJA 1MNMC 1HDPA 3JREA 1FX7A 1ZG3A 3FHZA 3DF8A 3QU6A 2DW4A 2ELJA 1B4AA 2WY8Q 5E8GA 1KZHA 2HPMA 4HX7A 2IS4A 3FMSA 2P81A 3OYLA 2EFWA 3H9JA 4JX4A 1BI2A 4ETSA 2HU9A 3JRAA 5FLMJ 1RNLA 3VYTB 1XB4A 4A3CJ 1HOMA 4NC7A 5C3EJ 1REPC 3F3XA 1X1BA 2FNPA 3CMAI 4YIRX 2V9KA 1KQ9A 5HLTA 3KLNA 1CGPA 2VUMJ 3PO2J 5J1RA 1Z91A 2MD0A 1W7PB 3BG7A 2HTJA 4CO8A 1HW1A 4RM3A 2LG4A 5D8LB 4XLNF 3AL0C 1OMIA 3WTWC 4A3LJ 4C30A 2EPFA 2HXIA 3EQLF 1FTTA 2XGXA 2DFFA 3ERED 3N97A 1B8IB 2CQQA 3WG7H 4N4NB 4BBRJ 1DP3A 1X3UA 4E7KA 1WH5A 1MJBA 1POGA 4YRVA 4MEYF 1WJBA 2GM4A 2ZSIB 2IS2A 2X1CA 3KEYA 4B3XA 4OINF 5HODA 2QVOA 2DQLA 3CP8A 3BC8A 3RKWA 4DYRA 1BL0A 2ZC2A 1MMNA 4G6QA 2C6YA 1ZRFA 3BY6A 3GO5A 5LRSA 5HDKA 3HOSA 5E17F 3LWFA 3HM5A 2F48A 1XX5A 3EPZA 5K1YA 3FKJA 2XF7A 3K4JA 5AIPA 1VQOI 2UWMA 2A69F 3N4MA 3EDPA 2RDPA 5B5EC 4DZPA 2HXOA 4HNTA 3ZQLA 1QVTA 1D0ZA 4F52A 3DPUA 3QQAA 2NRAC 2XF6A 2K9SA 1BI3A 2CW8A 4KYWA 3HOVJ 4IHTA 3F23A 4JYKA 3CD6I 5DCMA 3P9KA 2A07F 4B3AA 1KQ8A 2OC6A 5J1YA 5E3OA 2FU4A 3A0HC 3Q0VA 4QLCU 5L3BA 1HW2A 5KK1A 1MBFA 1B59A 4EM2A 3OYNA 1K4SA 2WWYA 2ZNZA 3CF5F 2OJED 2R92J 4BE1A 2DAOA 2VXZA 1MNEA 3CUOA 1W5CC 2JZYA 3SZPA 2O7OA 2EV0A 4DYQA 4EM1A 3DEWA 1MBHA 4E6KG 2BOLA 1MH4A 3BOQA 3FK7A 4CYCA 4OAYA 4U7DA 1YTYA 4NBQA 1G6NA 1XDSA 2GIVA 4XLHA 1T6SA 2X9DA 4XL9A 4FE7A 3PIPF 1LNWA 4XMYA 3HUGA 4RAYA 3L2WA 3CQZJ 2F4IA 2EZIA 3CJRB 2RAEA 3HIFA 3KP4A 2NS8A 2EZLA 4UVCA 2PJRA 3H3VK 1IUYA 3ASOH 2JSCA 3CCQI 4IO9F 2XRNA 3FMQA 3V42A 2R3SA 3EYIA 2BW3A 1S6LA 2HVSA 3MD2A 4BQNA 2I8DA 3RSNA 3H9GA 3LQQA 1UG2A 2WBMA 3HOXJ 4OIPF 3VDXA 4UVBA 5HLIA 3H5RA 2WAEA 3GXOA 5LLQA 1YFHA 1DPUA 3OOPA 1H9GA 2PMZA 2NVTJ 1ETQA 4A12A 2O6GE 2M87A 4I6ZA 4H4KC 2PEXA 2R7WA 1WJ5A 1TBXA 2VN2A 3T8TA 3JRCA 2BGCA 3QYEA 1XD7A 2R7ZJ 3O8GA 2DA3A 3F9KA 3WHBA 1X1CA 1QHHD 1ZHFA 2DFEA 1F5TA 3FZVA 5JI6A 2LH9A 2FBHA 5E8IA 2QYOA 1ZN2A 2DDBA 1LJ9A 2P8TA 3COAC 4Y15A 2QSHX 3A1YA 5ILSA 2W84A 1O4XA 5K5QA 3DCFA 1QZEA 1BJZA 3QPTA 3HC7A 3RPUA 2MD5A 1FOKA 1ACIA 3LL7A 4AWXB 1JKRC 4AUXA 4CH7A 1U5TC 3HEFA 1DP7P 5M5YJ 2KDOA 3LA3A 5KHDA 2CFOA 2PG4A 2DFIA 4D9JA 1XTAA 4A5MA 4DGWB 2DK8A 2DA2A 3NWSA 5FKKA 4IX7A 2FMYA 5E20A 1U78A 4DW6A 2WAQN 4IEJA 5LBQA 1A36A 2MC4A 5K7HA 2G7HA 3A2KA 1W4MA 3VYSB 2DT5A 3PSFA 3IL2A 3SXYA 3IV5A 1ZGJA 5FGMA 2EBIA 2LRDA 3LSIA 3MAJA 4CICA 4AIHA 1Y8QB 4HX4A 4ITVA 2ADUA 3HL2A 1YI2I 2CGPA 4NDLA 2M8GX 1HW5A 4HSTA 4R8HA 1YIOA 3TO7A 1Q1VA 2AQFA 3Q5FA 2GLOA 1UHSA 5K5OA 2LFBA 3W6JB 3V8LA 1GLNA 1D5YA 4U0WA 2KZVA 1FC3A 3TO6A 1WFXA 3ML6A 3G3ZA 4RGSA 4UUSB 1AA7A 2VODA 4RAFA 1R5ID 1FOXA 1FOYA 1J59A 1ERDA 2EZHA 2VT3A 3IAS2 2W00A 4XLCA 2X6YA 3KYLA 3ABUA 2CG4A 5LEJA 4PJMA 2W7NA 1TLHB 5D4RA 2QENA 2CUJA 5DV5A 1G3TA 2HQRA 1OFCX 1YS7A 1BW5A 2RNJA 4IPAA 4PJNA 3FHNA 4V19K 1FMWA 3ABLH 5HOOA 3IWZA 4A3EJ 2VQGA 1FT9A 3H0DA 1F36A 2QBYB 4IXAA 2P7VB 5J8FA 3S2HJ 5JVGF 5DD4A 3G1MA 4BXFA 1T95A 4CZZA 3ZGKA 4ESJA 3S14J 4A0YA 1PVEA 3JSPA 4E4HA 2EILH 1G59A 3OWTA 3V7CA 3ZN0A 5J4YA 2KIUA 2JA7J 1IZ1A 4I0BA 5CYVA 2O3FA 4N9HA 1OQYA 1OCRH 2L3DA 2P5VA 1WJFA 2CV1A 3S1MJ 1OR7A 2X85A 3CZ6A 3Q9VA 4L9TA 2BY0A 3IAM2 1ZGAA 2XUBA 2EZKA 3WTSC 4E7LA 1Z21A 2DT7B 4LG3A 4OAZA 1I3AA 4UVAA 2XC7A 1BR4A 2M45A 3E5XA 2IGKA 2LY1A 2V6CA 1XPXA 1BW6A 5GP9A 1YITI 1T08B 5GADJ 4A3DJ 4Q5SF 2GA1A 4XOTA 2HR3A 3DTEA 4OIRF 3RTRA 5FFZA 3SEZA 4QPQA 4ENJA 1IXCA 2DPDA 2LKPA 3IH2A 4EVIA 3C3WA 1FPQA 3OYFA 5IYBJ 2BYVE 3T5XA 4EJVA 3FXRA 5DCFA 1UMQA 1VQKI 1SFKA 2DMUA 4HG2A 2PMZN 3I64A 2LK2A 4IJAA 5IY5H 3C2GA 3BZCA 3QAHA 5FO5A 4ESBA 1IDZA 5IPAA 1EJ9A 1KQ0A 2YR2A 4ON0A 3HXLA 2IS1A 2OPTA 5AONA 1YX3A 2LTPA 2YS9A 4JK1X 4RAGA 5CQEA 2ELHA 1KYWA 3PUBA 2X48A 4ANJA 2ME0A 4RM2A 3QOEA 1KONA 3TMOA 4KFCA 1XG1A 5D5UB 2UV1A 4EJUA 2IW5A 4XOPA 2WV1A 2ZJQF 1IJWC 4XORA 5F6FA 2ME6A 4A0XA 1J7KA 3WTYC 2NXNB 1XCBA 2BE5F 2BW3B 2WAFA 4P55A 1QBJA 1N75A 1BM9A 1TNTA 4U7BA 1R1UA 3K2ZA 5EEHA 1P2FA 1KGSA 2Y0MA 3QRFF 1SFOJ 4PJLA 1USSA 1N78A 1TT5B 4F7ZA 3I4MJ 3I4NJ 1Z3YA 5F1RA 1IRXA 3HUGB 3DBRB 1IG7A 4GGGA 3M07A 1LVAA 1X2MA 4CCJA 3MKLA 1E17A 2DOFA 3DTKA 2DCEA 5IYDJ 4NB5A 5TGTA 3MVPA 1PDNC 1OPCA 5EDNA 2W48A 1VQNI 2LDUA 3I5UA 3OYMA 4KIFA 4HX8A 3KP2A 2GWRA 1H9TA 2DPUA 2HPIA 3TL4X 2MH9A 2HVRA 4P9UA 4M6YA 2QLZA 1X3WB 5D4SA 1EA3A 1B8IA 2OF7A 1SFUA 4N9IA 2XDVA 1OLTA 3MKZA 4V2GA 4M6XA 4HV6A 3LQRA 4E7HA 1BOBA 4JOMA 4BAYA 3JAMZ 2K40A 2JRTA 3FXKA 1JGGA 4UUVA 4ZTFA 3H5AA 2JWTA 3CC4I 1W7PA 3TW6A 3JRBA 3BR0A 2VBWA 1F9NA 3RPQA 2L7FP 3M1EA 2D45A 1ZREA 1WGXA 4RDUA 1SMYF 2R4GA 3O6BB 3K9TA 4BHBA 2HDWA 2H27A 4X0GA 2I5UA 3FF5A 3J80Z 1WH7A 1X1DA 3ASNH 3LAJA 1RR8C 2JN6A 3F8NA 3KP3A 4LIUA 5C4XJ 3QP5A 3RKQA 5K7FA 1FP1D 1RKTA 3W2WA 2OZUA 2PMUA 3DBLB 1CF7B 5CVRA 4RLQA 1MD0A 5IT9Z 4UNOA 4AIJA 3CUQA 2FJ1A 3BT9A 3E7LA 2VPRA 3ZQIA 2KRHA 4X1EA 1RR7A 1S8NA 1LB2A 1S29A 4OU0A 2JA5J 5B1AH 5M5XJ 5LRRA 3WTUC 1JKQC 1BIAA 2OTJI 4EGZA 3AFHA 1I6XA 3ZMDA 5TRDA 3L7WA 3SDBA 1IAWA 2GZWA 3A02A 3NEUA 2X6XA 2F6CA 3EUAA 1STZA 5D8KB 1MMSA 3M8EA 4IQJA 3CUQB 5CVJA 1HC8A 4IOAF 3BG9A 3NWTA 1ONVA 2YU3A 2XGCA 2Y48A 1HKQA 1HF0A 4I2OA 4HOBA 3DLLF 3OMYA 4XKCA 4ZYGA 3E6CC 4LMYA 1XSVA 2CSOA 1EKEA 3FXJA 4R79A 1FOWA 3EUKL 5LHGA 3MZYA 2BHZA 4XLEA 4DZJA 2DOEA 2JVGA 2X6WA 2DK5A 2EK5A 3M9AA 3S1NJ 3MZHA 3DFGA 2VI6A 4J19A 4G6TB 1S9HA 4BH9A 2B7EA 4C2MJ 4FASD 3HOZJ 2J5OA 2VIXA 1WJCA 5DYMA 3GTKJ 3EUHC 3IH3A 4G12A 1OYWA 4HNUA 4WXHA 2H6BA 4FTHA 2V1UA 1FWZA 4IHWA 5E1XA 4PJJA 1ZR2A 2O61A 2W4SA 2O9LA 4EJOA 2MC3A 3V7SA 4GYIA 5JHFA 4S04A 3FKIJ 2Q0OA 4L9NA 4AYBN 1YX5A 3LSGA 3MCZA 4CDGA 5B1BH 3QP6A 1TC3C 3DKYA 2XHKA 3CTAA 2FXAA 2KPMA 3PNVA 2VJJA 2HYGD 2ZMEA 4AC0A 1QA6A 4BBSJ 3J81K 1Y8RB 2QZ8A 2XF5A 2L7MP 4M72A 3EUHA 1R1VA 1FBSA 1MJAA 3BG5A 4JP0A 1VQ6I 3CCVI 4O5VA 2PLYA 4Z6YA 3OSGA 2MLKA 4BY7J 2FMLA 3RIRA 5ILUA 2VLAA 2QSGX 1W36C 2M1BA 3GZNB 4ESFA 2HQAA 2R5YA 1N25A 3L2QA 2ID3A 2HKXA 4M6VA 1ZLKA 3F6VA 1VZ0A 2ZFUA 4P96A 1S3JA 1QVUA 4RBOA 1BI0A 3L2RA 3KZIC 3CP2A 3REOA 1MJ9A 2DYRH 2ZMEC 2K3FA 2R7SA 2AHQA 4M3EA 2A5WA 4LB5A 5E1ZB 3LMMA 2F2EA 1OCCH 1W5SA 1BC8C 2QQ9A 1D1BA 3UKGA 2CJJA 5K7ZA 2XAHA 3OIPA 4M73A 5KAFC 2L7ZA 3VODA 3F8BA 4HQEA 5LEKA 4GXOA 1VQ9I 1R5HA 1IXRC 3FBNB 3DP7A 1LEBA 3J80K 1Z7UA 4HF2A 3RCOA 1RI7A 1X1PA 5DM6F 1VQ8I 1T0FA 3S3MA 2RVCA 1SVMA 1GHCA 2P5KA 2RNGA 3T0YA 1TTYA 4HA8A 1N77A 1XSDA 2QGUA 3PNTA 4QSHA 1Z6TA 1QRYA 2OQRA 1A04A 1DU6A 3K1NA 1D5VA 3KP7A 3R0JA 3L9FA 4MFEA 3WGIA 1ZG5A 4PUSA 3HRTA 3BG6A 4PZJA 2R7OA 4ZDLA 3GTJJ 1GDTA 4WXCA 2WB1N 3DU6A 3E6DA 4BHPA 3IP4B 3ZOBA 2Y0SA 4I01A 2FE3A 3A01B 1QU3A 2X4HA 5FKOA 2K9NA 1TW3A 1SFXA 2L54A 2FSWA 1ZG1A 5L3GA 3QYBA 4BS9A 3S3NA 2R5YB 1GVJA 3VSKA 5E1WA 2LBFB 1LDDA 3I58A 2V1DA 3MQ0A 3PJRA 3E1SA 4LK1F 5HS9A 2RN7A 3H92A 1MBGA 5CVUA 2XAQA 3B73A 4IRIA 1WWXA 3K4MA 2TCTA 4PK4A 1TZLA 4QIWN 5KCMA 2RV8A 3F8CA 1PYVA 4NC8A 3SZTA 4XSXF 1D8KA 1O3QA 2EIJH 2L01A 2DODA 3W6VA 4XRMA 2FOWA 4TV7A 2R93J 4BNCA 2A6HF 2V1NA 3RQIA 1PJRA 5GAGJ 3BTJA 4G7ZF 2HOTA 1GUUA 1OISA 5ICCA 1KU9A 1KU2A 5C44J 2BZTA 2MSYA 4I99C 4DBQA 1QZYA 3PIOF 2ZJPF 5JHUA 3ISPA 3LSPA 3KYCB 3FDYA 1MMAA 2K9QA 1YQAA 3K4NA 2ZXIA 2L4MA 2QM3A 1WPKA 4MGRA 2Q1ZB 2W85A 5BNGA 4LD5A 4LLGF 1TT0A 2IGMA 4UUTA 3RZDJ 4AD9A 3WE3A 1IGNA 1QHGA 2OUMA 2X0LA 5E3LA 3OYBA 1YW8A 1IUFA 2HZDA 1QNTA 4LB6B 2L9SA 4YFKF 2MA3A 3VFZA 5E3NA 3MMYB 2VASA 3BR3A 1VQMI 1DQUA 1ZH5A 3ZR8X 2OD5A 1NK3P 2OV7A 3HTUA 4A3JJ 1P4WA 1TL8A 1P4AA 2DN0A 1ZARA 2MH2A 1ZLJA 1EV7A 1VF9A 4DJAA 2KISA 3DWLE 3LA7A 1SVOA 4KIBA 1T56A 3GFLA 4CHUA 1FYLA 3M7GA 4CCMA 3SFZA 1A31A 1DGRM 2A61A 5LD2C 1B9MA 5H2FC 5DDGA 1RETA 1LKXA 3WU1B 4G7OF 3HB9A 1MSEC 3N05A 2M8EA 2BY3A 1NG6A 4HPQA 4L5JA 5IOYA 3O8HA 1OCTC 3UNGC 5EEAA 2QSFX 3DV8A 3I9V2 4P9FA 1TW2A 4PGHA 3OYJA 4CSWA 1FYMA 3OS0A 2EQRA 2Y0SN 4G9YA 2JTVA 4CCLA 4HW0A 4AYBA 1IO2A 1QZZA 1Y1VJ 2WAQA 3LA2A 3JRHA 1MDMA 3F6OA 3SZGA 3K69A 4A3GJ 3LFUA 4G6DA 2OCCH 2ZO4A 2KZGA 2Y30A 2BEOA 1J2XA 2B9SA 4NNJA 1Y1WJ 2K02A 5JLXA 3FK6A 1BBYA 2JUCA 2GOMA 2LP0A 3H3ZA 3HTSB 1LUJB 2LBFA 1G2HA 2E2JJ 3MKWB 3FMRA 2V9PA 2VC0A 3O2PE 3SJMA 3FM5A 2OTLI 4XKWA 4EATA 1Z05A 4LGWA 2MW8A 2D1HA 3S2WA 3ERMA 1Q1HA 1JKPC 1LDJA 5HVQC 5IYCJ 4A3KJ 1ETKA 2E5ZA 4Y4RA 3O3KA 4FHTA 2JA6J 3IKVA 3E3VA 4CGZA 3GX4X 4HQMA 1AKHB 2WY7Q 2VB6A 2W25A 3LNQA 2KJCA 1JTXA 2Y2ZA 1ZKGA 1EH7A 3R4KA 2GXAA 1IN5A 2R5ZA 4IRGA 4GDFA 1ITYA 1X58A 1UHMA 1ZQ3P 4F55A 2VT2A 1VQ5I 1OKRA 4KN7X 1YOVB 3BROA 1V3FA 2L02A 2XB5A 4D5CA 1SD6A 2GOXB 1F4KA 1UAAA 4IHVA 1JHHA 4XQFA 1OCPA 2QQBA 3L2UA 2P6SA 4WF2A 5M5WJ 5C4JJ 2F5EA 1Y39A 2F5VA 3L09A 2CUFA 3DTIA 1WJEA 3OV8A 4E7SA 5FRMA 2M5WA 1FYKA 4XRSG 1U0JA 3HRUA 1X4PA 3RI4A 3HG9A 4UV8A 3F0CA 3OYIA 2WA0A 1P92A 4Y3OA 1B9NA 2Z5UA 3QPHA 2R5ZB 1UJ8A 2Q2EA 2DTRA 2F5CA 2WADA 3CC7I 3WHCA 3GW2A 3CCMI 1A6IA 1KU7A 2COMA 2EV6A 3RKXA 5GPCA 3T8RA 5IOZA 2EA4A 1AWCA 4II3A 3G6EI 2P4WA 2IJLA 3KZYA 4M74A 1UB9A 3ZCOA 3DPLC 2ZFWA 4Y33A 5E18F 2QBYA 3E97A 3GFMA 4M3FA 3TDZC 2M7BA 3DKWA 1NH3A 3W3CA 3ZMSA 5HLGA 3K2AA 3CCRI 3AAFA 3GUDA 2HNHA 2OU2A 2M2EA 4XKVA 2LY2A 4HSRA 2QA4I 1XSXA 2ZKZA 2Z3YA 4YFNF 4ZYHA 1WJAA 4S0HB 4ENMA 5ICGA 3FXOA 1O7FA 1VNDA 1T33A 4B48A 2LY9A 4B8XA 1AHDP 4BQAA 5F0HA 5B66C 3ZMZA 2H6CA 5LHHA 3E0JB 1SD7A 1FIAA 2M4KA 4DQ2A 1USTA 1UG0A 2E1MC 2JPBA 2R7TA 4XLAA 3L00A 3SHFA 2HOAA 4RB0A 3EETA 1LDKB 4IHYA 3J81Z 3I3LA 3ULQB 3CDHA 4L9JA 2IBDA 4MTDA 3GTOJ 1SANA 2ZXHA 2HWVA 1LEAA 4NC6A 2MBFA 2VXDA 3JR9A 1YW9A 4AIDA 4Y7NJ 2EFOA 2QQ8A 1BJAA 2XB0X 4B1RA 4IHXA 2VKVA 4XLFA 1LPQA 1U2WA 3BCBA 3ZQGA 4L0YB 2DJNA 4YEJA 1K78A 4GRIA 2KRFA 1D8JA 3PQKA 1NTCA 4CCNA 5A2QK 1E2XA 1I50J 1L0OC 3IRRA 2CO5A 5HS8A 1KYZA 2VBZA 3FXQA 1O3RA 2CS3A 1R49A 3P7NA 2HEOA 4IVNA 2ELKA 4UB8C 4Q4ZF 1XDUA 4ZZDA 1J5YA 4Y13A 5M3FJ 4UXNA 1IV6A 4HBLA 4RB2C 2LMDA 1XGSA 4BE2A 3G71I 2ISZA 3HRSA 2R7RA 1JUMA 3DU5A 4ZZLA 3K10A 1YYVA 2K27A 2HFHA 1YJ9I 3AG1H 4ZYDA 3E6MA 3I59A 1MNDA 1X1AA 3ZPLA 3OIOA 4HZFA 2NVUB 1PP8F 5CJ9A 2GBYA 2ZB9A 4C2UA 1T2KA 1R22A 1MKMA 1I6HJ 1H89C 5FLVA 1YIJI 4B09A 2FBKA 2NS7A 3KE2A 4HRIA 2HS5A 1J0RA 3DEUA 1T8IA 3DEEA 4L5EA 5LGTA 1TWHJ 4Q47A 2BV6A 2YSRA 3SDGA 4GCVA 3GMEA 2NOJB 2MYSA 2W24A 1MMDA 3TQNA 5GTHC 3OR1C 2Y9YA 3PFIA 2LKXA 2M3AA 2OZ6A 4IKFA 3LSRA 4XM3A 2KIMA 1OYYA 2M0CA 2CUEA 1HA8A 1WRJA 3CCLI 2HYFA 3BPXA 3TKYA 1ZGWA 1CF7A 1YRNA 3TP3A 2GIZA 1A35A 1MSFC 2P6TA 3ZQCA 5BOXA 3H0GJ 2FBIA 3MZ8A 2UXNA 4ZC3A 4V2FA 2R7DA 2H8WA 2FRHA 2E71A 4A6DA 3OYCA 1VQPI 2PI0A 2NOGA 1S7EA 3PSIA 3BR2A 1RZ4A 5J47A 3FXMA 4QWQA 5LFAA 2PJRB 2AXTC 2QUFA 3K4KA 3CMEI 4H0EA 4BDYA 4ZJZA 2JA8J 2QQAA 2A6TA 2VE9A 1JT0A 4KT6A 3CCSI 2XGDA 2E19A 2V9VA 3P9IA 4BGDA 3GTGJ 2L2OA 3K1MA 4BJ5C 3QU3A 1E3OC 4X6AJ 3S32A 1A6QA 2HQ5A 5H20A 3R0AA 4I02A 2YX4A 3BTIA 5F0CA 3OL3A 3LAPA 1UZCA 3A0BC 3C1DA 3QWLA 1ORKA 2B0LA 2V1XA 3PFYA 1MBKA 3OS1A 5L3CA 3CJTB 1IXSB 4JX6A 1SMTA 4NHJA 1V55H 1YHQI 4XLPF 3L2VA 4KICA 4U87A 1HDDC 4A69C 3KX2A 4I7HA 4A93J 1I3QJ 3D5LA 1ULYA 3HKZN 4R1HA 3NAUA 2K5CA 2VL8A 2E7XA 3GCMA 1T98A 1H0MA 2JRMA 1PUFA 3GVAA 1B6AA 5EJCA 5D5WB 1FJLA 2K85A 1J75A 4N4OB 3OY9A 3FISA 4XBFA 2AXLA 2XSJC 1ETVA 4I98B 3GYHX 2A6EF 4BL0B 2PJPA 2DYSH 3TGNA 2XV4S 2ESNA 5EZGA 4CYCB 1VQ7I 1LFPA 4BXXJ 2VPLA 4A3MJ 3BZKA 2FX0A 1H88C 2JUGA 3VEPA 5F1JA 2BVLA 1GVDA 3K4LA 3DQVC 1G8XA 1U9OA 1ODDA 1ZTRA 2LC2A 2W57A 3ZRGA 4C9YA 5BPIA 1PUEE 2UXXA 2A05A 2L4AA 3S1RJ 3P9CA 1UCRA 3ZQQA 3LOCA 2O5RA 4FQGA 2RQQA 1FY7A 2R7QA 4FX0A 4GO1A 2Z99A 2ZBKA 5HS7A 5J40A 3BJ6A 5F04A 1MIJA 3I53A 1V5GA 3T1BA 1R00A 5DM7F 2DJIA 4LLLA 1IN7A 3OIQA 5TJJA 2R7XA 2BHYA 1R4NB 3BR5A 1OR7C 1WHUA 1I39A 1V5EA 1VI0A 3I0TA
chains in the Genus database with same CATH topology
3ABTA 4YIIA 5J6XA 2ACJA 4WWCA 2HTSA 4HDUA 2IA2A 4I0AA 1ZYRF 2EFNA 2ESHA 1FNNA 2A3SA 1P6RA 2RC4A 1ZAOA 4KIGA 4XSZF 5D5XB 1P4XA 1TQMA 4EGYA 3WE2A 1EH6A 4EV0A 4HV5A 1C0WA 2IP2A 3U1DA 1WQ2A 2RKHA 3HSEA 1YO5C 1RUOA 4P5OA 1XGMA 3TOBA 3ZMTA 3CUQC 4K2EA 1FBQA 2XASA 4HLYA 1BOAA 3ZP5A 2OAZA 3F21A 4L9VA 3TOAA 4ENKA 5FB2A 2IPQX 3ECHA 3Q9SA 4A2UA 3ZMVA 2NYXA 3BDDA 3KP5A 2AS5F 4M9SA 4YG2F 2MLGA 2D1VA 1Y0UA 4HF1A 4ASNA 3V4GA 4L5IA 1JGSA 1TQIA 2VBYA 2VOPA 1FLIA 1Z6RA 5BQTA 1R23A 1HSJA 4BYYA 2FOKA 1IN6A 2HOEA 3E5UA 5ERIA 4EQQA 3L2CA 3G73A 3DXJF 5DUIA 3WODF 2G9WA 1S7AA 4JBAA 1R7JA 4BHCA 1MGTA 3RKYA 1W5TA 3ROUA 1V4RA 5IT3A 4KUMA 4M71A 3GZ6A 3WGHA 3LSTA 3WGGA 1XMKA 2DI3A 2E7WA 4Q48A 3BPVA 5BPDA 2EFPA 3HRMA 2RGVA 1QPMA 3WG9A 5BS6A 3JTGA 3CO6C 3HHHA 1K7AA 2GA2A 1IN4A 4OOIA 3WU0A 2WV0A 1GXPA 2CWEA 3JW4A 3R60A 2BBYA 5HDNA 1KA8A 4MEXF 4MQ9F 5FD5A 1SFEA 3R6SA 2V79A 4GYGA 5A2QZ 4RGRA 4A5NA 4AIKA 4IHSA 3K0LA 3F22A 1GXQA 3GLXA 5LGNA 1UHWA 1IF1A 2J5PA 4RS8A 2K7LA 3GEZA 2XAJA 5L3FA 5DCMB 1NHAA 1DDNA 1WSUA 5FLXZ 3I59B 1B1BA 3I54A 3FXUA 2DBBA 3MFKA 3ELKA 2VC1A 5LGUA 3KEOA 2XKPA 4HLXA 4M9ZA 2E1NA 4HDVA 1BIBA 5ICEA 3ZMUA 3KFWX 1PP7U 2RQPA 2OBPA 4RGXA 2OA4A 2KKOA 1ON1A 1I1GA 2IA1A 2PQ8A 4OMYA 4MNUA 1U5TA 3KLOA 4IF4A 4KA4A 4LG0A 2H09A 1SAXA 1QQIA 4U0VA 3CO7C 5DEQA 4S05A 2CFXA 2P7CB 4OMZA 4RAZA 2JT1A 4L0ZB 2DO7A 2HGCA 3MEXA 4KT5C 1U5TB 4XRFA 4ENNA 3FWEA 5FD6A 4JQFA 3K1PA 1XCVA 2VBXA 5LHIA 5ED4A 4Y17A 4FX4A 5ILVA 1IRFA 4PDKA 2XAGA 3JSOA 2FF4A 3V8KA 1YLFA 3NQOA 4YFXF 2CYYA 2K86A 2O03A 2FA5A 2GQQA 3GFJA 3RJPA 2ZCWA 2XAFA 1YG2A 4DNCA 1YW7A 2IRFG 4G94A 1AOYA 2ZJ2A 2HKOA 1O57A 2EA2A 2ZNYA 1ON2A 1JHFA 2PN6A 2ETHA 5L3EA 1T38A 3KZZA 2DU9A 3F8MA 5KVRA 2WC2A 1U6GA 2Z9OA 1RUNA 1TQPA 1LQ1A 1RIOH 1HSTA 4MHGA 3J7AO 2HZTA 4HYEA 2O0YA 1O7LA 5DD8A 5K5RA 1TNSA 2Z33A 5DUKA 4WCGA 3VB2A 3U9GA 1FBUA 2WTEA 3BP8A 2STTA 4U88A 4RGUA 4RB1A 1ZRDA 5CVVA 3V7RA 1R5GA 2YPRA 4BXUA 2R7FA 3W6KB 2NNNA 6PAXA 1HKSA 5IT9K 1QO0D 1T39A 2KIFA 1Z9CA 5HDGA 1DPRA 2EWNA 1IW7F 5FFXA 3CLOA 4U0YA 1HQCA 4G8XA 1FSHA 4HF0A 3IC7A 3JAMK 2LSOA 4WXDA 4UV9A 2H94A 1O3SA 4AVPA 2NNYA 1MDMB 5AIQA 4LLNA 3E6BA 2HDCA 1I1SA 2XKOA 3RYPA 3IRQA 1OYIA 2LF8A 2YX7A 3KETA 2VONA 4HAMA 5BMZA 1W7PD 1I27A 1JXSA 1XGNA 3PQJA 5JR3A 1SD5A 2FEZA 1XN7A 4G7HF 2JPCA 3EYYA 3FM3A 4RB3C 3NRVA 4E70A 2NAZA 2OQGA 1FZPB 1SD4A 2FNAA 1ZRCA 2DLLA 2UZKA 3B02A 1U3EM 3GWZA 1D3YA 4EMSA 1S7OA 1R1TA 4NQWA 4OIQF 2KJBA 3GF2A 2LF7A 1BC7C 4O3MA 2GAUA 5D6EA 4M9XA 5L3DA 3TO9A 4OIOF 2Y75A 4CXFA 3BJAA 2ISYA 2EV5A 4CYDA 1R36A 4UHTA 4LFUA 1G4DA 3FX3A 1QGPA 4FT8A 3WTXC 2QWWA 2K4BA 3ZN1A 3V8JA 5HLHA 5H6RA 4MTEA 5EEGA 2EFQA 4IRHA 2XVCA 2GXGA 2O8XA 2E1CA 2TDXA 1K78B 4EJTA 2VOOA 2CQKA 3ECOA 2IA0A 2M30A 4L18B 3H3UA 4LG0B 5D6FA 4WK8F 3WTTC 3HYIA 1MZBA 4WX9A 3SQNA 4A0ZA 5F64A 1BI1A 3BZ6A 4KN4X 3ZQ7A 2A68F 1HKTA 4ZH4F 2HQNA 1IN8A 3HOTA 3I4PA 2LNBA 1XMAA 1K79A 3IKTA 1F1ZA 4KNYA 4ZYEA 4LK0F 5J8CA 1G3YA 3HSFA 4A6EA 3HHGA 1KU3A 1R58A 4EJWA 2IT0A 1DUXC 2F5FA 4D0PA 4KMUX 1UFMA 3E5QA 2XIGA 3M8FA 1IRGA 3KP6A 3F72A 2F5DA 5CVIA 1G3SA 2CW0F 2EJRA 1WI9A 3C7JA 1Z1DA 3JTHA 3KEQA 2STWA 4EM0B 3C18A 3HSRA 1XGOA 3IHUA 2VE8A 4I09A 2NS0A 3RDIA 3GFIA 1HBXG 3R61A 2K4JA 4PGGA 2PMHA 2PBIA 4KMFA 1G3WA 5CLSA 2IVMA 3BJOA 1EH8A 2XROA 1K6OA 2FQ3A 3U2RA 1FSEA 1O3TA 1YS6A 3I71A 2G7UA 3QOPA 4O6JA 1BN5A 4MQVA 3LFKA 4KDPA 4Z2YA 3DPTA 5JVTA 5H6QA 1L3LA 5D5VB 3CJNA 3TDUC 2DQRA 2A5YB 3WTZA 2Q8KA 2EB7A 3D0SA 4YIFA 2GXBA 2ZMEB 3WTVC 1FP2A 1JE8A 3VOEA 1J9IA 1I5ZA 2D2WA 4N0BA 5FLXK 3F8FA 3IWFA 1HXDA 1U8RA 3KCCA 2PFBA 3RYRA 4PCQA 3BWGA 5JFRA 2P5LC 1VTNC 3MWMA 5ICFA 3GZ5A 1WKMA 4LJZF 2ZXJA 1FX7A 1ZG3A 3FHZA 3DF8A 3QU6A 2DW4A 1B4AA 5E8GA 4HX7A 3FMSA 2EFWA 1BI2A 4ETSA 1RNLA 1XB4A 1REPC 3F3XA 2FNPA 1KQ9A 3KLNA 1CGPA 1Z91A 1W7PB 2HTJA 4CO8A 1HW1A 5D8LB 4XLNF 1OMIA 3WTWC 3EQLF 2XGXA 3ERED 3N97A 1X3UA 1MJBA 4MEYF 4OINF 2QVOA 2DQLA 3RKWA 4G6QA 2C6YA 1ZRFA 3BY6A 3GO5A 5LRSA 5HDKA 3HOSA 5E17F 3LWFA 5K1YA 5AIPA 2UWMA 2A69F 3N4MA 3EDPA 2RDPA 2NRAC 1BI3A 4KYWA 4IHTA 3F23A 5DCMA 3P9KA 2A07F 1KQ8A 2FU4A 4QLCU 5L3BA 1HW2A 5KK1A 1B59A 4EM2A 2WWYA 2ZNZA 2DAOA 2VXZA 3CUOA 2JZYA 3SZPA 2EV0A 4EM1A 3BOQA 4U7DA 1YTYA 1G6NA 1XDSA 2GIVA 1T6SA 1LNWA 3HUGA 4RAYA 4UVCA 3HIFA 3KP4A 1IUYA 2JSCA 2XRNA 3FMQA 2R3SA 3EYIA 1S6LA 3LQQA 4OIPF 4UVBA 5HLIA 3GXOA 5LLQA 1YFHA 1DPUA 3OOPA 1H9GA 4A12A 2O6GE 2M87A 2PEXA 1TBXA 2VN2A 3T8TA 2BGCA 1XD7A 1ZHFA 1F5TA 3FZVA 5JI6A 2FBHA 5E8IA 2QYOA 1ZN2A 1LJ9A 2P8TA 3COAC 4Y15A 5ILSA 2W84A 5K5QA 3QPTA 3RPUA 2MD5A 1FOKA 4AWXB 1U5TC 1DP7P 3LA3A 2PG4A 2DFIA 4A5MA 2DK8A 2FMYA 5E20A 1U78A 5LBQA 2G7HA 1W4MA 2DT5A 3IL2A 3SXYA 1ZGJA 5FGMA 3MAJA 4CICA 4AIHA 4HX4A 2ADUA 2CGPA 1HW5A 4R8HA 1YIOA 3TO7A 3Q5FA 5K5OA 3W6JB 3V8LA 4U0WA 1FC3A 3TO6A 3ML6A 3G3ZA 4RGSA 2VODA 1J59A 2VT3A 3ABUA 2CG4A 5LEJA 1TLHB 5D4RA 2QENA 5DV5A 1G3TA 2HQRA 1YS7A 2RNJA 4IPAA 5HOOA 3IWZA 1FT9A 2QBYB 4IXAA 2P7VB 5J8FA 5DD4A 4CZZA 4ESJA 4A0YA 3JSPA 3V7CA 3ZN0A 2KIUA 1IZ1A 4I0BA 5CYVA 2O3FA 4N9HA 2L3DA 2P5VA 1OR7A 3Q9VA 4L9TA 1ZGAA 2XUBA 3WTSC 4UVAA 2M45A 3E5XA 2V6CA 4Q5SF 2GA1A 2HR3A 4OIRF 3RTRA 5FFZA 4ENJA 2DPDA 1IXCA 2LKPA 4EVIA 3C3WA 1FPQA 2BYVE 3T5XA 4EJVA 3FXRA 5DCFA 3I64A 4IJAA 3QAHA 5FO5A 4ESBA 1KQ0A 2YR2A 4ON0A 5AONA 4JK1X 2ELHA 1KYWA 4KFCA 5D5UB 4EJUA 2IW5A 5F6FA 4A0XA 1J7KA 3WTYC 1XCBA 2BE5F 4P55A 1QBJA 1BM9A 1TNTA 4U7BA 1R1UA 3K2ZA 5EEHA 1P2FA 1KGSA 2Y0MA 3QRFF 1USSA 4F7ZA 5F1RA 4GGGA 1LVAA 1E17A 4NB5A 1PDNC 1OPCA 2LDUA 3I5UA 4KIFA 4HX8A 3KP2A 2GWRA 1H9TA 2DPUA 2MH9A 4P9UA 4M6YA 2QLZA 5D4SA 1SFUA 4N9IA 4M6XA 4HV6A 3LQRA 4BAYA 3JAMZ 2JRTA 4UUVA 1W7PA 2VBWA 1F9NA 3RPQA 3M1EA 2D45A 1ZREA 1SMYF 3O6BB 3K9TA 4BHBA 2H27A 3FF5A 3J80Z 3LAJA 3F8NA 3KP3A 3QP5A 1FP1D 2OZUA 2PMUA 1CF7B 5CVRA 1MD0A 5IT9Z 4UNOA 4AIJA 3CUQA 1S8NA 1LB2A 1S29A 4OU0A 5LRRA 3WTUC 1BIAA 4EGZA 1I6XA 3ZMDA 5TRDA 3L7WA 1IAWA 2GZWA 3NEUA 1STZA 5D8KB 3M8EA 3CUQB 5CVJA 1ONVA 2YU3A 4I2OA 1HKQA 2Y48A 4HOBA 4ZYGA 3E6CC 4LMYA 1XSVA 2CSOA 4R79A 5LHGA 3MZYA 2DK5A 2EK5A 3M9AA 3MZHA 3DFGA 4BH9A 2J5OA 5DYMA 1OYWA 4WXHA 2H6BA 2V1UA 1FWZA 5E1XA 2O61A 4EJOA 2MC3A 3V7SA 4GYIA 4S04A 2Q0OA 4L9NA 3MCZA 4CDGA 3QP6A 2XHKA 3CTAA 2FXAA 2HYGD 2ZMEA 3J81K 2QZ8A 4M72A 3EUHA 1R1VA 1FBSA 1MJAA 4O5VA 2PLYA 2MLKA 2FMLA 3RIRA 5ILUA 2M1BA 4ESFA 1ZLKA 2HKXA 3F6VA 4P96A 1S3JA 1BI0A 3REOA 1MJ9A 4LB5A 5E1ZB 2F2EA 1W5SA 1BC8C 2QQ9A 2XAHA 4M73A 3VODA 3F8BA 4HQEA 5LEKA 4GXOA 1R5HA 1IXRC 3DP7A 1LEBA 3J80K 1Z7UA 4HF2A 1RI7A 1T0FA 2RVCA 1GHCA 2P5KA 3T0YA 1TTYA 4HA8A 1XSDA 1Z6TA 2OQRA 1A04A 3K1NA 1D5VA 3KP7A 3R0JA 3L9FA 3WGIA 1ZG5A 3HRTA 4PZJA 4WXCA 3E6DA 4BHPA 4I01A 2FE3A 2X4HA 1TW3A 1SFXA 2L54A 2FSWA 1ZG1A 5L3GA 1GVJA 5E1WA 1LDDA 3I58A 2V1DA 3MQ0A 4LK1F 5HS9A 2RN7A 3H92A 5CVUA 2XAQA 3B73A 4IRIA 1WWXA 2RV8A 3F8CA 3SZTA 4XSXF 1D8KA 1O3QA 2L01A 4TV7A 4BNCA 2A6HF 4G7ZF 5ICCA 1KU9A 1KU2A 1QZYA 5JHUA 3ISPA 1YQAA 2L4MA 2QM3A 4MGRA 2W85A 4LD5A 4LLGF 4AD9A 3WE3A 2X0LA 1YW8A 4LB6B 1QNTA 4YFKF 2MA3A 3VFZA 1ZH5A 2OD5A 3HTUA 1P4WA 1P4AA 1ZARA 2MH2A 1ZLJA 1EV7A 3LA7A 4KIBA 3GFLA 4CHUA 1FYLA 3M7GA 3SFZA 2A61A 1B9MA 5DDGA 3WU1B 4G7OF 2M8EA 4L5JA 3DV8A 4PGHA 4P9FA 1TW2A 1FYMA 4G9YA 2JTVA 4HW0A 1QZZA 3LA2A 1MDMA 3F6OA 3K69A 4G6DA 2ZO4A 2BEOA 1J2XA 2K02A 1BBYA 3HTSB 3H3ZA 3FMRA 2VC0A 3O2PE 3FM5A 1Z05A 4LGWA 2D1HA 3S2WA 1Q1HA 1LDJA 5HVQC 3O3KA 4FHTA 4CGZA 3IKVA 3E3VA 3GX4X 4HQMA 2W25A 2KJCA 1EH7A 3R4KA 1IN5A 4IRGA 1UHMA 2VT2A 1OKRA 4KN7X 3BROA 1V3FA 2L02A 1SD6A 1F4KA 1JHHA 2QQBA 2P6SA 4WF2A 2F5EA 3L09A 3OV8A 2M5WA 1FYKA 3HRUA 3RI4A 4UV8A 1P92A 1B9NA 2Z5UA 3QPHA 2Q2EA 2DTRA 2F5CA 3GW2A 1KU7A 2COMA 2EV6A 3RKXA 3T8RA 2EA4A 1AWCA 2P4WA 2IJLA 3KZYA 4M74A 1UB9A 3DPLC 2ZFWA 5E18F 2QBYA 3E97A 3GFMA 3TDZC 3DKWA 3ZMSA 5HLGA 3AAFA 3GUDA 2OU2A 1XSXA 2ZKZA 2Z3YA 4YFNF 4ZYHA 4ENMA 5ICGA 1O7FA 4B8XA 4BQAA 3ZMZA 2H6CA 5LHHA 1SD7A 4DQ2A 1USTA 2JPBA 3L00A 3SHFA 4RB0A 3EETA 1LDKB 3J81Z 3ULQB 4MTDA 3CDHA 4L9JA 2HWVA 1LEAA 2MBFA 1YW9A 2EFOA 1BJAA 1U2WA 4L0YB 1K78A 2KRFA 1D8JA 3PQKA 5A2QK 1E2XA 3IRRA 1L0OC 2CO5A 5HS8A 1KYZA 2VBZA 3FXQA 1O3RA 3P7NA 2HEOA 4IVNA 4Q4ZF 1XDUA 4ZZDA 1J5YA 4Y13A 4UXNA 4HBLA 4RB2C 1XGSA 2ISZA 3HRSA 4ZZLA 1YYVA 2K27A 2HFHA 4ZYDA 3E6MA 3I59A 3ZPLA 1PP8F 4HZFA 5CJ9A 1T2KA 1R22A 1MKMA 4B09A 2FBKA 3KE2A 2HS5A 1J0RA 3DEUA 5LGTA 4Q47A 2BV6A 2YSRA 4GCVA 2W24A 3TQNA 3PFIA 2OZ6A 2KIMA 1OYYA 1WRJA 2HYFA 3BPXA 3TKYA 1CF7A 2P6TA 5BOXA 2FBIA 2UXNA 2R7DA 2FRHA 4A6DA 2PI0A 1RZ4A 4QWQA 4H0EA 2QUFA 2QQAA 2VE9A 2V9VA 3P9IA 3K1MA 3QU3A 5H20A 3R0AA 4I02A 2YX4A 3LAPA 3C1DA 2V1XA 2B0LA 5L3CA 1IXSB 1SMTA 4NHJA 4XLPF 4KICA 4I7HA 3D5LA 1ULYA 4R1HA 2E7XA 1T98A 1H0MA 3GVAA 1B6AA 5D5WB 1J75A 4XBFA 2AXLA 4I98B 3GYHX 2A6EF 2PJPA 3TGNA 2XV4S 2ESNA 3VEPA 3DQVC 1ODDA 2W57A 5BPIA 1PUEE 2UXXA 2L4AA 3P9CA 1UCRA 1FY7A 4FX0A 4GO1A 2Z99A 2ZBKA 5HS7A 3BJ6A 3I53A 3T1BA 1R00A 4LLLA 1IN7A 5TJJA 3I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABT A;  4YII A;  5J6X A;  2ACJ A;  4WWC A;  2HTS A;  4HDU A;  2IA2 A;  4I0A A;  1ZYR F;  2EFN A;  2ESH A;  1FNN A;  2A3S A;  1P6R A;  2RC4 A;  1ZAO A;  4KIG A;  4XSZ F;  5D5X B;  1P4X A;  1TQM A;  4EGY A;  3WE2 A;  1EH6 A;  4EV0 A;  4HV5 A;  1C0W A;  2IP2 A;  3U1D A;  1WQ2 A;  2RKH A;  3HSE A;  1YO5 C;  1RUO A;  4P5O A;  1XGM A;  3TOB A;  3ZMT A;  3CUQ C;  4K2E A;  1FBQ A;  2XAS A;  4HLY A;  1BOA A;  3ZP5 A;  2OAZ A;  3F21 A;  4L9V A;  3TOA A;  4ENK A;  5FB2 A;  2IPQ X;  3ECH A;  3Q9S A;  4A2U A;  3ZMV A;  2NYX A;  3BDD A;  3KP5 A;  2AS5 F;  4M9S A;  4YG2 F;  2MLG A;  2D1V A;  1Y0U A;  4HF1 A;  4ASN A;  3V4G A;  4L5I A;  1JGS A;  1TQI A;  2VBY A;  2VOP A;  1FLI A;  1Z6R A;  5BQT A;  1R23 A;  1HSJ A;  4BYY A;  2FOK A;  1IN6 A;  2HOE A;  3E5U A;  5ERI A;  4EQQ A;  3L2C A;  3G73 A;  3DXJ F;  5DUI A;  3WOD F;  2G9W A;  1S7A A;  4JBA A;  1R7J A;  4BHC A;  1MGT A;  3RKY A;  1W5T A;  3ROU A;  1V4R A;  5IT3 A;  4KUM A;  4M71 A;  3GZ6 A;  3WGH A;  3LST A;  3WGG A;  1XMK A;  2DI3 A;  2E7W A;  4Q48 A;  3BPV A;  5BPD A;  2EFP A;  3HRM A;  2RGV A;  1QPM A;  3WG9 A;  5BS6 A;  3JTG A;  3CO6 C;  3HHH A;  1K7A A;  2GA2 A;  1IN4 A;  4OOI A;  3WU0 A;  2WV0 A;  1GXP A;  2CWE A;  3JW4 A;  3R60 A;  2BBY A;  5HDN A;  1KA8 A;  4MEX F;  4MQ9 F;  5FD5 A;  1SFE A;  3R6S A;  2V79 A;  4GYG A;  5A2Q Z;  4RGR A;  4A5N A;  4AIK A;  4IHS A;  3K0L A;  3F22 A;  1GXQ A;  3GLX A;  5LGN A;  1UHW A;  1IF1 A;  2J5P A;  4RS8 A;  2K7L A;  3GEZ A;  2XAJ A;  5L3F A;  5DCM B;  1NHA A;  1DDN A;  1WSU A;  5FLX Z;  3I59 B;  1B1B A;  3I54 A;  3FXU A;  2DBB A;  3MFK A;  3ELK A;  2VC1 A;  5LGU A;  3KEO A;  2XKP A;  4HLX A;  4M9Z A;  2E1N A;  4HDV A;  1BIB A;  5ICE A;  3ZMU A;  3KFW X;  1PP7 U;  2RQP A;  2OBP A;  4RGX A;  2OA4 A;  2KKO A;  1ON1 A;  1I1G A;  2IA1 A;  2PQ8 A;  4OMY A;  4MNU A;  1U5T A;  3KLO A;  4IF4 A;  4KA4 A;  4LG0 A;  2H09 A;  1SAX A;  1QQI A;  4U0V A;  3CO7 C;  5DEQ A;  4S05 A;  2CFX A;  2P7C B;  4OMZ A;  4RAZ A;  2JT1 A;  4L0Z B;  2DO7 A;  2HGC A;  3MEX A;  4KT5 C;  1U5T B;  4XRF A;  4ENN A;  3FWE A;  5FD6 A;  4JQF A;  3K1P A;  1XCV A;  2VBX A;  5LHI A;  5ED4 A;  4Y17 A;  4FX4 A;  5ILV A;  1IRF A;  4PDK A;  2XAG A;  3JSO A;  2FF4 A;  3V8K A;  1YLF A;  3NQO A;  4YFX F;  2CYY A;  2K86 A;  2O03 A;  2FA5 A;  2GQQ A;  3GFJ A;  3RJP A;  2ZCW A;  2XAF A;  1YG2 A;  4DNC A;  1YW7 A;  2IRF G;  4G94 A;  1AOY A;  2ZJ2 A;  2HKO A;  1O57 A;  2EA2 A;  2ZNY A;  1ON2 A;  1JHF A;  2PN6 A;  2ETH A;  5L3E A;  1T38 A;  3KZZ A;  2DU9 A;  3F8M A;  5KVR A;  2WC2 A;  1U6G A;  2Z9O A;  1RUN A;  1TQP A;  1LQ1 A;  1RIO H;  1HST A;  4MHG A;  3J7A O;  2HZT A;  4HYE A;  2O0Y A;  1O7L A;  5DD8 A;  5K5R A;  1TNS A;  2Z33 A;  5DUK A;  4WCG A;  3VB2 A;  3U9G A;  1FBU A;  2WTE A;  3BP8 A;  2STT A;  4U88 A;  4RGU A;  4RB1 A;  1ZRD A;  5CVV A;  3V7R A;  1R5G A;  2YPR A;  4BXU A;  2R7F A;  3W6K B;  2NNN A;  6PAX A;  1HKS A;  5IT9 K;  1QO0 D;  1T39 A;  2KIF A;  1Z9C A;  5HDG A;  1DPR A;  2EWN A;  1IW7 F;  5FFX A;  3CLO A;  4U0Y A;  1HQC A;  4G8X A;  1FSH A;  4HF0 A;  3IC7 A;  3JAM K;  2LSO A;  4WXD A;  4UV9 A;  2H94 A;  1O3S A;  4AVP A;  2NNY A;  1MDM B;  5AIQ A;  4LLN A;  3E6B A;  2HDC A;  1I1S A;  2XKO A;  3RYP A;  3IRQ A;  1OYI A;  2LF8 A;  2YX7 A;  3KET A;  2VON A;  4HAM A;  5BMZ A;  1W7P D;  1I27 A;  1JXS A;  1XGN A;  3PQJ A;  5JR3 A;  1SD5 A;  2FEZ A;  1XN7 A;  4G7H F;  2JPC A;  3EYY A;  3FM3 A;  4RB3 C;  3NRV A;  4E70 A;  2NAZ A;  2OQG A;  1FZP B;  1SD4 A;  2FNA A;  1ZRC A;  2DLL A;  2UZK A;  3B02 A;  1U3E M;  3GWZ A;  1D3Y A;  4EMS A;  1S7O A;  1R1T A;  4NQW A;  4OIQ F;  2KJB A;  3GF2 A;  2LF7 A;  1BC7 C;  4O3M A;  2GAU A;  5D6E A;  4M9X A;  5L3D A;  3TO9 A;  4OIO F;  2Y75 A;  4CXF A;  3BJA A;  2ISY A;  2EV5 A;  4CYD A;  1R36 A;  4UHT A;  4LFU A;  1G4D A;  3FX3 A;  1QGP A;  4FT8 A;  3WTX C;  2QWW A;  2K4B A;  3ZN1 A;  3V8J A;  5HLH A;  5H6R A;  4MTE A;  5EEG A;  2EFQ A;  4IRH A;  2XVC A;  2GXG A;  2O8X A;  2E1C A;  2TDX A;  1K78 B;  4EJT A;  2VOO A;  2CQK A;  3ECO A;  2IA0 A;  2M30 A;  4L18 B;  3H3U A;  4LG0 B;  5D6F A;  4WK8 F;  3WTT C;  3HYI A;  1MZB A;  4WX9 A;  3SQN A;  4A0Z A;  5F64 A;  1BI1 A;  3BZ6 A;  4KN4 X;  3ZQ7 A;  2A68 F;  1HKT A;  4ZH4 F;  2HQN A;  1IN8 A;  3HOT A;  3I4P A;  2LNB A;  1XMA A;  1K79 A;  3IKT A;  1F1Z A;  4KNY A;  4ZYE A;  4LK0 F;  5J8C A;  1G3Y A;  3HSF A;  4A6E A;  3HHG A;  1KU3 A;  1R58 A;  4EJW A;  2IT0 A;  1DUX C;  2F5F A;  4D0P A;  4KMU X;  1UFM A;  3E5Q A;  2XIG A;  3M8F A;  1IRG A;  3KP6 A;  3F72 A;  2F5D A;  5CVI A;  1G3S A;  2CW0 F;  2EJR A;  1WI9 A;  3C7J A;  1Z1D A;  3JTH A;  3KEQ A;  2STW A;  4EM0 B;  3C18 A;  3HSR A;  1XGO A;  3IHU A;  2VE8 A;  4I09 A;  2NS0 A;  3RDI A;  3GFI A;  1HBX G;  3R61 A;  2K4J A;  4PGG A;  2PMH A;  2PBI A;  4KMF A;  1G3W A;  5CLS A;  2IVM A;  3BJO A;  1EH8 A;  2XRO A;  1K6O A;  2FQ3 A;  3U2R A;  1FSE A;  1O3T A;  1YS6 A;  3I71 A;  2G7U A;  3QOP A;  4O6J A;  1BN5 A;  4MQV A;  3LFK A;  4KDP A;  4Z2Y A;  3DPT A;  5JVT A;  5H6Q A;  1L3L A;  5D5V B;  3CJN A;  3TDU C;  2DQR A;  2A5Y B;  3WTZ A;  2Q8K A;  2EB7 A;  3D0S A;  4YIF A;  2GXB A;  2ZME B;  3WTV C;  1FP2 A;  1JE8 A;  3VOE A;  1J9I A;  1I5Z A;  2D2W A;  4N0B A;  5FLX K;  3F8F A;  3IWF A;  1HXD A;  1U8R A;  3KCC A;  2PFB A;  3RYR A;  4PCQ A;  3BWG A;  5JFR A;  2P5L C;  1VTN C;  3MWM A;  5ICF A;  3GZ5 A;  1WKM A;  4LJZ F;  2ZXJ A;  1FX7 A;  1ZG3 A;  3FHZ A;  3DF8 A;  3QU6 A;  2DW4 A;  1B4A A;  5E8G A;  4HX7 A;  3FMS A;  2EFW A;  1BI2 A;  4ETS A;  1RNL A;  1XB4 A;  1REP C;  3F3X A;  2FNP A;  1KQ9 A;  3KLN A;  1CGP A;  1Z91 A;  1W7P B;  2HTJ A;  4CO8 A;  1HW1 A;  5D8L B;  4XLN F;  1OMI A;  3WTW C;  3EQL F;  2XGX A;  3ERE D;  3N97 A;  1X3U A;  1MJB A;  4MEY F;  4OIN F;  2QVO A;  2DQL A;  3RKW A;  4G6Q A;  2C6Y A;  1ZRF A;  3BY6 A;  3GO5 A;  5LRS A;  5HDK A;  3HOS A;  5E17 F;  3LWF A;  5K1Y A;  5AIP A;  2UWM A;  2A69 F;  3N4M A;  3EDP A;  2RDP A;  2NRA C;  1BI3 A;  4KYW A;  4IHT A;  3F23 A;  5DCM A;  3P9K A;  2A07 F;  1KQ8 A;  2FU4 A;  4QLC U;  5L3B A;  1HW2 A;  5KK1 A;  1B59 A;  4EM2 A;  2WWY A;  2ZNZ A;  2DAO A;  2VXZ A;  3CUO A;  2JZY A;  3SZP A;  2EV0 A;  4EM1 A;  3BOQ A;  4U7D A;  1YTY A;  1G6N A;  1XDS A;  2GIV A;  1T6S A;  1LNW A;  3HUG A;  4RAY A;  4UVC A;  3HIF A;  3KP4 A;  1IUY A;  2JSC A;  2XRN A;  3FMQ A;  2R3S A;  3EYI A;  1S6L A;  3LQQ A;  4OIP F;  4UVB A;  5HLI A;  3GXO A;  5LLQ A;  1YFH A;  1DPU A;  3OOP A;  1H9G A;  4A12 A;  2O6G E;  2M87 A;  2PEX A;  1TBX A;  2VN2 A;  3T8T A;  2BGC A;  1XD7 A;  1ZHF A;  1F5T A;  3FZV A;  5JI6 A;  2FBH A;  5E8I A;  2QYO A;  1ZN2 A;  1LJ9 A;  2P8T A;  3COA C;  4Y15 A;  5ILS A;  2W84 A;  5K5Q A;  3QPT A;  3RPU A;  2MD5 A;  1FOK A;  4AWX B;  1U5T C;  1DP7 P;  3LA3 A;  2PG4 A;  2DFI A;  4A5M A;  2DK8 A;  2FMY A;  5E20 A;  1U78 A;  5LBQ A;  2G7H A;  1W4M A;  2DT5 A;  3IL2 A;  3SXY A;  1ZGJ A;  5FGM A;  3MAJ A;  4CIC A;  4AIH A;  4HX4 A;  2ADU A;  2CGP A;  1HW5 A;  4R8H A;  1YIO A;  3TO7 A;  3Q5F A;  5K5O A;  3W6J B;  3V8L A;  4U0W A;  1FC3 A;  3TO6 A;  3ML6 A;  3G3Z A;  4RGS A;  2VOD A;  1J59 A;  2VT3 A;  3ABU A;  2CG4 A;  5LEJ A;  1TLH B;  5D4R A;  2QEN A;  5DV5 A;  1G3T A;  2HQR A;  1YS7 A;  2RNJ A;  4IPA A;  5HOO A;  3IWZ A;  1FT9 A;  2QBY B;  4IXA A;  2P7V B;  5J8F A;  5DD4 A;  4CZZ A;  4ESJ A;  4A0Y A;  3JSP A;  3V7C A;  3ZN0 A;  2KIU A;  1IZ1 A;  4I0B A;  5CYV A;  2O3F A;  4N9H A;  2L3D A;  2P5V A;  1OR7 A;  3Q9V A;  4L9T A;  1ZGA A;  2XUB A;  3WTS C;  4UVA A;  2M45 A;  3E5X A;  2V6C A;  4Q5S F;  2GA1 A;  2HR3 A;  4OIR F;  3RTR A;  5FFZ A;  4ENJ A;  2DPD A;  1IXC A;  2LKP A;  4EVI A;  3C3W A;  1FPQ A;  2BYV E;  3T5X A;  4EJV A;  3FXR A;  5DCF A;  3I64 A;  4IJA A;  3QAH A;  5FO5 A;  4ESB A;  1KQ0 A;  2YR2 A;  4ON0 A;  5AON A;  4JK1 X;  2ELH A;  1KYW A;  4KFC A;  5D5U B;  4EJU A;  2IW5 A;  5F6F A;  4A0X A;  1J7K A;  3WTY C;  1XCB A;  2BE5 F;  4P55 A;  1QBJ A;  1BM9 A;  1TNT A;  4U7B A;  1R1U A;  3K2Z A;  5EEH A;  1P2F A;  1KGS A;  2Y0M A;  3QRF F;  1USS A;  4F7Z A;  5F1R A;  4GGG A;  1LVA A;  1E17 A;  4NB5 A;  1PDN C;  1OPC A;  2LDU A;  3I5U A;  4KIF A;  4HX8 A;  3KP2 A;  2GWR A;  1H9T A;  2DPU A;  2MH9 A;  4P9U A;  4M6Y A;  2QLZ A;  5D4S A;  1SFU A;  4N9I A;  4M6X A;  4HV6 A;  3LQR A;  4BAY A;  3JAM Z;  2JRT A;  4UUV A;  1W7P A;  2VBW A;  1F9N A;  3RPQ A;  3M1E A;  2D45 A;  1ZRE A;  1SMY F;  3O6B B;  3K9T A;  4BHB A;  2H27 A;  3FF5 A;  3J80 Z;  3LAJ A;  3F8N A;  3KP3 A;  3QP5 A;  1FP1 D;  2OZU A;  2PMU A;  1CF7 B;  5CVR A;  1MD0 A;  5IT9 Z;  4UNO A;  4AIJ A;  3CUQ A;  1S8N A;  1LB2 A;  1S29 A;  4OU0 A;  5LRR A;  3WTU C;  1BIA A;  4EGZ A;  1I6X A;  3ZMD A;  5TRD A;  3L7W A;  1IAW A;  2GZW A;  3NEU A;  1STZ A;  5D8K B;  3M8E A;  3CUQ B;  5CVJ A;  1ONV A;  2YU3 A;  4I2O A;  1HKQ A;  2Y48 A;  4HOB A;  4ZYG A;  3E6C C;  4LMY A;  1XSV A;  2CSO A;  4R79 A;  5LHG A;  3MZY A;  2DK5 A;  2EK5 A;  3M9A A;  3MZH A;  3DFG A;  4BH9 A;  2J5O A;  5DYM A;  1OYW A;  4WXH A;  2H6B A;  2V1U A;  1FWZ A;  5E1X A;  2O61 A;  4EJO A;  2MC3 A;  3V7S A;  4GYI A;  4S04 A;  2Q0O A;  4L9N A;  3MCZ A;  4CDG A;  3QP6 A;  2XHK A;  3CTA A;  2FXA A;  2HYG D;  2ZME A;  3J81 K;  2QZ8 A;  4M72 A;  3EUH A;  1R1V A;  1FBS A;  1MJA A;  4O5V A;  2PLY A;  2MLK A;  2FML A;  3RIR A;  5ILU A;  2M1B A;  4ESF A;  1ZLK A;  2HKX A;  3F6V A;  4P96 A;  1S3J A;  1BI0 A;  3REO A;  1MJ9 A;  4LB5 A;  5E1Z B;  2F2E A;  1W5S A;  1BC8 C;  2QQ9 A;  2XAH A;  4M73 A;  3VOD A;  3F8B A;  4HQE A;  5LEK A;  4GXO A;  1R5H A;  1IXR C;  3DP7 A;  1LEB A;  3J80 K;  1Z7U A;  4HF2 A;  1RI7 A;  1T0F A;  2RVC A;  1GHC A;  2P5K A;  3T0Y A;  1TTY A;  4HA8 A;  1XSD A;  1Z6T A;  2OQR A;  1A04 A;  3K1N A;  1D5V A;  3KP7 A;  3R0J A;  3L9F A;  3WGI A;  1ZG5 A;  3HRT A;  4PZJ A;  4WXC A;  3E6D A;  4BHP A;  4I01 A;  2FE3 A;  2X4H A;  1TW3 A;  1SFX A;  2L54 A;  2FSW A;  1ZG1 A;  5L3G A;  1GVJ A;  5E1W A;  1LDD A;  3I58 A;  2V1D A;  3MQ0 A;  4LK1 F;  5HS9 A;  2RN7 A;  3H92 A;  5CVU A;  2XAQ A;  3B73 A;  4IRI A;  1WWX A;  2RV8 A;  3F8C A;  3SZT A;  4XSX F;  1D8K A;  1O3Q A;  2L01 A;  4TV7 A;  4BNC A;  2A6H F;  4G7Z F;  5ICC A;  1KU9 A;  1KU2 A;  1QZY A;  5JHU A;  3ISP A;  1YQA A;  2L4M A;  2QM3 A;  4MGR A;  2W85 A;  4LD5 A;  4LLG F;  4AD9 A;  3WE3 A;  2X0L A;  1YW8 A;  4LB6 B;  1QNT A;  4YFK F;  2MA3 A;  3VFZ A;  1ZH5 A;  2OD5 A;  3HTU A;  1P4W A;  1P4A A;  1ZAR A;  2MH2 A;  1ZLJ A;  1EV7 A;  3LA7 A;  4KIB A;  3GFL A;  4CHU A;  1FYL A;  3M7G A;  3SFZ A;  2A61 A;  1B9M A;  5DDG A;  3WU1 B;  4G7O F;  2M8E A;  4L5J A;  3DV8 A;  4PGH A;  4P9F A;  1TW2 A;  1FYM A;  4G9Y A;  2JTV A;  4HW0 A;  1QZZ A;  3LA2 A;  1MDM A;  3F6O A;  3K69 A;  4G6D A;  2ZO4 A;  2BEO A;  1J2X A;  2K02 A;  1BBY A;  3HTS B;  3H3Z A;  3FMR A;  2VC0 A;  3O2P E;  3FM5 A;  1Z05 A;  4LGW A;  2D1H A;  3S2W A;  1Q1H A;  1LDJ A;  5HVQ C;  3O3K A;  4FHT A;  4CGZ A;  3IKV A;  3E3V A;  3GX4 X;  4HQM A;  2W25 A;  2KJC A;  1EH7 A;  3R4K A;  1IN5 A;  4IRG A;  1UHM A;  2VT2 A;  1OKR A;  4KN7 X;  3BRO A;  1V3F A;  2L02 A;  1SD6 A;  1F4K A;  1JHH A;  2QQB A;  2P6S A;  4WF2 A;  2F5E A;  3L09 A;  3OV8 A;  2M5W A;  1FYK A;  3HRU A;  3RI4 A;  4UV8 A;  1P92 A;  1B9N A;  2Z5U A;  3QPH A;  2Q2E A;  2DTR A;  2F5C A;  3GW2 A;  1KU7 A;  2COM A;  2EV6 A;  3RKX A;  3T8R A;  2EA4 A;  1AWC A;  2P4W A;  2IJL A;  3KZY A;  4M74 A;  1UB9 A;  3DPL C;  2ZFW A;  5E18 F;  2QBY A;  3E97 A;  3GFM A;  3TDZ C;  3DKW A;  3ZMS A;  5HLG A;  3AAF A;  3GUD A;  2OU2 A;  1XSX A;  2ZKZ A;  2Z3Y A;  4YFN F;  4ZYH A;  4ENM A;  5ICG A;  1O7F A;  4B8X A;  4BQA A;  3ZMZ A;  2H6C A;  5LHH A;  1SD7 A;  4DQ2 A;  1UST A;  2JPB A;  3L00 A;  3SHF A;  4RB0 A;  3EET A;  1LDK B;  3J81 Z;  3ULQ B;  4MTD A;  3CDH A;  4L9J A;  2HWV A;  1LEA A;  2MBF A;  1YW9 A;  2EFO A;  1BJA A;  1U2W A;  4L0Y B;  1K78 A;  2KRF A;  1D8J A;  3PQK A;  5A2Q K;  1E2X A;  3IRR A;  1L0O C;  2CO5 A;  5HS8 A;  1KYZ A;  2VBZ A;  3FXQ A;  1O3R A;  3P7N A;  2HEO A;  4IVN A;  4Q4Z F;  1XDU A;  4ZZD A;  1J5Y A;  4Y13 A;  4UXN A;  4HBL A;  4RB2 C;  1XGS A;  2ISZ A;  3HRS A;  4ZZL A;  1YYV A;  2K27 A;  2HFH A;  4ZYD A;  3E6M A;  3I59 A;  3ZPL A;  1PP8 F;  4HZF A;  5CJ9 A;  1T2K A;  1R22 A;  1MKM A;  4B09 A;  2FBK A;  3KE2 A;  2HS5 A;  1J0R A;  3DEU A;  5LGT A;  4Q47 A;  2BV6 A;  2YSR A;  4GCV A;  2W24 A;  3TQN A;  3PFI A;  2OZ6 A;  2KIM A;  1OYY A;  1WRJ A;  2HYF A;  3BPX A;  3TKY A;  1CF7 A;  2P6T A;  5BOX A;  2FBI A;  2UXN A;  2R7D A;  2FRH A;  4A6D A;  2PI0 A;  1RZ4 A;  4QWQ A;  4H0E A;  2QUF A;  2QQA A;  2VE9 A;  2V9V A;  3P9I A;  3K1M A;  3QU3 A;  5H20 A;  3R0A A;  4I02 A;  2YX4 A;  3LAP A;  3C1D A;  2V1X A;  2B0L A;  5L3C A;  1IXS B;  1SMT A;  4NHJ A;  4XLP F;  4KIC A;  4I7H A;  3D5L A;  1ULY A;  4R1H A;  2E7X A;  1T98 A;  1H0M A;  3GVA A;  1B6A A;  5D5W B;  1J75 A;  4XBF A;  2AXL A;  4I98 B;  3GYH X;  2A6E F;  2PJP A;  3TGN A;  2XV4 S;  2ESN A;  3VEP A;  3DQV C;  1ODD A;  2W57 A;  5BPI A;  1PUE E;  2UXX A;  2L4A A;  3P9C A;  1UCR A;  1FY7 A;  4FX0 A;  4GO1 A;  2Z99 A;  2ZBK A;  5HS7 A;  3BJ6 A;  3I53 A;  3T1B A;  1R00 A;  4LLL A;  1IN7 A;  5TJJ A;  3I0T A; 
#chains in the Genus database with same CATH topology
 2EIM H;  1U8B A;  2IAI A;  4DYC A;  4BU2 A;  1B72 B;  3ABT A;  4KIT B;  4YII A;  4YEL A;  5J6X A;  3HOU J;  2ACJ A;  3M3Y J;  2QF7 A;  4WWC A;  2DA7 A;  2HTS A;  4HDU A;  5J3L A;  2IA2 A;  1E3P A;  4OWR B;  4I0A A;  3VYU B;  2ICW G;  1ZYR F;  2EFN A;  2MGQ A;  2ESH A;  1X3Z B;  2V7F A;  3K6G A;  2Y31 A;  3RQ4 A;  1FNN A;  4XR6 A;  2A3S A;  4ZTJ A;  1P6R A;  2DDA A;  1RPW A;  1S5L C;  1ZAO A;  2RC4 A;  2CQX A;  2KFD A;  2M4G A;  3B6A A;  4XRS A;  4KIG A;  2B63 J;  3NAR A;  4UY8 I;  2EIN H;  3K4B A;  4XSZ F;  3BLY A;  5D5X B;  1P4X A;  1TQM A;  4NQW B;  4EGY A;  3WU2 C;  3WE2 A;  1EH6 A;  4EV0 A;  3K70 D;  1FMV A;  4HV5 A;  1C0W A;  3BTL A;  2IP2 A;  3U1D A;  2VKE A;  1WQ2 A;  1B72 A;  1MBJ A;  2QKM B;  4C3I J;  3GTM J;  4CA0 A;  2RKH A;  3HSE A;  1NK2 P;  2DA4 A;  3BTC A;  1XC5 A;  4PFP A;  1YO5 C;  1RUO A;  1VQ4 I;  4P5O A;  1XGM A;  3VPR A;  3TOB A;  3ZMT A;  4BDZ A;  4II2 A;  3CUQ C;  4K2E A;  1FBQ A;  3CC2 I;  2JSP A;  1TWA J;  2DTZ A;  2XAS A;  1JTY A;  2EH3 A;  4HLY A;  3S17 J;  2Z1D A;  1BR1 A;  1BOA A;  2KDZ A;  3ZP5 A;  3AKZ A;  3HBL A;  4QTR A;  2OAZ A;  2DFH A;  1X4O A;  3F21 A;  2HVQ A;  4L9V A;  3TOA A;  4ENK A;  5FB2 A;  2IPQ X;  3ECH A;  3Q9S A;  1JUS A;  4A2U A;  3G1L A;  3PUF A;  3OYK A;  3G1O A;  5FKM A;  3ZMV A;  2XPW A;  3J7Z I;  5CPR B;  2NYX A;  3BDD A;  3KP5 A;  3HGY A;  3TED A;  2AS5 F;  1QPI A;  1V5F A;  4IQ4 A;  2DT6 A;  4M9S A;  2MLG A;  2VQH A;  4YG2 F;  2D1V A;  4MIM A;  1U9N A;  3K7A J;  1Y0U A;  3OYH A;  3BR6 A;  4HF1 A;  2H1L A;  4QPO A;  2ZSH B;  4XON A;  4FE4 A;  5FJ8 J;  2NVY J;  4ASN A;  3V4G A;  4L5I A;  1JGS A;  1TQI A;  5TIS C;  2E2H J;  2VBY A;  3G4S I;  2VOP A;  1FLI A;  2VKD A;  1Z6R A;  4EEF G;  3K4C A;  1JUP A;  4LIV A;  5BQT A;  1R23 A;  4NUB A;  1HSJ A;  2VQL A;  2FOK A;  2LYC A;  2Z16 A;  1IN6 A;  4BYY A;  2HOE A;  3E5U A;  3CCE I;  5ERI A;  4EQQ A;  2DOA A;  3L2C A;  4XN0 A;  3G73 A;  3DXJ F;  4A3F J;  5FKN A;  2VJ4 A;  2XPV A;  5DUI A;  3WOD F;  3KYD B;  3OYG A;  2G9W A;  1YE9 A;  1S7A A;  3FXL A;  1Y56 A;  4JBA A;  1JJ8 C;  4ZDP A;  1R7J A;  4BHC A;  1MGT A;  3RKY A;  5CQG A;  1ETO A;  1W5T A;  4B47 A;  2ZJR F;  2L9V A;  2X1E A;  3GTL J;  3ROU A;  1V4R A;  3S8P A;  5IT3 A;  1OCO H;  2Z2S B;  4IOC F;  4E7Z A;  4KUM A;  4M71 A;  3GZ6 A;  1GT0 C;  3WGH A;  3OSF A;  2M9H A;  1Z67 A;  2XAU A;  3LST A;  3WGG A;  1XMK A;  3VSL A;  2DI3 A;  1DGW Y;  2E7W A;  2OCE A;  4Q48 A;  3BPV A;  5BPD A;  2EFP A;  3S2D J;  3HRM A;  4KJZ A;  2RGV A;  4XID A;  1QPM A;  5GPA A;  3WG9 A;  5BS6 A;  3VWB A;  2CV0 A;  3JTG A;  3CO6 C;  3HHH A;  1K7A A;  2GA2 A;  2COB A;  3B6C A;  2HYJ A;  1OCZ H;  3Q0U A;  1IN4 A;  4OOI A;  3WU0 A;  4ZDO A;  2WV0 A;  1Z7L A;  3W2V A;  4F93 B;  1GXP A;  3H9Q A;  2K9M A;  3LSJ A;  2W1O A;  2CWE A;  2M0M A;  4HEA 2;  3JW4 A;  3IH4 A;  3R60 A;  5IP9 J;  2BBY A;  1K6Y A;  5HDN A;  1KA8 A;  4MEX F;  4MQ9 F;  5FD5 A;  1SFE A;  2LLK A;  3R6S A;  2E36 A;  2V79 A;  3BQZ A;  4GYG A;  2CQN A;  1R4M B;  5A2Q Z;  2AQE A;  4RGR A;  4A5N A;  5HNH A;  2JA2 A;  4AIK A;  4IHS A;  3K0L A;  3F22 A;  1GXQ A;  3GLX A;  3W2A A;  5LGN A;  1UHW A;  1IF1 A;  2J5P A;  4RS8 A;  5JLW A;  1IC8 A;  2K7L A;  2RRE A;  3GEZ A;  3S93 A;  2IGO A;  2XAJ A;  4MO7 A;  5L3F A;  5DCM B;  1NHA A;  1DDN A;  2X1D A;  1WSU A;  5FLX Z;  5EG0 B;  2VJI A;  3D5S C;  4D7N A;  1J09 A;  3I59 B;  5DS9 A;  1B1B A;  2XRL A;  3I54 A;  2F4O B;  3FXU A;  2DBB A;  2X6O A;  1JI8 A;  9ANT A;  3MFK A;  3ELK A;  2VC1 A;  5F08 A;  2JMW A;  2FD5 A;  5LGU A;  3ZQH A;  2YU9 J;  2MAB A;  2V6E A;  3TP0 A;  3KEO A;  2XKP A;  2CQ7 A;  1EF4 A;  4HLX A;  5EGO A;  4M9Z A;  2E1N A;  4HDV A;  1BIB A;  5ICE A;  3ZMU A;  3KFW X;  4Y52 J;  4J01 A;  1PP7 U;  2RQP A;  2OBP A;  4RGX A;  2ZXW H;  5GAH J;  2OA4 A;  2KKO A;  1ON1 A;  5M3M J;  3OYD A;  1I1G A;  2IA1 A;  2PQ8 A;  4OMY A;  4MNU A;  3FBI B;  1U5T A;  3CCY A;  3KLO A;  2HI3 A;  2KLO A;  4IF4 A;  4KA4 A;  1MH3 A;  1WI3 A;  2H09 A;  4LG0 A;  4BUP A;  1SAX A;  1QQI A;  4UB6 C;  1LFB A;  4U0V A;  3CO7 C;  5DEQ A;  4S05 A;  2CFX A;  1R9T J;  2I10 A;  2P7C B;  4OMZ A;  4RAZ A;  4BEH A;  2JT1 A;  1GV5 A;  4L0Z B;  2DO7 A;  2QEX I;  2HGC A;  3MEX A;  4BAC A;  2H1K A;  3S3O A;  1TWG J;  1U5T B;  4KT5 C;  4XRF A;  4ENN A;  3S1Q J;  3FWE A;  5FD6 A;  2L9N A;  4JQF A;  3D5R C;  3K1P A;  3Q0W A;  1XCV A;  2DA1 A;  2VBX A;  5LHI A;  3QPL A;  3VYR B;  5EGO B;  3AL0 B;  5ED4 A;  5GTI C;  4Y17 A;  5EZH A;  4FX4 A;  5ILV A;  1IRF A;  5EYR A;  4PDK A;  3RPU D;  1S72 I;  4DIQ A;  2XAG A;  2IXS A;  3DLA A;  5CKT A;  3J7A Y;  2DA6 A;  2QKL B;  2FF4 A;  3V8K A;  3JSO A;  1YLF A;  3NQO A;  4YFX F;  2CYY A;  3PM1 A;  2K86 A;  2O03 A;  3ZXS A;  2FA5 A;  2GQQ A;  2VKH A;  3GFJ A;  2PX9 A;  5EG0 A;  4XN3 A;  3RJP A;  2ZCW A;  2XAF A;  3CMY A;  1YG2 A;  4DNC A;  1YW7 A;  4BEH B;  1ZK8 A;  2IRF G;  1BA5 A;  3JRI A;  4G94 A;  1AOY A;  3G2B A;  1P7I A;  2ZJ2 A;  2HKO A;  3QPS A;  3D1N I;  1O57 A;  3HPH A;  2DMP A;  2EA2 A;  2ZNY A;  1W1W E;  1ON2 A;  1HCR A;  5FRN A;  1JHF A;  1XS9 A;  2PN6 A;  2ETH A;  1ENH A;  5L3E A;  2R7U A;  1T38 A;  5B3S H;  3KZZ A;  1ZR4 A;  2DU9 A;  2XGE A;  3BG3 A;  4FIS A;  4IL6 C;  4LIT A;  3HGG A;  1K61 A;  1XMX A;  1TP4 A;  2F4M B;  3F8M A;  3ONQ A;  5KVR A;  2Y9Z A;  1DU0 A;  1IDY A;  2WC2 A;  2CRG A;  1U6G A;  2L7K A;  1X2N A;  2ECB A;  2Z9O A;  1RUN A;  4M3G A;  4ABZ A;  1TQP A;  1LQ1 A;  3OYE A;  2YUS A;  1RIO H;  1HST A;  4MHG A;  3J7A O;  5J4V A;  2HZT A;  1LVK A;  1RRJ A;  1JT6 A;  4HYE A;  2O0Y A;  2LKS A;  4E7J A;  3M8J A;  1O7L A;  5DD8 A;  5K5R A;  3CF2 A;  4XNF A;  1P7J A;  1TNS A;  3K70 C;  4B4C A;  2Z33 A;  2VQC A;  5DUK A;  4C2T A;  3A01 A;  4WCG A;  4KIS A;  3VB2 A;  2K3P A;  2V4J C;  1FBU A;  2WTE A;  3BP8 A;  3U9G A;  2L0K A;  2JK3 A;  3ABK H;  2STT A;  4J00 A;  2KL4 A;  3H35 A;  1VFC A;  4U88 A;  4RGU A;  4RB1 A;  1ZRD A;  5CVV A;  3V7R A;  1F43 A;  1R5G A;  2DMQ A;  3QYF A;  2YPR A;  4LOC A;  4BXU A;  2XSD C;  2R7F A;  3W6K B;  2NNN A;  6PAX A;  2BXZ A;  2Q2E B;  1HKS A;  5IT9 K;  1QO0 D;  5FRO A;  1T39 A;  2KIF A;  1Z9C A;  3CES A;  5HDG A;  1DPR A;  3GLL A;  1W36 D;  2LR8 A;  1W0T A;  2IS6 A;  2EWN A;  1WZ2 A;  4XK4 A;  1IW7 F;  3HPG A;  5FFX A;  2JQ7 A;  3CLO A;  4U0Y A;  1HQC A;  2BY1 A;  1PUF B;  4G8X A;  2FQ4 A;  1FSH A;  3MKY B;  2MFZ A;  1ETX A;  2E60 A;  3JRD A;  3A4C A;  4HF0 A;  4W1U A;  2CW7 A;  3BR1 A;  3BQY A;  3IC7 A;  3JAM K;  4D5F A;  5J1U A;  1GV2 A;  2LSO A;  4WXD A;  3AG3 H;  2LOO A;  4UV9 A;  2H94 A;  1O3S A;  1RKW A;  1YJN I;  4AVP A;  2NNY A;  1MDM B;  3KIO A;  2ID6 A;  4RMN A;  5AIQ A;  3AG2 H;  4LLN A;  3E6B A;  3MN2 A;  1Z0X A;  4D7M A;  2HDC A;  4DOZ A;  1X19 A;  1I1S A;  2XKO A;  3RYP A;  2VON A;  3IRQ A;  1SAU A;  1OYI A;  3CJQ B;  2LF8 A;  2YX7 A;  4CCO A;  1D1A A;  3KET A;  3L1P A;  3CLQ A;  3LSH A;  1K4T A;  2CV2 A;  4HAM A;  5BMZ A;  3OR2 C;  1W7P D;  1MBE A;  1FTZ A;  1Z77 A;  2KIQ A;  1I27 A;  3PO3 J;  2KP6 A;  1JXS A;  1XGN A;  3PQJ A;  5JR3 A;  3IUO A;  1SD5 A;  3GTQ J;  2FEZ A;  2V26 A;  2E35 A;  1XN7 A;  4XKB A;  4G7H F;  1NG7 A;  2JPC A;  3EYY A;  3FM3 A;  1MW7 A;  4F91 B;  4RB3 C;  2DA5 A;  3NRV A;  1JKO C;  3X2Q H;  2G0E A;  1WVR A;  4BKX A;  4P1W A;  4E70 A;  2NAZ A;  2OQG A;  1D1C A;  1FZP B;  3TW7 A;  4MLO A;  1SD4 A;  3P5J A;  1SEU A;  2FNA A;  1ZRC A;  1V54 H;  2L9R A;  2DLL A;  1YJW I;  2UZK A;  1Z3X A;  3B02 A;  5IP6 A;  2CU7 A;  1U3E M;  4BQO A;  3CDI A;  3GWZ A;  1D3Y A;  3HOW J;  3CMM A;  4EMS A;  1R71 A;  1S7O A;  4PSX A;  1R1T A;  2CH0 A;  4GFB A;  3OOU A;  4NQW A;  4OIQ F;  2KJB A;  3QOD A;  3GF2 A;  3SYT A;  2LF7 A;  1BC7 C;  5HNF A;  3U21 A;  2EIK H;  2GAU A;  5D6E A;  4O3M A;  4M9X A;  2E1M B;  4CCK A;  2E5N A;  5L3D A;  2E1O A;  3TO9 A;  4OIO F;  1VQL I;  2MG4 A;  2H8R A;  2Y75 A;  4CXF A;  3GTP J;  2BXY A;  3BJA A;  2M7A A;  2ISY A;  1A5J A;  2EV5 A;  2BY2 A;  2E2I J;  4DBR A;  1ZEL A;  4CYD A;  3HDD A;  1R36 A;  4B43 A;  5F27 A;  4UHT A;  2E34 A;  4LFU A;  2AO9 A;  2K9L A;  1G4D A;  2DMT A;  4C3H J;  3DKX A;  3FX3 A;  2DMN A;  1QGP A;  4FT8 A;  4AVZ A;  4BY1 J;  3WTX C;  1H8A C;  2KRC A;  2R0Q C;  3KPH A;  2QWW A;  2K4B A;  3ZN1 A;  4C3J J;  1MMG A;  3V8J A;  4RLF A;  4UUS A;  1OJL A;  3PL8 A;  5HLH A;  2CUZ A;  5H6R A;  1IRZ A;  4F3Q A;  4ZYA A;  2JVH A;  4MTE A;  5EEG A;  3HKZ A;  2IEK A;  3H1C A;  2EFQ A;  4IRH A;  2XVC A;  1Y6I A;  2GXG A;  2BVM A;  2O8X A;  2WB1 A;  4D1Q A;  2E1C A;  2TDX A;  5DTD A;  1K78 B;  3TBI A;  4EJT A;  4BQQ A;  2VOO A;  4FET A;  3JRF A;  2QCO A;  3S15 J;  2CQK A;  3ECO A;  2IA0 A;  2M30 A;  4L18 B;  3H3U A;  4LG0 B;  3C2H A;  5D6F A;  4IZZ A;  2R7V A;  4WK8 F;  3ABM H;  3J7Y J;  3WTT C;  4W97 A;  3HZJ A;  3HYI A;  1MZB A;  4WX9 A;  3SQN A;  2CMP A;  4A0Z A;  1CQT A;  5F64 A;  1BI1 A;  3BZ6 A;  4KN4 X;  4F92 B;  3ZQ7 A;  2IGN A;  2A68 F;  3ZQF A;  2TRT A;  2HDD A;  3H5N A;  2D5V A;  1HKT A;  4ZH4 F;  2HQN A;  4XIC A;  1IN8 A;  3HOT A;  4B44 A;  3I4P A;  2LNB A;  1XMA A;  1K79 A;  3IKT A;  1F1Z A;  2VJ5 A;  3DBH B;  3ESW B;  3LSK A;  5EF6 A;  4KNY A;  4ZYE A;  2KQR A;  2L5Q A;  4LK0 F;  5J8C A;  1G3Y A;  3HSF A;  3OL4 A;  4A6E A;  5IP7 J;  3HHG A;  1KU3 A;  3CCU I;  4BJT A;  1R58 A;  4EJW A;  2IT0 A;  3OYA A;  5E3M A;  1DUX C;  2F5F A;  3M1C A;  4D0P A;  2LD5 A;  3AG4 H;  4KMU X;  1LE8 A;  1UFM A;  3E5Q A;  2XIG A;  1W0U A;  3M8F A;  3S16 J;  1IRG A;  4RA2 A;  4A3B J;  3KP6 A;  3F72 A;  2F5D A;  2JJ7 A;  1M1E B;  5CVI A;  1K83 J;  1G3S A;  2CW0 F;  2EJR A;  1WI9 A;  4HNV A;  3C7J A;  1E3H A;  1Z1D A;  3JTH A;  3KEQ A;  2UUZ A;  1D0Y A;  1LE8 B;  5KNL A;  4E7I A;  3I55 I;  2N8G A;  2STW A;  4EM0 B;  3C18 A;  3HSR A;  1XGO A;  4MFD A;  3IHU A;  2LVS A;  2VE8 A;  4I09 A;  2DXI A;  4A3I J;  1R6R A;  2NS0 A;  3RDI A;  1RC9 A;  4CZC A;  4BE0 A;  3GFI A;  2FUG 2;  1HBX G;  3SEQ A;  2KHM A;  3R61 A;  3I56 I;  2ECC A;  3Q3S A;  2K4J A;  5GAE J;  1ETY A;  4PGG A;  2PMH A;  2PBI A;  2HOS A;  4KMF A;  3A03 A;  1JJ6 C;  1G3W A;  3JCU C;  1T0F C;  3BCA A;  1YRN B;  1WCM J;  5CLS A;  1LFU P;  4JX5 A;  1SVL A;  2IVM A;  3OS2 A;  3PNY A;  3BJO A;  3H36 A;  1RES A;  1EH8 A;  1UEL B;  2XRO A;  1K6O A;  1HLV A;  1FIP A;  2FQ3 A;  4CUG A;  3U2R A;  1ETW A;  4FCY A;  1AKH A;  1BR2 A;  3JRG A;  1FSE A;  1APL C;  4PSW A;  2NVX J;  3GBG A;  1O3T A;  1YS6 A;  3I71 A;  2G7U A;  3QOP A;  4M3B A;  4O6J A;  1BN5 A;  3M4O J;  4MQV A;  5FKL A;  3LFK A;  4KDP A;  3UR3 C;  4Z2Y A;  1TWC J;  4M3D A;  1P9Q C;  1TWF J;  3DPT A;  5JVT A;  4I76 A;  4AU7 A;  5H6Q A;  1IV8 A;  1L3L A;  2LRE A;  3FIW A;  5D5V B;  3CJN A;  2X51 A;  3TDU C;  2DQR A;  2A5Y B;  2XPU A;  3C2B A;  5F0F A;  3SFI A;  3WTZ A;  2Q8K A;  2EB7 A;  3D0S A;  2Y69 H;  2KMU A;  4YIF A;  1WJD A;  1Y0N A;  2W82 A;  2GXB A;  5KAI C;  2ZME B;  3HOY J;  1D0X A;  2O8K A;  2M34 A;  3WTV C;  1FP2 A;  1JE8 A;  3HJE A;  3VOE A;  1SC7 A;  1I5Z A;  2D2W A;  4N0B A;  1J9I A;  3CDL A;  4AM3 A;  3CCJ I;  5FLX K;  1E0E A;  3RZO J;  4BJ6 C;  1AU7 A;  3F8F A;  3IWF A;  1HXD A;  2P0W A;  1U8R A;  3KCC A;  5E79 C;  4PFO A;  2PFB A;  3RYR A;  2NVQ J;  4PCQ A;  3U1K A;  3BWG A;  5JFR A;  2P5L C;  2KT0 A;  3MWM A;  5ICF A;  1VTN C;  1FEX A;  3GZ5 A;  4PJ0 C;  1WKM A;  3LSM A;  4LJZ F;  2ZXJ A;  1MNM C;  1HDP A;  3JRE A;  1FX7 A;  1ZG3 A;  3FHZ A;  3DF8 A;  3QU6 A;  2DW4 A;  2ELJ A;  1B4A A;  2WY8 Q;  5E8G A;  1KZH A;  2HPM A;  4HX7 A;  2IS4 A;  3FMS A;  2P81 A;  3OYL A;  2EFW A;  3H9J A;  4JX4 A;  1BI2 A;  4ETS A;  2HU9 A;  3JRA A;  5FLM J;  1RNL A;  3VYT B;  1XB4 A;  4A3C J;  1HOM A;  4NC7 A;  5C3E J;  1REP C;  3F3X A;  1X1B A;  2FNP A;  3CMA I;  4YIR X;  2V9K A;  1KQ9 A;  5HLT A;  3KLN A;  1CGP A;  2VUM J;  3PO2 J;  5J1R A;  1Z91 A;  2MD0 A;  1W7P B;  3BG7 A;  2HTJ A;  4CO8 A;  1HW1 A;  4RM3 A;  2LG4 A;  5D8L B;  4XLN F;  3AL0 C;  1OMI A;  3WTW C;  4A3L J;  4C30 A;  2EPF A;  2HXI A;  3EQL F;  1FTT A;  2XGX A;  2DFF A;  3ERE D;  3N97 A;  1B8I B;  2CQQ A;  3WG7 H;  4N4N B;  4BBR J;  1DP3 A;  1X3U A;  4E7K A;  1WH5 A;  1MJB A;  1POG A;  4YRV A;  4MEY F;  1WJB A;  2GM4 A;  2ZSI B;  2IS2 A;  2X1C A;  3KEY A;  4B3X A;  4OIN F;  5HOD A;  2QVO A;  2DQL A;  3CP8 A;  3BC8 A;  3RKW A;  4DYR A;  1BL0 A;  2ZC2 A;  1MMN A;  4G6Q A;  2C6Y A;  1ZRF A;  3BY6 A;  3GO5 A;  5LRS A;  5HDK A;  3HOS A;  5E17 F;  3LWF A;  3HM5 A;  2F48 A;  1XX5 A;  3EPZ A;  5K1Y A;  3FKJ A;  2XF7 A;  3K4J A;  5AIP A;  1VQO I;  2UWM A;  2A69 F;  3N4M A;  3EDP A;  2RDP A;  5B5E C;  4DZP A;  2HXO A;  4HNT A;  3ZQL A;  1QVT A;  1D0Z A;  4F52 A;  3DPU A;  3QQA A;  2NRA C;  2XF6 A;  2K9S A;  1BI3 A;  2CW8 A;  4KYW A;  3HOV J;  4IHT A;  3F23 A;  4JYK A;  3CD6 I;  5DCM A;  3P9K A;  2A07 F;  4B3A A;  1KQ8 A;  2OC6 A;  5J1Y A;  5E3O A;  2FU4 A;  3A0H C;  3Q0V A;  4QLC U;  5L3B A;  1HW2 A;  5KK1 A;  1MBF A;  1B59 A;  4EM2 A;  3OYN A;  1K4S A;  2WWY A;  2ZNZ A;  3CF5 F;  2OJE D;  2R92 J;  4BE1 A;  2DAO A;  2VXZ A;  1MNE A;  3CUO A;  1W5C C;  2JZY A;  3SZP A;  2O7O A;  2EV0 A;  4DYQ A;  4EM1 A;  3DEW A;  1MBH A;  4E6K G;  2BOL A;  1MH4 A;  3BOQ A;  3FK7 A;  4CYC A;  4OAY A;  4U7D A;  1YTY A;  4NBQ A;  1G6N A;  1XDS A;  2GIV A;  4XLH A;  1T6S A;  2X9D A;  4XL9 A;  4FE7 A;  3PIP F;  1LNW A;  4XMY A;  3HUG A;  4RAY A;  3L2W A;  3CQZ J;  2F4I A;  2EZI A;  3CJR B;  2RAE A;  3HIF A;  3KP4 A;  2NS8 A;  2EZL A;  4UVC A;  2PJR A;  3H3V K;  1IUY A;  3ASO H;  2JSC A;  3CCQ I;  4IO9 F;  2XRN A;  3FMQ A;  3V42 A;  2R3S A;  3EYI A;  2BW3 A;  1S6L A;  2HVS A;  3MD2 A;  4BQN A;  2I8D A;  3RSN A;  3H9G A;  3LQQ A;  1UG2 A;  2WBM A;  3HOX J;  4OIP F;  3VDX A;  4UVB A;  5HLI A;  3H5R A;  2WAE A;  3GXO A;  5LLQ A;  1YFH A;  1DPU A;  3OOP A;  1H9G A;  2PMZ A;  2NVT J;  1ETQ A;  4A12 A;  2O6G E;  2M87 A;  4I6Z A;  4H4K C;  2PEX A;  2R7W A;  1WJ5 A;  1TBX A;  2VN2 A;  3T8T A;  3JRC A;  2BGC A;  3QYE A;  1XD7 A;  2R7Z J;  3O8G A;  2DA3 A;  3F9K A;  3WHB A;  1X1C A;  1QHH D;  1ZHF A;  2DFE A;  1F5T A;  3FZV A;  5JI6 A;  2LH9 A;  2FBH A;  5E8I A;  2QYO A;  1ZN2 A;  2DDB A;  1LJ9 A;  2P8T A;  3COA C;  4Y15 A;  2QSH X;  3A1Y A;  5ILS A;  2W84 A;  1O4X A;  5K5Q A;  3DCF A;  1QZE A;  1BJZ A;  3QPT A;  3HC7 A;  3RPU A;  2MD5 A;  1FOK A;  1ACI A;  3LL7 A;  4AWX B;  1JKR C;  4AUX A;  4CH7 A;  1U5T C;  3HEF A;  1DP7 P;  5M5Y J;  2KDO A;  3LA3 A;  5KHD A;  2CFO A;  2PG4 A;  2DFI A;  4D9J A;  1XTA A;  4A5M A;  4DGW B;  2DK8 A;  2DA2 A;  3NWS A;  5FKK A;  4IX7 A;  2FMY A;  5E20 A;  1U78 A;  4DW6 A;  2WAQ N;  4IEJ A;  5LBQ A;  1A36 A;  2MC4 A;  5K7H A;  2G7H A;  3A2K A;  1W4M A;  3VYS B;  2DT5 A;  3PSF A;  3IL2 A;  3SXY A;  3IV5 A;  1ZGJ A;  5FGM A;  2EBI A;  2LRD A;  3LSI A;  3MAJ A;  4CIC A;  4AIH A;  1Y8Q B;  4HX4 A;  4ITV A;  2ADU A;  3HL2 A;  1YI2 I;  2CGP A;  4NDL A;  2M8G X;  1HW5 A;  4HST A;  4R8H A;  1YIO A;  3TO7 A;  1Q1V A;  2AQF A;  3Q5F A;  2GLO A;  1UHS A;  5K5O A;  2LFB A;  3W6J B;  3V8L A;  1GLN A;  1D5Y A;  4U0W A;  2KZV A;  1FC3 A;  3TO6 A;  1WFX A;  3ML6 A;  3G3Z A;  4RGS A;  4UUS B;  1AA7 A;  2VOD A;  4RAF A;  1R5I D;  1FOX A;  1FOY A;  1J59 A;  1ERD A;  2EZH A;  2VT3 A;  3IAS 2;  2W00 A;  4XLC A;  2X6Y A;  3KYL A;  3ABU A;  2CG4 A;  5LEJ A;  4PJM A;  2W7N A;  1TLH B;  5D4R A;  2QEN A;  2CUJ A;  5DV5 A;  1G3T A;  2HQR A;  1OFC X;  1YS7 A;  1BW5 A;  2RNJ A;  4IPA A;  4PJN A;  3FHN A;  4V19 K;  1FMW A;  3ABL H;  5HOO A;  3IWZ A;  4A3E J;  2VQG A;  1FT9 A;  3H0D A;  1F36 A;  2QBY B;  4IXA A;  2P7V B;  5J8F A;  3S2H J;  5JVG F;  5DD4 A;  3G1M A;  4BXF A;  1T95 A;  4CZZ A;  3ZGK A;  4ESJ A;  3S14 J;  4A0Y A;  1PVE A;  3JSP A;  4E4H A;  2EIL H;  1G59 A;  3OWT A;  3V7C A;  3ZN0 A;  5J4Y A;  2KIU A;  2JA7 J;  1IZ1 A;  4I0B A;  5CYV A;  2O3F A;  4N9H A;  1OQY A;  1OCR H;  2L3D A;  2P5V A;  1WJF A;  2CV1 A;  3S1M J;  1OR7 A;  2X85 A;  3CZ6 A;  3Q9V A;  4L9T A;  2BY0 A;  3IAM 2;  1ZGA A;  2XUB A;  2EZK A;  3WTS C;  4E7L A;  1Z21 A;  2DT7 B;  4LG3 A;  4OAZ A;  1I3A A;  4UVA A;  2XC7 A;  1BR4 A;  2M45 A;  3E5X A;  2IGK A;  2LY1 A;  2V6C A;  1XPX A;  1BW6 A;  5GP9 A;  1YIT I;  1T08 B;  5GAD J;  4A3D J;  4Q5S F;  2GA1 A;  4XOT A;  2HR3 A;  3DTE A;  4OIR F;  3RTR A;  5FFZ A;  3SEZ A;  4QPQ A;  4ENJ A;  1IXC A;  2DPD A;  2LKP A;  3IH2 A;  4EVI A;  3C3W A;  1FPQ A;  3OYF A;  5IYB J;  2BYV E;  3T5X A;  4EJV A;  3FXR A;  5DCF A;  1UMQ A;  1VQK I;  1SFK A;  2DMU A;  4HG2 A;  2PMZ N;  3I64 A;  2LK2 A;  4IJA A;  5IY5 H;  3C2G A;  3BZC A;  3QAH A;  5FO5 A;  4ESB A;  1IDZ A;  5IPA A;  1EJ9 A;  1KQ0 A;  2YR2 A;  4ON0 A;  3HXL A;  2IS1 A;  2OPT A;  5AON A;  1YX3 A;  2LTP A;  2YS9 A;  4JK1 X;  4RAG A;  5CQE A;  2ELH A;  1KYW A;  3PUB A;  2X48 A;  4ANJ A;  2ME0 A;  4RM2 A;  3QOE A;  1KON A;  3TMO A;  4KFC A;  1XG1 A;  5D5U B;  2UV1 A;  4EJU A;  2IW5 A;  4XOP A;  2WV1 A;  2ZJQ F;  1IJW C;  4XOR A;  5F6F A;  2ME6 A;  4A0X A;  1J7K A;  3WTY C;  2NXN B;  1XCB A;  2BE5 F;  2BW3 B;  2WAF A;  4P55 A;  1QBJ A;  1N75 A;  1BM9 A;  1TNT A;  4U7B A;  1R1U A;  3K2Z A;  5EEH A;  1P2F A;  1KGS A;  2Y0M A;  3QRF F;  1SFO J;  4PJL A;  1USS A;  1N78 A;  1TT5 B;  4F7Z A;  3I4M J;  3I4N J;  1Z3Y A;  5F1R A;  1IRX A;  3HUG B;  3DBR B;  1IG7 A;  4GGG A;  3M07 A;  1LVA A;  1X2M A;  4CCJ A;  3MKL A;  1E17 A;  2DOF A;  3DTK A;  2DCE A;  5IYD J;  4NB5 A;  5TGT A;  3MVP A;  1PDN C;  1OPC A;  5EDN A;  2W48 A;  1VQN I;  2LDU A;  3I5U A;  3OYM A;  4KIF A;  4HX8 A;  3KP2 A;  2GWR A;  1H9T A;  2DPU A;  2HPI A;  3TL4 X;  2MH9 A;  2HVR A;  4P9U A;  4M6Y A;  2QLZ A;  1X3W B;  5D4S A;  1EA3 A;  1B8I A;  2OF7 A;  1SFU A;  4N9I A;  2XDV A;  1OLT A;  3MKZ A;  4V2G A;  4M6X A;  4HV6 A;  3LQR A;  4E7H A;  1BOB A;  4JOM A;  4BAY A;  3JAM Z;  2K40 A;  2JRT A;  3FXK A;  1JGG A;  4UUV A;  4ZTF A;  3H5A A;  2JWT A;  3CC4 I;  1W7P A;  3TW6 A;  3JRB A;  3BR0 A;  2VBW A;  1F9N A;  3RPQ A;  2L7F P;  3M1E A;  2D45 A;  1ZRE A;  1WGX A;  4RDU A;  1SMY F;  2R4G A;  3O6B B;  3K9T A;  4BHB A;  2HDW A;  2H27 A;  4X0G A;  2I5U A;  3FF5 A;  3J80 Z;  1WH7 A;  1X1D A;  3ASN H;  3LAJ A;  1RR8 C;  2JN6 A;  3F8N A;  3KP3 A;  4LIU A;  5C4X J;  3QP5 A;  3RKQ A;  5K7F A;  1FP1 D;  1RKT A;  3W2W A;  2OZU A;  2PMU A;  3DBL B;  1CF7 B;  5CVR A;  4RLQ A;  1MD0 A;  5IT9 Z;  4UNO A;  4AIJ A;  3CUQ A;  2FJ1 A;  3BT9 A;  3E7L A;  2VPR A;  3ZQI A;  2KRH A;  4X1E A;  1RR7 A;  1S8N A;  1LB2 A;  1S29 A;  4OU0 A;  2JA5 J;  5B1A H;  5M5X J;  5LRR A;  3WTU C;  1JKQ C;  1BIA A;  2OTJ I;  4EGZ A;  3AFH A;  1I6X A;  3ZMD A;  5TRD A;  3L7W A;  3SDB A;  1IAW A;  2GZW A;  3A02 A;  3NEU A;  2X6X A;  2F6C A;  3EUA A;  1STZ A;  5D8K B;  1MMS A;  3M8E A;  4IQJ A;  3CUQ B;  5CVJ A;  1HC8 A;  4IOA F;  3BG9 A;  3NWT A;  1ONV A;  2YU3 A;  2XGC A;  2Y48 A;  1HKQ A;  1HF0 A;  4I2O A;  4HOB A;  3DLL F;  3OMY A;  4XKC A;  4ZYG A;  3E6C C;  4LMY A;  1XSV A;  2CSO A;  1EKE A;  3FXJ A;  4R79 A;  1FOW A;  3EUK L;  5LHG A;  3MZY A;  2BHZ A;  4XLE A;  4DZJ A;  2DOE A;  2JVG A;  2X6W A;  2DK5 A;  2EK5 A;  3M9A A;  3S1N J;  3MZH A;  3DFG A;  2VI6 A;  4J19 A;  4G6T B;  1S9H A;  4BH9 A;  2B7E A;  4C2M J;  4FAS D;  3HOZ J;  2J5O A;  2VIX A;  1WJC A;  5DYM A;  3GTK J;  3EUH C;  3IH3 A;  4G12 A;  1OYW A;  4HNU A;  4WXH A;  2H6B A;  4FTH A;  2V1U A;  1FWZ A;  4IHW A;  5E1X A;  4PJJ A;  1ZR2 A;  2O61 A;  2W4S A;  2O9L A;  4EJO A;  2MC3 A;  3V7S A;  4GYI A;  5JHF A;  4S04 A;  3FKI J;  2Q0O A;  4L9N A;  4AYB N;  1YX5 A;  3LSG A;  3MCZ A;  4CDG A;  5B1B H;  3QP6 A;  1TC3 C;  3DKY A;  2XHK A;  3CTA A;  2FXA A;  2KPM A;  3PNV A;  2VJJ A;  2HYG D;  2ZME A;  4AC0 A;  1QA6 A;  4BBS J;  3J81 K;  1Y8R B;  2QZ8 A;  2XF5 A;  2L7M P;  4M72 A;  3EUH A;  1R1V A;  1FBS A;  1MJA A;  3BG5 A;  4JP0 A;  1VQ6 I;  3CCV I;  4O5V A;  2PLY A;  4Z6Y A;  3OSG A;  2MLK A;  4BY7 J;  2FML A;  3RIR A;  5ILU A;  2VLA A;  2QSG X;  1W36 C;  2M1B A;  3GZN B;  4ESF A;  2HQA A;  2R5Y A;  1N25 A;  3L2Q A;  2ID3 A;  2HKX A;  4M6V A;  1ZLK A;  3F6V A;  1VZ0 A;  2ZFU A;  4P96 A;  1S3J A;  1QVU A;  4RBO A;  1BI0 A;  3L2R A;  3KZI C;  3CP2 A;  3REO A;  1MJ9 A;  2DYR H;  2ZME C;  2K3F A;  2R7S A;  2AHQ A;  4M3E A;  2A5W A;  4LB5 A;  5E1Z B;  3LMM A;  2F2E A;  1OCC H;  1W5S A;  1BC8 C;  2QQ9 A;  1D1B A;  3UKG A;  2CJJ A;  5K7Z A;  2XAH A;  3OIP A;  4M73 A;  5KAF C;  2L7Z A;  3VOD A;  3F8B A;  4HQE A;  5LEK A;  4GXO A;  1VQ9 I;  1R5H A;  1IXR C;  3FBN B;  3DP7 A;  1LEB A;  3J80 K;  1Z7U A;  4HF2 A;  3RCO A;  1RI7 A;  1X1P A;  5DM6 F;  1VQ8 I;  1T0F A;  3S3M A;  2RVC A;  1SVM A;  1GHC A;  2P5K A;  2RNG A;  3T0Y A;  1TTY A;  4HA8 A;  1N77 A;  1XSD A;  2QGU A;  3PNT A;  4QSH A;  1Z6T A;  1QRY A;  2OQR A;  1A04 A;  1DU6 A;  3K1N A;  1D5V A;  3KP7 A;  3R0J A;  3L9F A;  4MFE A;  3WGI A;  1ZG5 A;  4PUS A;  3HRT A;  3BG6 A;  4PZJ A;  2R7O A;  4ZDL A;  3GTJ J;  1GDT A;  4WXC A;  2WB1 N;  3DU6 A;  3E6D A;  4BHP A;  3IP4 B;  3ZOB A;  2Y0S A;  4I01 A;  2FE3 A;  3A01 B;  1QU3 A;  2X4H A;  5FKO A;  2K9N A;  1TW3 A;  1SFX A;  2L54 A;  2FSW A;  1ZG1 A;  5L3G A;  3QYB A;  4BS9 A;  3S3N A;  2R5Y B;  1GVJ A;  3VSK A;  5E1W A;  2LBF B;  1LDD A;  3I58 A;  2V1D A;  3MQ0 A;  3PJR A;  3E1S A;  4LK1 F;  5HS9 A;  2RN7 A;  3H92 A;  1MBG A;  5CVU A;  2XAQ A;  3B73 A;  4IRI A;  1WWX A;  3K4M A;  2TCT A;  4PK4 A;  1TZL A;  4QIW N;  5KCM A;  2RV8 A;  3F8C A;  1PYV A;  4NC8 A;  3SZT A;  4XSX F;  1D8K A;  1O3Q A;  2EIJ H;  2L01 A;  2DOD A;  3W6V A;  4XRM A;  2FOW A;  4TV7 A;  2R93 J;  4BNC A;  2A6H F;  2V1N A;  3RQI A;  1PJR A;  5GAG J;  3BTJ A;  4G7Z F;  2HOT A;  1GUU A;  1OIS A;  5ICC A;  1KU9 A;  1KU2 A;  5C44 J;  2BZT A;  2MSY A;  4I99 C;  4DBQ A;  1QZY A;  3PIO F;  2ZJP F;  5JHU A;  3ISP A;  3LSP A;  3KYC B;  3FDY A;  1MMA A;  2K9Q A;  1YQA A;  3K4N A;  2ZXI A;  2L4M A;  2QM3 A;  1WPK A;  4MGR A;  2Q1Z B;  2W85 A;  5BNG A;  4LD5 A;  4LLG F;  1TT0 A;  2IGM A;  4UUT A;  3RZD J;  4AD9 A;  3WE3 A;  1IGN A;  1QHG A;  2OUM A;  2X0L A;  5E3L A;  3OYB A;  1YW8 A;  1IUF A;  2HZD A;  1QNT A;  4LB6 B;  2L9S A;  4YFK F;  2MA3 A;  3VFZ A;  5E3N A;  3MMY B;  2VAS A;  3BR3 A;  1VQM I;  1DQU A;  1ZH5 A;  3ZR8 X;  2OD5 A;  1NK3 P;  2OV7 A;  3HTU A;  4A3J J;  1P4W A;  1TL8 A;  1P4A A;  2DN0 A;  1ZAR A;  2MH2 A;  1ZLJ A;  1EV7 A;  1VF9 A;  4DJA A;  2KIS A;  3DWL E;  3LA7 A;  1SVO A;  4KIB A;  1T56 A;  3GFL A;  4CHU A;  1FYL A;  3M7G A;  4CCM A;  3SFZ A;  1A31 A;  1DGR M;  2A61 A;  5LD2 C;  1B9M A;  5H2F C;  5DDG A;  1RET A;  1LKX A;  3WU1 B;  4G7O F;  3HB9 A;  1MSE C;  3N05 A;  2M8E A;  2BY3 A;  1NG6 A;  4HPQ A;  4L5J A;  5IOY A;  3O8H A;  1OCT C;  3UNG C;  5EEA A;  2QSF X;  3DV8 A;  3I9V 2;  4P9F A;  1TW2 A;  4PGH A;  3OYJ A;  4CSW A;  1FYM A;  3OS0 A;  2EQR A;  2Y0S N;  4G9Y A;  2JTV A;  4CCL A;  4HW0 A;  4AYB A;  1IO2 A;  1QZZ A;  1Y1V J;  2WAQ A;  3LA2 A;  3JRH A;  1MDM A;  3F6O A;  3SZG A;  3K69 A;  4A3G J;  3LFU A;  4G6D A;  2OCC H;  2ZO4 A;  2KZG A;  2Y30 A;  2BEO A;  1J2X A;  2B9S A;  4NNJ A;  1Y1W J;  2K02 A;  5JLX A;  3FK6 A;  1BBY A;  2JUC A;  2GOM A;  2LP0 A;  3H3Z A;  3HTS B;  1LUJ B;  2LBF A;  1G2H A;  2E2J J;  3MKW B;  3FMR A;  2V9P A;  2VC0 A;  3O2P E;  3SJM A;  3FM5 A;  2OTL I;  4XKW A;  4EAT A;  1Z05 A;  4LGW A;  2MW8 A;  2D1H A;  3S2W A;  3ERM A;  1Q1H A;  1JKP C;  1LDJ A;  5HVQ C;  5IYC J;  4A3K J;  1ETK A;  2E5Z A;  4Y4R A;  3O3K A;  4FHT A;  2JA6 J;  3IKV A;  3E3V A;  4CGZ A;  3GX4 X;  4HQM A;  1AKH B;  2WY7 Q;  2VB6 A;  2W25 A;  3LNQ A;  2KJC A;  1JTX A;  2Y2Z A;  1ZKG A;  1EH7 A;  3R4K A;  2GXA A;  1IN5 A;  2R5Z A;  4IRG A;  4GDF A;  1ITY A;  1X58 A;  1UHM A;  1ZQ3 P;  4F55 A;  2VT2 A;  1VQ5 I;  1OKR A;  4KN7 X;  1YOV B;  3BRO A;  1V3F A;  2L02 A;  2XB5 A;  4D5C A;  1SD6 A;  2GOX B;  1F4K A;  1UAA A;  4IHV A;  1JHH A;  4XQF A;  1OCP A;  2QQB A;  3L2U A;  2P6S A;  4WF2 A;  5M5W J;  5C4J J;  2F5E A;  1Y39 A;  2F5V A;  3L09 A;  2CUF A;  3DTI A;  1WJE A;  3OV8 A;  4E7S A;  5FRM A;  2M5W A;  1FYK A;  4XRS G;  1U0J A;  3HRU A;  1X4P A;  3RI4 A;  3HG9 A;  4UV8 A;  3F0C A;  3OYI A;  2WA0 A;  1P92 A;  4Y3O A;  1B9N A;  2Z5U A;  3QPH A;  2R5Z B;  1UJ8 A;  2Q2E A;  2DTR A;  2F5C A;  2WAD A;  3CC7 I;  3WHC A;  3GW2 A;  3CCM I;  1A6I A;  1KU7 A;  2COM A;  2EV6 A;  3RKX A;  5GPC A;  3T8R A;  5IOZ A;  2EA4 A;  1AWC A;  4II3 A;  3G6E I;  2P4W A;  2IJL A;  3KZY A;  4M74 A;  1UB9 A;  3ZCO A;  3DPL C;  2ZFW A;  4Y33 A;  5E18 F;  2QBY A;  3E97 A;  3GFM A;  4M3F A;  3TDZ C;  2M7B A;  3DKW A;  1NH3 A;  3W3C A;  3ZMS A;  5HLG A;  3K2A A;  3CCR I;  3AAF A;  3GUD A;  2HNH A;  2OU2 A;  2M2E A;  4XKV A;  2LY2 A;  4HSR A;  2QA4 I;  1XSX A;  2ZKZ A;  2Z3Y A;  4YFN F;  4ZYH A;  1WJA A;  4S0H B;  4ENM A;  5ICG A;  3FXO A;  1O7F A;  1VND A;  1T33 A;  4B48 A;  2LY9 A;  4B8X A;  1AHD P;  4BQA A;  5F0H A;  5B66 C;  3ZMZ A;  2H6C A;  5LHH A;  3E0J B;  1SD7 A;  1FIA A;  2M4K A;  4DQ2 A;  1UST A;  1UG0 A;  2E1M C;  2JPB A;  2R7T A;  4XLA A;  3L00 A;  3SHF A;  2HOA A;  4RB0 A;  3EET A;  1LDK B;  4IHY A;  3J81 Z;  3I3L A;  3ULQ B;  3CDH A;  4L9J A;  2IBD A;  4MTD A;  3GTO J;  1SAN A;  2ZXH A;  2HWV A;  1LEA A;  4NC6 A;  2MBF A;  2VXD A;  3JR9 A;  1YW9 A;  4AID A;  4Y7N J;  2EFO A;  2QQ8 A;  1BJA A;  2XB0 X;  4B1R A;  4IHX A;  2VKV A;  4XLF A;  1LPQ A;  1U2W A;  3BCB A;  3ZQG A;  4L0Y B;  2DJN A;  4YEJ A;  1K78 A;  4GRI A;  2KRF A;  1D8J A;  3PQK A;  1NTC A;  4CCN A;  5A2Q K;  1E2X A;  1I50 J;  1L0O C;  3IRR A;  2CO5 A;  5HS8 A;  1KYZ A;  2VBZ A;  3FXQ A;  1O3R A;  2CS3 A;  1R49 A;  3P7N A;  2HEO A;  4IVN A;  2ELK A;  4UB8 C;  4Q4Z F;  1XDU A;  4ZZD A;  1J5Y A;  4Y13 A;  5M3F J;  4UXN A;  1IV6 A;  4HBL A;  4RB2 C;  2LMD A;  1XGS A;  4BE2 A;  3G71 I;  2ISZ A;  3HRS A;  2R7R A;  1JUM A;  3DU5 A;  4ZZL A;  3K10 A;  1YYV A;  2K27 A;  2HFH A;  1YJ9 I;  3AG1 H;  4ZYD A;  3E6M A;  3I59 A;  1MND A;  1X1A A;  3ZPL A;  3OIO A;  4HZF A;  2NVU B;  1PP8 F;  5CJ9 A;  2GBY A;  2ZB9 A;  4C2U A;  1T2K A;  1R22 A;  1MKM A;  1I6H J;  1H89 C;  5FLV A;  1YIJ I;  4B09 A;  2FBK A;  2NS7 A;  3KE2 A;  4HRI A;  2HS5 A;  1J0R A;  3DEU A;  1T8I A;  3DEE A;  4L5E A;  5LGT A;  1TWH J;  4Q47 A;  2BV6 A;  2YSR A;  3SDG A;  4GCV A;  3GME A;  2NOJ B;  2MYS A;  2W24 A;  1MMD A;  3TQN A;  5GTH C;  3OR1 C;  2Y9Y A;  3PFI A;  2LKX A;  2M3A A;  2OZ6 A;  4IKF A;  3LSR A;  4XM3 A;  2KIM A;  1OYY A;  2M0C A;  2CUE A;  1HA8 A;  1WRJ A;  3CCL I;  2HYF A;  3BPX A;  3TKY A;  1ZGW A;  1CF7 A;  1YRN A;  3TP3 A;  2GIZ A;  1A35 A;  1MSF C;  2P6T A;  3ZQC A;  5BOX A;  3H0G J;  2FBI A;  3MZ8 A;  2UXN A;  4ZC3 A;  4V2F A;  2R7D A;  2H8W A;  2FRH A;  2E71 A;  4A6D A;  3OYC A;  1VQP I;  2PI0 A;  2NOG A;  1S7E A;  3PSI A;  3BR2 A;  1RZ4 A;  5J47 A;  3FXM A;  4QWQ A;  5LFA A;  2PJR B;  2AXT C;  2QUF A;  3K4K A;  3CME I;  4H0E A;  4BDY A;  4ZJZ A;  2JA8 J;  2QQA A;  2A6T A;  2VE9 A;  1JT0 A;  4KT6 A;  3CCS I;  2XGD A;  2E19 A;  2V9V A;  3P9I A;  4BGD A;  3GTG J;  2L2O A;  3K1M A;  4BJ5 C;  3QU3 A;  1E3O C;  4X6A J;  3S32 A;  1A6Q A;  2HQ5 A;  5H20 A;  3R0A A;  4I02 A;  2YX4 A;  3BTI A;  5F0C A;  3OL3 A;  3LAP A;  1UZC A;  3A0B C;  3C1D A;  3QWL A;  1ORK A;  2B0L A;  2V1X A;  3PFY A;  1MBK A;  3OS1 A;  5L3C A;  3CJT B;  1IXS B;  4JX6 A;  1SMT A;  4NHJ A;  1V55 H;  1YHQ I;  4XLP F;  3L2V A;  4KIC A;  4U87 A;  1HDD C;  4A69 C;  3KX2 A;  4I7H A;  4A93 J;  1I3Q J;  3D5L A;  1ULY A;  3HKZ N;  4R1H A;  3NAU A;  2K5C A;  2VL8 A;  2E7X A;  3GCM A;  1T98 A;  1H0M A;  2JRM A;  1PUF A;  3GVA A;  1B6A A;  5EJC A;  5D5W B;  1FJL A;  2K85 A;  1J75 A;  4N4O B;  3OY9 A;  3FIS A;  4XBF A;  2AXL A;  2XSJ C;  1ETV A;  4I98 B;  3GYH X;  2A6E F;  4BL0 B;  2PJP A;  2DYS H;  3TGN A;  2XV4 S;  2ESN A;  5EZG A;  4CYC B;  1VQ7 I;  1LFP A;  4BXX J;  2VPL A;  4A3M J;  3BZK A;  2FX0 A;  1H88 C;  2JUG A;  3VEP A;  5F1J A;  2BVL A;  1GVD A;  3K4L A;  3DQV C;  1G8X A;  1U9O A;  1ODD A;  1ZTR A;  2LC2 A;  2W57 A;  3ZRG A;  4C9Y A;  5BPI A;  1PUE E;  2UXX A;  2A05 A;  2L4A A;  3S1R J;  3P9C A;  1UCR A;  3ZQQ A;  3LOC A;  2O5R A;  4FQG A;  2RQQ A;  1FY7 A;  2R7Q A;  4FX0 A;  4GO1 A;  2Z99 A;  2ZBK A;  5HS7 A;  5J40 A;  3BJ6 A;  5F04 A;  1MIJ A;  3I53 A;  1V5G A;  3T1B A;  1R00 A;  5DM7 F;  2DJI A;  4LLL A;  1IN7 A;  3OIQ A;  5TJJ A;  2R7X A;  2BHY A;  1R4N B;  3BR5 A;  1OR7 C;  1WHU A;  1I39 A;  1V5E A;  1VI0 A;  3I0T A; 
#chains in the Genus database with same CATH homology
 3ABT A;  4YII A;  5J6X A;  2ACJ A;  4WWC A;  2HTS A;  4HDU A;  2IA2 A;  4I0A A;  1ZYR F;  2EFN A;  2ESH A;  1FNN A;  2A3S A;  1P6R A;  2RC4 A;  1ZAO A;  4KIG A;  4XSZ F;  5D5X B;  1P4X A;  1TQM A;  4EGY A;  3WE2 A;  1EH6 A;  4EV0 A;  4HV5 A;  1C0W A;  2IP2 A;  3U1D A;  1WQ2 A;  2RKH A;  3HSE A;  1YO5 C;  1RUO A;  4P5O A;  1XGM A;  3TOB A;  3ZMT A;  3CUQ C;  4K2E A;  1FBQ A;  2XAS A;  4HLY A;  1BOA A;  3ZP5 A;  2OAZ A;  3F21 A;  4L9V A;  3TOA A;  4ENK A;  5FB2 A;  2IPQ X;  3ECH A;  3Q9S A;  4A2U A;  3ZMV A;  2NYX A;  3BDD A;  3KP5 A;  2AS5 F;  4M9S A;  4YG2 F;  2MLG A;  2D1V A;  1Y0U A;  4HF1 A;  4ASN A;  3V4G A;  4L5I A;  1JGS A;  1TQI A;  2VBY A;  2VOP A;  1FLI A;  1Z6R A;  5BQT A;  1R23 A;  1HSJ A;  4BYY A;  2FOK A;  1IN6 A;  2HOE A;  3E5U A;  5ERI A;  4EQQ A;  3L2C A;  3G73 A;  3DXJ F;  5DUI A;  3WOD F;  2G9W A;  1S7A A;  4JBA A;  1R7J A;  4BHC A;  1MGT A;  3RKY A;  1W5T A;  3ROU A;  1V4R A;  5IT3 A;  4KUM A;  4M71 A;  3GZ6 A;  3WGH A;  3LST A;  3WGG A;  1XMK A;  2DI3 A;  2E7W A;  4Q48 A;  3BPV A;  5BPD A;  2EFP A;  3HRM A;  2RGV A;  1QPM A;  3WG9 A;  5BS6 A;  3JTG A;  3CO6 C;  3HHH A;  1K7A A;  2GA2 A;  1IN4 A;  4OOI A;  3WU0 A;  2WV0 A;  1GXP A;  2CWE A;  3JW4 A;  3R60 A;  2BBY A;  5HDN A;  1KA8 A;  4MEX F;  4MQ9 F;  5FD5 A;  1SFE A;  3R6S A;  2V79 A;  4GYG A;  5A2Q Z;  4RGR A;  4A5N A;  4AIK A;  4IHS A;  3K0L A;  3F22 A;  1GXQ A;  3GLX A;  5LGN A;  1UHW A;  1IF1 A;  2J5P A;  4RS8 A;  2K7L A;  3GEZ A;  2XAJ A;  5L3F A;  5DCM B;  1NHA A;  1DDN A;  1WSU A;  5FLX Z;  3I59 B;  1B1B A;  3I54 A;  3FXU A;  2DBB A;  3MFK A;  3ELK A;  2VC1 A;  5LGU A;  3KEO A;  2XKP A;  4HLX A;  4M9Z A;  2E1N A;  4HDV A;  1BIB A;  5ICE A;  3ZMU A;  3KFW X;  1PP7 U;  2RQP A;  2OBP A;  4RGX A;  2OA4 A;  2KKO A;  1ON1 A;  1I1G A;  2IA1 A;  2PQ8 A;  4OMY A;  4MNU A;  1U5T A;  3KLO A;  4IF4 A;  4KA4 A;  4LG0 A;  2H09 A;  1SAX A;  1QQI A;  4U0V A;  3CO7 C;  5DEQ A;  4S05 A;  2CFX A;  2P7C B;  4OMZ A;  4RAZ A;  2JT1 A;  4L0Z B;  2DO7 A;  2HGC A;  3MEX A;  4KT5 C;  1U5T B;  4XRF A;  4ENN A;  3FWE A;  5FD6 A;  4JQF A;  3K1P A;  1XCV A;  2VBX A;  5LHI A;  5ED4 A;  4Y17 A;  4FX4 A;  5ILV A;  1IRF A;  4PDK A;  2XAG A;  3JSO A;  2FF4 A;  3V8K A;  1YLF A;  3NQO A;  4YFX F;  2CYY A;  2K86 A;  2O03 A;  2FA5 A;  2GQQ A;  3GFJ A;  3RJP A;  2ZCW A;  2XAF A;  1YG2 A;  4DNC A;  1YW7 A;  2IRF G;  4G94 A;  1AOY A;  2ZJ2 A;  2HKO A;  1O57 A;  2EA2 A;  2ZNY A;  1ON2 A;  1JHF A;  2PN6 A;  2ETH A;  5L3E A;  1T38 A;  3KZZ A;  2DU9 A;  3F8M A;  5KVR A;  2WC2 A;  1U6G A;  2Z9O A;  1RUN A;  1TQP A;  1LQ1 A;  1RIO H;  1HST A;  4MHG A;  3J7A O;  2HZT A;  4HYE A;  2O0Y A;  1O7L A;  5DD8 A;  5K5R A;  1TNS A;  2Z33 A;  5DUK A;  4WCG A;  3VB2 A;  3U9G A;  1FBU A;  2WTE A;  3BP8 A;  2STT A;  4U88 A;  4RGU A;  4RB1 A;  1ZRD A;  5CVV A;  3V7R A;  1R5G A;  2YPR A;  4BXU A;  2R7F A;  3W6K B;  2NNN A;  6PAX A;  1HKS A;  5IT9 K;  1QO0 D;  1T39 A;  2KIF A;  1Z9C A;  5HDG A;  1DPR A;  2EWN A;  1IW7 F;  5FFX A;  3CLO A;  4U0Y A;  1HQC A;  4G8X A;  1FSH A;  4HF0 A;  3IC7 A;  3JAM K;  2LSO A;  4WXD A;  4UV9 A;  2H94 A;  1O3S A;  4AVP A;  2NNY A;  1MDM B;  5AIQ A;  4LLN A;  3E6B A;  2HDC A;  1I1S A;  2XKO A;  3RYP A;  3IRQ A;  1OYI A;  2LF8 A;  2YX7 A;  3KET A;  2VON A;  4HAM A;  5BMZ A;  1W7P D;  1I27 A;  1JXS A;  1XGN A;  3PQJ A;  5JR3 A;  1SD5 A;  2FEZ A;  1XN7 A;  4G7H F;  2JPC A;  3EYY A;  3FM3 A;  4RB3 C;  3NRV A;  4E70 A;  2NAZ A;  2OQG A;  1FZP B;  1SD4 A;  2FNA A;  1ZRC A;  2DLL A;  2UZK A;  3B02 A;  1U3E M;  3GWZ A;  1D3Y A;  4EMS A;  1S7O A;  1R1T A;  4NQW A;  4OIQ F;  2KJB A;  3GF2 A;  2LF7 A;  1BC7 C;  4O3M A;  2GAU A;  5D6E A;  4M9X A;  5L3D A;  3TO9 A;  4OIO F;  2Y75 A;  4CXF A;  3BJA A;  2ISY A;  2EV5 A;  4CYD A;  1R36 A;  4UHT A;  4LFU A;  1G4D A;  3FX3 A;  1QGP A;  4FT8 A;  3WTX C;  2QWW A;  2K4B A;  3ZN1 A;  3V8J A;  5HLH A;  5H6R A;  4MTE A;  5EEG A;  2EFQ A;  4IRH A;  2XVC A;  2GXG A;  2O8X A;  2E1C A;  2TDX A;  1K78 B;  4EJT A;  2VOO A;  2CQK A;  3ECO A;  2IA0 A;  2M30 A;  4L18 B;  3H3U A;  4LG0 B;  5D6F A;  4WK8 F;  3WTT C;  3HYI A;  1MZB A;  4WX9 A;  3SQN A;  4A0Z A;  5F64 A;  1BI1 A;  3BZ6 A;  4KN4 X;  3ZQ7 A;  2A68 F;  1HKT A;  4ZH4 F;  2HQN A;  1IN8 A;  3HOT A;  3I4P A;  2LNB A;  1XMA A;  1K79 A;  3IKT A;  1F1Z A;  4KNY A;  4ZYE A;  4LK0 F;  5J8C A;  1G3Y A;  3HSF A;  4A6E A;  3HHG A;  1KU3 A;  1R58 A;  4EJW A;  2IT0 A;  1DUX C;  2F5F A;  4D0P A;  4KMU X;  1UFM A;  3E5Q A;  2XIG A;  3M8F A;  1IRG A;  3KP6 A;  3F72 A;  2F5D A;  5CVI A;  1G3S A;  2CW0 F;  2EJR A;  1WI9 A;  3C7J A;  1Z1D A;  3JTH A;  3KEQ A;  2STW A;  4EM0 B;  3C18 A;  3HSR A;  1XGO A;  3IHU A;  2VE8 A;  4I09 A;  2NS0 A;  3RDI A;  3GFI A;  1HBX G;  3R61 A;  2K4J A;  4PGG A;  2PMH A;  2PBI A;  4KMF A;  1G3W A;  5CLS A;  2IVM A;  3BJO A;  1EH8 A;  2XRO A;  1K6O A;  2FQ3 A;  3U2R A;  1FSE A;  1O3T A;  1YS6 A;  3I71 A;  2G7U A;  3QOP A;  4O6J A;  1BN5 A;  4MQV A;  3LFK A;  4KDP A;  4Z2Y A;  3DPT A;  5JVT A;  5H6Q A;  1L3L A;  5D5V B;  3CJN A;  3TDU C;  2DQR A;  2A5Y B;  3WTZ A;  2Q8K A;  2EB7 A;  3D0S A;  4YIF A;  2GXB A;  2ZME B;  3WTV C;  1FP2 A;  1JE8 A;  3VOE A;  1J9I A;  1I5Z A;  2D2W A;  4N0B A;  5FLX K;  3F8F A;  3IWF A;  1HXD A;  1U8R A;  3KCC A;  2PFB A;  3RYR A;  4PCQ A;  3BWG A;  5JFR A;  2P5L C;  1VTN C;  3MWM A;  5ICF A;  3GZ5 A;  1WKM A;  4LJZ F;  2ZXJ A;  1FX7 A;  1ZG3 A;  3FHZ A;  3DF8 A;  3QU6 A;  2DW4 A;  1B4A A;  5E8G A;  4HX7 A;  3FMS A;  2EFW A;  1BI2 A;  4ETS A;  1RNL A;  1XB4 A;  1REP C;  3F3X A;  2FNP A;  1KQ9 A;  3KLN A;  1CGP A;  1Z91 A;  1W7P B;  2HTJ A;  4CO8 A;  1HW1 A;  5D8L B;  4XLN F;  1OMI A;  3WTW C;  3EQL F;  2XGX A;  3ERE D;  3N97 A;  1X3U A;  1MJB A;  4MEY F;  4OIN F;  2QVO A;  2DQL A;  3RKW A;  4G6Q A;  2C6Y A;  1ZRF A;  3BY6 A;  3GO5 A;  5LRS A;  5HDK A;  3HOS A;  5E17 F;  3LWF A;  5K1Y A;  5AIP A;  2UWM A;  2A69 F;  3N4M A;  3EDP A;  2RDP A;  2NRA C;  1BI3 A;  4KYW A;  4IHT A;  3F23 A;  5DCM A;  3P9K A;  2A07 F;  1KQ8 A;  2FU4 A;  4QLC U;  5L3B A;  1HW2 A;  5KK1 A;  1B59 A;  4EM2 A;  2WWY A;  2ZNZ A;  2DAO A;  2VXZ A;  3CUO A;  2JZY A;  3SZP A;  2EV0 A;  4EM1 A;  3BOQ A;  4U7D A;  1YTY A;  1G6N A;  1XDS A;  2GIV A;  1T6S A;  1LNW A;  3HUG A;  4RAY A;  4UVC A;  3HIF A;  3KP4 A;  1IUY A;  2JSC A;  2XRN A;  3FMQ A;  2R3S A;  3EYI A;  1S6L A;  3LQQ A;  4OIP F;  4UVB A;  5HLI A;  3GXO A;  5LLQ A;  1YFH A;  1DPU A;  3OOP A;  1H9G A;  4A12 A;  2O6G E;  2M87 A;  2PEX A;  1TBX A;  2VN2 A;  3T8T A;  2BGC A;  1XD7 A;  1ZHF A;  1F5T A;  3FZV A;  5JI6 A;  2FBH A;  5E8I A;  2QYO A;  1ZN2 A;  1LJ9 A;  2P8T A;  3COA C;  4Y15 A;  5ILS A;  2W84 A;  5K5Q A;  3QPT A;  3RPU A;  2MD5 A;  1FOK A;  4AWX B;  1U5T C;  1DP7 P;  3LA3 A;  2PG4 A;  2DFI A;  4A5M A;  2DK8 A;  2FMY A;  5E20 A;  1U78 A;  5LBQ A;  2G7H A;  1W4M A;  2DT5 A;  3IL2 A;  3SXY A;  1ZGJ A;  5FGM A;  3MAJ A;  4CIC A;  4AIH A;  4HX4 A;  2ADU A;  2CGP A;  1HW5 A;  4R8H A;  1YIO A;  3TO7 A;  3Q5F A;  5K5O A;  3W6J B;  3V8L A;  4U0W A;  1FC3 A;  3TO6 A;  3ML6 A;  3G3Z A;  4RGS A;  2VOD A;  1J59 A;  2VT3 A;  3ABU A;  2CG4 A;  5LEJ A;  1TLH B;  5D4R A;  2QEN A;  5DV5 A;  1G3T A;  2HQR A;  1YS7 A;  2RNJ A;  4IPA A;  5HOO A;  3IWZ A;  1FT9 A;  2QBY B;  4IXA A;  2P7V B;  5J8F A;  5DD4 A;  4CZZ A;  4ESJ A;  4A0Y A;  3JSP A;  3V7C A;  3ZN0 A;  2KIU A;  1IZ1 A;  4I0B A;  5CYV A;  2O3F A;  4N9H A;  2L3D A;  2P5V A;  1OR7 A;  3Q9V A;  4L9T A;  1ZGA A;  2XUB A;  3WTS C;  4UVA A;  2M45 A;  3E5X A;  2V6C A;  4Q5S F;  2GA1 A;  2HR3 A;  4OIR F;  3RTR A;  5FFZ A;  4ENJ A;  2DPD A;  1IXC A;  2LKP A;  4EVI A;  3C3W A;  1FPQ A;  2BYV E;  3T5X A;  4EJV A;  3FXR A;  5DCF A;  3I64 A;  4IJA A;  3QAH A;  5FO5 A;  4ESB A;  1KQ0 A;  2YR2 A;  4ON0 A;  5AON A;  4JK1 X;  2ELH A;  1KYW A;  4KFC A;  5D5U B;  4EJU A;  2IW5 A;  5F6F A;  4A0X A;  1J7K A;  3WTY C;  1XCB A;  2BE5 F;  4P55 A;  1QBJ A;  1BM9 A;  1TNT A;  4U7B A;  1R1U A;  3K2Z A;  5EEH A;  1P2F A;  1KGS A;  2Y0M A;  3QRF F;  1USS A;  4F7Z A;  5F1R A;  4GGG A;  1LVA A;  1E17 A;  4NB5 A;  1PDN C;  1OPC A;  2LDU A;  3I5U A;  4KIF A;  4HX8 A;  3KP2 A;  2GWR A;  1H9T A;  2DPU A;  2MH9 A;  4P9U A;  4M6Y A;  2QLZ A;  5D4S A;  1SFU A;  4N9I A;  4M6X A;  4HV6 A;  3LQR A;  4BAY A;  3JAM Z;  2JRT A;  4UUV A;  1W7P A;  2VBW A;  1F9N A;  3RPQ A;  3M1E A;  2D45 A;  1ZRE A;  1SMY F;  3O6B B;  3K9T A;  4BHB A;  2H27 A;  3FF5 A;  3J80 Z;  3LAJ A;  3F8N A;  3KP3 A;  3QP5 A;  1FP1 D;  2OZU A;  2PMU A;  1CF7 B;  5CVR A;  1MD0 A;  5IT9 Z;  4UNO A;  4AIJ A;  3CUQ A;  1S8N A;  1LB2 A;  1S29 A;  4OU0 A;  5LRR A;  3WTU C;  1BIA A;  4EGZ A;  1I6X A;  3ZMD A;  5TRD A;  3L7W A;  1IAW A;  2GZW A;  3NEU A;  1STZ A;  5D8K B;  3M8E A;  3CUQ B;  5CVJ A;  1ONV A;  2YU3 A;  4I2O A;  1HKQ A;  2Y48 A;  4HOB A;  4ZYG A;  3E6C C;  4LMY A;  1XSV A;  2CSO A;  4R79 A;  5LHG A;  3MZY A;  2DK5 A;  2EK5 A;  3M9A A;  3MZH A;  3DFG A;  4BH9 A;  2J5O A;  5DYM A;  1OYW A;  4WXH A;  2H6B A;  2V1U A;  1FWZ A;  5E1X A;  2O61 A;  4EJO A;  2MC3 A;  3V7S A;  4GYI A;  4S04 A;  2Q0O A;  4L9N A;  3MCZ A;  4CDG A;  3QP6 A;  2XHK A;  3CTA A;  2FXA A;  2HYG D;  2ZME A;  3J81 K;  2QZ8 A;  4M72 A;  3EUH A;  1R1V A;  1FBS A;  1MJA A;  4O5V A;  2PLY A;  2MLK A;  2FML A;  3RIR A;  5ILU A;  2M1B A;  4ESF A;  1ZLK A;  2HKX A;  3F6V A;  4P96 A;  1S3J A;  1BI0 A;  3REO A;  1MJ9 A;  4LB5 A;  5E1Z B;  2F2E A;  1W5S A;  1BC8 C;  2QQ9 A;  2XAH A;  4M73 A;  3VOD A;  3F8B A;  4HQE A;  5LEK A;  4GXO A;  1R5H A;  1IXR C;  3DP7 A;  1LEB A;  3J80 K;  1Z7U A;  4HF2 A;  1RI7 A;  1T0F A;  2RVC A;  1GHC A;  2P5K A;  3T0Y A;  1TTY A;  4HA8 A;  1XSD A;  1Z6T A;  2OQR A;  1A04 A;  3K1N A;  1D5V A;  3KP7 A;  3R0J A;  3L9F A;  3WGI A;  1ZG5 A;  3HRT A;  4PZJ A;  4WXC A;  3E6D A;  4BHP A;  4I01 A;  2FE3 A;  2X4H A;  1TW3 A;  1SFX A;  2L54 A;  2FSW A;  1ZG1 A;  5L3G A;  1GVJ A;  5E1W A;  1LDD A;  3I58 A;  2V1D A;  3MQ0 A;  4LK1 F;  5HS9 A;  2RN7 A;  3H92 A;  5CVU A;  2XAQ A;  3B73 A;  4IRI A;  1WWX A;  2RV8 A;  3F8C A;  3SZT A;  4XSX F;  1D8K A;  1O3Q A;  2L01 A;  4TV7 A;  4BNC A;  2A6H F;  4G7Z F;  5ICC A;  1KU9 A;  1KU2 A;  1QZY A;  5JHU A;  3ISP A;  1YQA A;  2L4M A;  2QM3 A;  4MGR A;  2W85 A;  4LD5 A;  4LLG F;  4AD9 A;  3WE3 A;  2X0L A;  1YW8 A;  4LB6 B;  1QNT A;  4YFK F;  2MA3 A;  3VFZ A;  1ZH5 A;  2OD5 A;  3HTU A;  1P4W A;  1P4A A;  1ZAR A;  2MH2 A;  1ZLJ A;  1EV7 A;  3LA7 A;  4KIB A;  3GFL A;  4CHU A;  1FYL A;  3M7G A;  3SFZ A;  2A61 A;  1B9M A;  5DDG A;  3WU1 B;  4G7O F;  2M8E A;  4L5J A;  3DV8 A;  4PGH A;  4P9F A;  1TW2 A;  1FYM A;  4G9Y A;  2JTV A;  4HW0 A;  1QZZ A;  3LA2 A;  1MDM A;  3F6O A;  3K69 A;  4G6D A;  2ZO4 A;  2BEO A;  1J2X A;  2K02 A;  1BBY A;  3HTS B;  3H3Z A;  3FMR A;  2VC0 A;  3O2P E;  3FM5 A;  1Z05 A;  4LGW A;  2D1H A;  3S2W A;  1Q1H A;  1LDJ A;  5HVQ C;  3O3K A;  4FHT A;  4CGZ A;  3IKV A;  3E3V A;  3GX4 X;  4HQM A;  2W25 A;  2KJC A;  1EH7 A;  3R4K A;  1IN5 A;  4IRG A;  1UHM A;  2VT2 A;  1OKR A;  4KN7 X;  3BRO A;  1V3F A;  2L02 A;  1SD6 A;  1F4K A;  1JHH A;  2QQB A;  2P6S A;  4WF2 A;  2F5E A;  3L09 A;  3OV8 A;  2M5W A;  1FYK A;  3HRU A;  3RI4 A;  4UV8 A;  1P92 A;  1B9N A;  2Z5U A;  3QPH A;  2Q2E A;  2DTR A;  2F5C A;  3GW2 A;  1KU7 A;  2COM A;  2EV6 A;  3RKX A;  3T8R A;  2EA4 A;  1AWC A;  2P4W A;  2IJL A;  3KZY A;  4M74 A;  1UB9 A;  3DPL C;  2ZFW A;  5E18 F;  2QBY A;  3E97 A;  3GFM A;  3TDZ C;  3DKW A;  3ZMS A;  5HLG A;  3AAF A;  3GUD A;  2OU2 A;  1XSX A;  2ZKZ A;  2Z3Y A;  4YFN F;  4ZYH A;  4ENM A;  5ICG A;  1O7F A;  4B8X A;  4BQA A;  3ZMZ A;  2H6C A;  5LHH A;  1SD7 A;  4DQ2 A;  1UST A;  2JPB A;  3L00 A;  3SHF A;  4RB0 A;  3EET A;  1LDK B;  3J81 Z;  3ULQ B;  4MTD A;  3CDH A;  4L9J A;  2HWV A;  1LEA A;  2MBF A;  1YW9 A;  2EFO A;  1BJA A;  1U2W A;  4L0Y B;  1K78 A;  2KRF A;  1D8J A;  3PQK A;  5A2Q K;  1E2X A;  3IRR A;  1L0O C;  2CO5 A;  5HS8 A;  1KYZ A;  2VBZ A;  3FXQ A;  1O3R A;  3P7N A;  2HEO A;  4IVN A;  4Q4Z F;  1XDU A;  4ZZD A;  1J5Y A;  4Y13 A;  4UXN A;  4HBL A;  4RB2 C;  1XGS A;  2ISZ A;  3HRS A;  4ZZL A;  1YYV A;  2K27 A;  2HFH A;  4ZYD A;  3E6M A;  3I59 A;  3ZPL A;  1PP8 F;  4HZF A;  5CJ9 A;  1T2K A;  1R22 A;  1MKM A;  4B09 A;  2FBK A;  3KE2 A;  2HS5 A;  1J0R A;  3DEU A;  5LGT A;  4Q47 A;  2BV6 A;  2YSR A;  4GCV A;  2W24 A;  3TQN A;  3PFI A;  2OZ6 A;  2KIM A;  1OYY A;  1WRJ A;  2HYF A;  3BPX A;  3TKY A;  1CF7 A;  2P6T A;  5BOX A;  2FBI A;  2UXN A;  2R7D A;  2FRH A;  4A6D A;  2PI0 A;  1RZ4 A;  4QWQ A;  4H0E A;  2QUF A;  2QQA A;  2VE9 A;  2V9V A;  3P9I A;  3K1M A;  3QU3 A;  5H20 A;  3R0A A;  4I02 A;  2YX4 A;  3LAP A;  3C1D A;  2V1X A;  2B0L A;  5L3C A;  1IXS B;  1SMT A;  4NHJ A;  4XLP F;  4KIC A;  4I7H A;  3D5L A;  1ULY A;  4R1H A;  2E7X A;  1T98 A;  1H0M A;  3GVA A;  1B6A A;  5D5W B;  1J75 A;  4XBF A;  2AXL A;  4I98 B;  3GYH X;  2A6E F;  2PJP A;  3TGN A;  2XV4 S;  2ESN A;  3VEP A;  3DQV C;  1ODD A;  2W57 A;  5BPI A;  1PUE E;  2UXX A;  2L4A A;  3P9C A;  1UCR A;  1FY7 A;  4FX0 A;  4GO1 A;  2Z99 A;  2ZBK A;  5HS7 A;  3BJ6 A;  3I53 A;  3T1B A;  1R00 A;  4LLL A;  1IN7 A;  5TJJ A;  3I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...