2LF8A

Intramolecular regulation of the ets domain within etv6 sequence r335 to r458
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQVLDEQTYQEDEPTIASPVGWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor ETV6
publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 33
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf8A01
2ELHA 2M8EA 4QLCU 1YW7A 2JSCA 3HYIA 3JW4A 3GW2A 3WTTC 3L09A 5DD4A 2HOEA 3ZP5A 1F5TA 1AOYA 1FZPB 5FLXZ 2KIFA 3GVAA 2L4MA 3IC7A 1KYWA 1ZRDA 4LMYA 2H09A 4CHUA 2J5PA 1FP1D 1W5TA 3KP7A 2RQPA 2QVOA 3KLNA 2EWNA 5LLQA 5HS8A 2K7LA 3HIFA 1LDKB 1HW1A 2HKOA 4HF1A 5IT3A 1K78B 3WTVC 2XROA 5E8GA 4RGUA 4LG0A 3LA2A 1TQMA 4B8XA 4JQFA 4YFNF 1V3FA 1FBSA 1C0WA 4L9NA 2RDPA 2W85A 2JZYA 5CJ9A 4ETSA 3MZYA 2XV4S 3ZN1A 1TLHB 5E17F 3SZPA 3QP5A 1UB9A 2HTSA 3N4MA 4A5MA 4GYGA 3MCZA 5DCMB 3VOEA 3KP2A 3E5QA 1YS6A 2PJPA 5HVQC 3BOQA 1FSHA 2TDXA 2FNPA 4UV9A 3J81K 4M72A 4N9HA 2DQRA 5E1WA 1IAWA 2HYGD 2IJLA 1YW9A 1OR7A 4D0PA 5E1XA 3KFWX 4M9XA 2D45A 1MKMA 1XSVA 3ABUA 2ZJ2A 3NRVA 2P6SA 3LFKA 4P9FA 1L0OC 1FT9A 1JXSA 4WWCA 4YG2F 3BP8A 2Z9OA 4HLXA 5CVJA 4LK1F 1ZRFA 1I6XA 1R36A 4IHSA 4G9YA 4CDGA 2P7CB 2XUBA 4KN7X 2VXZA 1J5YA 2EFOA 1YFHA 3GUDA 1TQPA 2P5LC 2L01A 3K1NA 4ZYDA 1G3TA 2CSOA 1IN5A 2H27A 2H6CA 2OZ6A 2HTJA 1P6RA 3QP6A 3WU0A 4EVIA 2HS5A 3CDHA 2CQKA 3E97A 1MGTA 2V9VA 1U5TA 2ZXJA 4HQEA 3TGNA 2B0LA 2VC0A 3GZ6A 3TKYA 4H0EA 4KNYA 1O3TA 1I5ZA 1STZA 1HW5A 4BHBA 2CWEA 1BI1A 5K1YA 1R00A 2G7HA 3GYHX 3CLOA 1EH6A 2HQRA 1KQ8A 3KP4A 2COMA 1ZH5A 3F3XA 3C18A 3GEZA 2PFBA 5E20A 1CF7A 3FMSA 3MFKA 2E7WA 2F5FA 4UXNA 4S04A 1R7JA 1T2KA 3DV8A 4GGGA 2PLYA 3I0TA 1E17A 2RGVA 3DPLC 2MLKA 3WTZA 5D4SA 1SFEA 2K27A 2DBBA 2LF7A 2MA3A 2PMHA 2XHKA 3RDIA 3FM5A 2Q2EA 4CZZA 1OKRA 5ICCA 4HAMA 3LQRA 1XDUA 1IN4A 5FB2A 1ZRCA 3ELKA 3QU6A 2EFNA 1U2WA 5HS9A 2VONA 1YW8A 1MDMA 3RKYA 4I7HA 3HRTA 1W7PA 1KU7A 3PQJA 4WF2A 4YIFA 3I64A 2DK5A 4RAYA 2Z3YA 1G3WA 3V7CA 3I54A 5LBQA 3GZ5A 2ZNYA 2HFHA 5JI6A 2HQNA 5FO5A 2QQ9A 2FBHA 2F5EA 2NNNA 1LNWA 5ILVA 4ENMA 1LVAA 2HWVA 2V1XA 2H94A 5IT9K 4AIHA 4EJTA 3TQNA 2HEOA 2PN6A 2GWRA 3IKTA 4PDKA 3L00A 2EK5A 4Z2YA 3RPUA 2ZFWA 2VC1A 4EGZA 2OD5A 4LB5A 2NAZA 3QRFF 4Q48A 2IW5A 2AS5F 4JK1X 2ZMEA 5HLIA 3HRSA 3VB2A 5L3FA 2QYOA 2LDUA 4LK0F 1OYYA 4WCGA 3HTSB 2ESHA 4FX0A 1BIAA 3C1DA 3EDPA 5ICEA 5DUKA 2FMYA 2QBYA 1MD0A 2DI3A 4I09A 1IN6A 3I71A 5DD8A 3JAMK 3F21A 3R0AA 1LJ9A 3TDUC 2GAUA 3V7RA 1SAXA 2L3DA 3ERED 1ZN2A 4OOIA 4U0VA 3TO6A 2RV8A 3M1EA 2FBIA 2RNJA 1B4AA 4I98B 4MQVA 3WTSC 5JR3A 3L2CA 3ABTA 3QPHA 3V4GA 2IA1A 2VBYA 5LRSA 3HTUA 1R23A 3ECOA 2OU2A 4P55A 2O03A 4UV8A 3ZMVA 2DU9A 1S29A 4XLPF 4ESJA 3ISPA 5BS6A 1ZG1A 1ON2A 1D3YA 2LNBA 4G7OF 5TRDA 5CLSA 2QZ8A 1O57A 5LRRA 1ON1A 4OMZA 4UUVA 4EJOA 3TOBA 2OQRA 4IXAA 1CGPA 2W84A 1B9NA 4BH9A 2Z33A 2CGPA 4LG0B 1E2XA 5F64A 2QWWA 4PZJA 1D5VA 3JAMZ 2P8TA 4A0YA 2FNAA 3RKXA 1EH8A 2GIVA 1U8RA 1XSDA 3EYYA 3M8EA 2A07F 2D2WA 1BN5A 1QQIA 4KIFA 3WTXC 5H6RA 1Y0UA 5CYVA 2KIMA 4EGYA 4O3MA 2HGCA 1FY7A 3D0SA 1F9NA 4HDVA 4HYEA 1RNLA 4Y17A 2DTRA 2XIGA 1BM9A 5L3BA 5FFXA 1ZREA 3P9IA 4OIRF 1P4XA 1XCVA 1J59A 3P9CA 5LEKA 3P9KA 3FWEA 4CYDA 5D5WB 2MBFA 3KZYA 5BQTA 4KYWA 4BAYA 3DXJF 3VFZA 4OMYA 2BYVE 1DUXC 1BI2A 1GXPA 3CO7C 1BIBA 4Y13A 2YU3A 3IKVA 4RGRA 1UHWA 4G6DA 3T1BA 4R1HA 3R6SA 3GLXA 5L3EA 3CJNA 2GZWA 2Q0OA 5ED4A 4KIBA 1XMKA 4A12A 2D1VA 3KP6A 3GX4X 5D5XB 5D5VB 3EUHA 1G3SA 1LDJA 1LEBA 3OOPA 1ODDA 2OBPA 4EJWA 4XRFA 1KYZA 5KK1A 4MQ9F 1Z7UA 1V4RA 1ZHFA 2VOOA 1ZG3A 1U5TB 3BPXA 2JPCA 1YO5C 4DNCA 1PUEE 3GWZA 4OIPF 4YIIA 4AIKA 2Z99A 1FSEA 5J8FA 3V8JA 4G94A 1G4DA 1P4AA 2FEZA 3ZMUA 3FHZA 1XN7A 3FMQA 3TO9A 3J80K 2V79A 4AVPA 4IRHA 4MGRA 1CF7B 3WTWC 1XGOA 4ESFA 4PGHA 1Z9CA 2A5YB 5EEHA 4ASNA 3PQKA 3SXYA 2FA5A 1YTYA 1JHHA 4KDPA 3WTUC 3F23A 4BQAA 3JSPA 5DEQA 1TTYA 3RYRA 5L3CA 2FRHA 2EV0A 2XAHA 1QO0D 3G3ZA 2VOPA 2K4JA 3BJAA 4N9IA 2XAGA 4M73A 5CVRA 2ZCWA 1HKSA 3JTHA 1FP2A 2UWMA 1B6AA 1K6OA 2CYYA 4HOBA 2HKXA 3EYIA 1FWZA 4Y15A 4EM0B 4EV0A 1MDMB 3KEOA 3M7GA 4B09A 3CO6C 1W7PB 3RIRA 1LDDA 1RUOA 2R7DA 3CUQA 2UXNA 4HF0A 1BI0A 4ENKA 2UZKA 2STTA 2GXGA 2FXAA 2XAFA 3JTGA 3MQ0A 3SQNA 3I4PA 2R7FA 3AAFA 2ISZA 3DP7A 2ETHA 3GFLA 3HUGA 4HX8A 2O0YA 4KIGA 1WWXA 3IHUA 1WQ2A 2JRTA 4G7HF 5DYMA 2FQ3A 2DAOA 3VEPA 4WXHA 3R60A 3ZMTA 2HZTA 1R22A 5D6FA 1RIOH 2DPUA 4UHTA 3BDDA 1O3SA 1KU2A 2G9WA 1LB2A 2KRFA 3ZN0A 3RI4A 5E8IA 3D5LA 3E5XA 2ZMEB 2YPRA 2VN2A 2A3SA 4EM1A 1G3YA 3DF8A 3FXQA 2IRFG 2FOKA 5BPDA 2RN7A 4UVAA 2QENA 3J81Z 5FD5A 1QBJA 4L5JA 2QQAA 3I5UA 1R1VA 1Z6RA 1FPQA 2QBYB 2DLLA 1WKMA 4A6DA 4I0AA 2WWYA 3CUQC 4TV7A 4ESBA 2OAZA 5BOXA 5LGUA 4OIOF 3C3WA 2WC2A 5E1ZB 3B73A 2EV6A 2AXLA 1HSJA 5A2QK 2HDCA 2VE9A 5EEGA 1MJAA 1QNTA 2WV0A 5LEJA 1YIOA 1FBUA 5AONA 4RB1A 2F5DA 3I53A 3KP3A 4IF4A 1U3EM 1LEAA 2G7UA 1IW7F 2WTEA 2IP2A 2STWA 1YG2A 1QZZA 2ZBKA 5K5QA 2MH2A 4WXCA 2MLGA 3V8KA 5DDGA 2PMUA 3RPQA 1SMYF 2QQBA 1G6NA 1DPUA 3FZVA 4IHTA 1QPMA 4HX7A 1YYVA 1S3JA 4L9VA 2PQ8A 2K86A 4A5NA 4IRIA 1USTA 3DEUA 2O61A 3SZTA 3ML6A 3ZMZA 5ERIA 2PBIA 1WRJA 2FF4A 5D5UB 2XASA 1IZ1A 2EA2A 1OPCA 4ENJA 4R8HA 4LLLA 1BOAA 5ILUA 3HOSA 3Q9SA 2DK8A 1MZBA 4MEYF 3WGHA 2DQLA 1KU9A 5TJJA 1PP7U 3ZMSA 3FF5A 3K9TA 1O3QA 5E18F 5BPIA 3OV8A 1BJAA 1I1GA 4BXUA 3WU1B 2BE5F 3B02A 3L7WA 4P9UA 2GA1A 2F5CA 4ZYHA 2E1NA 3U9GA 2FSWA 4QWQA 3KZZA 4EJUA 4LLGF 3Q9VA 4LLNA 3IRQA 3T8RA 4NHJA 1XD7A 3E3VA 4M6XA 3GXOA 5FD6A 2P6TA 3REOA 4HV5A 1S7OA 1W5SA 1TNTA 3LA3A 1S7AA 2KKOA 2ZO4A 1R5GA 1VTNC 2IT0A 2M30A 2YX7A 2KIUA 2V1DA 2DO7A 1U78A 5IT9Z 4S05A 1D8JA 3J7AO 1P2FA 3G73A 4F7ZA 4ON0A 4YFXF 1T39A 1HKTA 2DW4A 4LJZF 3RYPA 1XGMA 5J6XA 1XDSA 2L4AA 2NS0A 1A04A 3K1PA 1W4MA 3COAC 3K1MA 3QOPA 1TW3A 3N97A 4HA8A 1SFXA 4CXFA 3ZMDA 4GO1A 1XSXA 4XBFA 6PAXA 2W57A 5HLGA 2P5KA 1S6LA 3RTRA 5H20A 2DFIA 2EB7A 3KP5A 2A68F 4Q47A 3F6VA 3QU3A 1QZYA 3IRRA 2PG4A 1EV7A 5DV5A 4Q4ZF 1Z91A 4EM2A 3BWGA 1HW2A 5K5RA 1GHCA 4OU0A 4L18B 3I58A 3HOTA 5LGNA 5HDNA 2QLZA 3WGGA 2JPBA 1O7LA 1FC3A 1T98A 1ULYA 4I2OA 2VT3A 1ZARA 5L3GA 2NRAC 2W24A 2GQQA 1OMIA 4GXOA 1W7PD 3F8NA 5H6QA 1IXCA 2XKOA 1U6GA 4EQQA 4BNCA 5AIQA 2JTVA 4KUMA 2C6YA 3NEUA 3TOAA 3WODF 1KA8A 4I01A 4KN4X 1R1TA 2Y0MA 1KGSA 1BC8C 1L3LA 3K0LA 2M1BA 1XB4A 3FMRA 2J5OA 2P5VA 1DPRA 4O6JA 3I59A 4HV6A 2BBYA 3LWFA 3VODA 1PP8F 1R5HA 2VE8A 1J0RA 3O6BB 4HQMA 4LB6B 2XRNA 1FLIA 1H9GA 4M9SA 1OYWA 3RJPA 4GYIA 3FM3A 4IRGA 3CTAA 3LAJA 3KETA 1T38A 3T0YA 1YS7A 1XGNA 5ICGA 2QUFA 5CVUA 4RGSA 1RZ4A 2A6HF 1B9MA 2PEXA 1H9TA 3GFJA 1USSA 4HF2A 4U7BA 4ZZDA 4U0WA 2Y75A 3IL2A 1WI9A 2MD5A 3KCCA 1Q1HA 5LHIA 2JT1A 3KLOA 3MAJA 1FNNA 1UCRA 1ZGAA 4XLNF 5HDKA 1ZLJA 4XSXF 2DT5A 4ZYEA 3GFMA 3IWZA 3HSRA 4M6YA 3R4KA 4WXDA 3C7JA 3PFIA 4AWXB 1ZLKA 3HSFA 4MEXF 1K79A 4Q5SF 5K5OA 5LHHA 3IWFA 2XAJA 2FMLA 3HHHA 2Y48A 1B1BA 2ZKZA 1WSUA 1IUYA 2Z5UA 2RKHA 1ZYRF 1AWCA 5JVTA 3LQQA 4RB0A 1J2XA 2A6EF 2NNYA 1ZAOA 2XKPA 2GA2A 3HRMA 1BC7C 3RKWA 3O3KA 3J80Z 1FX7A 2YX4A 4R79A 5J8CA 2YSRA 3F8MA 3H3UA 2EFQA 1OYIA 3MWMA 4AIJA 3MEXA 2O8XA 4YFKF 3KEQA 4O5VA 2A61A 4G8XA 4UVCA 2CW0F 3QAHA 3U1DA 4LD5A 3L9FA 3WG9A 3GFIA 3ECHA 3M8FA 2BEOA 1IRGA 5CVVA 3F8FA 2L02A 4OINF 1KQ9A 2UXXA 4ZZLA 3TO7A 4PCQA 2M87A 2BGCA 4M71A 4U0YA 2MC3A 4HW0A 4NB5A 2ISYA 2V6CA 5HS7A 4EMSA 3ZPLA 5FFZA 1IRFA 4WK8F 1FYLA 1SFUA 5L3DA 5F1RA 4CICA 2XVCA 4MNUA 5BMZA 2KJCA 1MJBA 1DDNA 2OZUA 2CO5A 4GCVA 2HYFA 4ZH4F 3H3ZA 2KJBA 4L9TA 3P7NA 4L0ZB 1R1UA 4KT5C 1DP7P 1SD6A 3DPTA 1KU3A 3WGIA 1LQ1A 1ONVA 4UVBA 3S2WA 1D8KA 4LFUA 4K2EA 4E70A 1K78A 3GO5A 4RB2C 3W6KB 3M9AA 1HSTA 2P4WA 5HLHA 4RB3C 2D1HA 4IJAA 2PI0A 4A0XA 2IA0A 2LSOA 2FE3A 2LF8A 3TDZC 2P7VB 2FBKA 3DQVC 4L9JA 2M5WA 5DUIA 3F8BA 2ZNZA 1NHAA 5DCMA 4N0BA 2HR3A 4FX4A 4MTEA 3FXUA 1HBXG 1I27A 3V8LA 4I02A 4HBLA 1EH7A 1U5TC 4CO8A 2VBXA 1J75A 2IVMA 3SFZA 4KA4A 5ICFA 1IN8A 4MTDA 4IPAA 4U88A 4KMUX 3WTYC 2VBWA 4PGGA 4CGZA 1IXSB 5A2QZ 5JHUA 2Q8KA 3JSOA 2GXBA 4BHCA 1X3UA 2K02A 3E6BA 1F1ZA 5DCFA 1RUNA 3LSTA 4NQWA 3MZHA 1RI7A 1HXDA 1ZG5A 2E7XA 1J7KA 3Q5FA 1P4WA 1GVJA 2L54A 3E6CC 4BHPA 2CG4A 4P96A 1F4KA 2RC4A 2M45A 2O3FA 3K69A 3LAPA 4XSZF 5HOOA 4P5OA 5D8LB 2OQGA 3NQOA 2XAQA 3CUOA 1PDNC 4DQ2A 4LGWA 4ZYGA 1IXRC 5AIPA 3QPTA 2W25A 1R58A 3WE3A 1XMAA 2VODA 1GXQA 3E6MA 1O7FA 2H6BA 1BI3A 4HZFA 4RAZA 3EETA 3SHFA 3I59B 3KE2A 3HHGA 3F72A 5D6EA 4JBAA 2LKPA 5KVRA 4G6QA 1REPC 4RS8A 3DKWA 2VT2A 2IA2A 2CFXA 4HLYA 1TW2A 4HX4A 1IF1A 2V1UA 1ZGJA 1UFMA 3WE2A 3FX3A 2EJRA 1UHMA 1TBXA 4KFCA 1T0FA 1FYMA 3EQLF 5FGMA 2EV5A 1FYKA 2ACJA 4RGXA 1XCBA 3HRUA 1MJ9A 4G7ZF 5HDGA 1H0MA 2E1CA 1JE8A 4FT8A 2YR2A 3V7SA 1XGSA 4M9ZA 5ILSA 2RVCA 4ENNA 3T8TA 2QM3A 4A2UA 2F2EA 2XGXA 5JFRA 3U2RA 1IN7A 2DPDA 4I0BA 4EJVA 2O6GE 1KQ0A 1S8NA 3BJOA 1Z1DA 3F8CA 4WX9A 3K2ZA 1Z05A 2VBZA 1B59A 1SMTA 1HKQA 5LGTA 5F6FA 4UNOA 2X0LA 4AD9A 1FOKA 4IVNA 1J9IA 1K7AA 3E6DA 2ADUA 3T5XA 4A6EA 4M74A 4L0YB 1P92A 1HQCA 3BY6A 3O2PE 2R3SA 3F6OA 3GF2A 4U7DA 2EA4A 2IPQX 1SD7A 4HDUA 1JGSA 1SD4A 3BJ6A 1QGPA 5FLXK 1TQIA 4KMFA 2A69F 2BV6A 2NYXA 3ZQ7A 4A0ZA 3CUQB 3R61A 1FBQA 1BBYA 3BROA 3DFGA 4FHTA 3F22A 4KICA 2X4HA 3ULQB 5D4RA 1JHFA 5D8KB 1I1SA 1TNSA 3FXRA 1O3RA 4MHGA 1Z6TA 2MH9A 3R0JA 4BYYA 3BPVA 2OA4A 3E5UA 3HSEA 5CVIA 2EFWA 3H92A 1YQAA 2EFPA 4L5IA 5LHGA 2FU4A 3BZ6A 2K4BA 4OIQF 1SD5A 3W6JB 2ESNA 1YLFA 3LA7A 1T6SA 3ROUA
chains in the Genus database with same CATH superfamily
2ELHA 2PMZN 2Q1ZB 2M8EA 3K70D 3DTIA 4QLCU 1D0ZA 1YW7A 4N4NB 5J40A 2JSCA 3HYIA 3JW4A 5B66C 4KJZA 1DU6A 3MZ8A 3GW2A 1V5GA 5TGTA 3WTTC 3L09A 2TRTA 3VYSB 4XRSA 3M1CA 5DD4A 2HOEA 3ZP5A 2IGOA 1F5TA 2KZVA 3CQZJ 2XDVA 1AOYA 1FZPB 1X4OA 5FLXZ 3HJEA 2KIFA 3GVAA 2L9NA 2L4MA 3IC7A 1KYWA 3VPRA 4GFBA 3FK6A 4NDLA 4ZJZA 4LMYA 4XQFA 2DMUA 2R5YB 1ZRDA 1BR1A 2H09A 4CHUA 2E71A 2J5PA 1FP1D 3HXLA 3HKZA 2PJRA 3K4BA 3OR1C 1W5TA 3KP7A 2RQPA 2XAUA 4B47A 1EJ9A 2CV1A 2QVOA 4PUSA 3KLNA 2EWNA 5LLQA 5HS8A 1BW5A 2Y9ZA 5CQGA 2K7LA 3HIFA 2WA0A 4J00A 1LE8A 3K4LA 3TEDA 1LDKB 2X6WA 3S2DJ 2LY1A 1HW1A 2HKOA 3L2UA 4HF1A 1F43A 1F36A 5IT3A 3WU2C 1AHDP 2COBA 1K78B 3WTVC 2JJ7A 2XROA 3E7LA 5E8GA 4CA0A 1D5YA 1XPXA 4RGUA 4LG0A 2LREA 3PO3J 3OR2C 3LA2A 4Y52J 3DKYA 1TQMA 3HPHA 4B8XA 1U0JA 2ME6A 4JQFA 4A3GJ 4YFNF 1V3FA 1FBSA 5J1YA 2YU9J 1UAAA 3QOEA 3SDGA 1C0WA 1TWCJ 4L9NA 2RDPA 2NXNB 2W85A 2MW8A 1TWFJ 2JZYA 3IH4A 1DQUA 5CJ9A 5GAGJ 4ETSA 3MZYA 2XV4S 3ZN1A 1TLHB 2KT0A 5E17F 3SZPA 2OTLI 3QP5A 4NC6A 4PSWA 2Y30A 2JSPA 1UB9A 2HTSA 5EYRA 1K4TA 1W0TA 3L2WA 2EBIA 3H3VK 4M3DA 3N4MA 4A5MA 4GYGA 3MCZA 5DCMB 3VOEA 3KP2A 3E5QA 1YS6A 4BU2A 1E3HA 2LY9A 5M3FJ 1FOWA 2DTZA 5HVQC 1YHQI 2PJPA 2W4SA 3RQ4A 3BOQA 3OSFA 3F0CA 1FSHA 2TDXA 2GLOA 2VQLA 2ZC2A 2VB6A 2FNPA 4UV9A 3J81K 4M72A 1Z3YA 4N9HA 2DQRA 2CH0A 2VJ5A 3TW7A 5E1WA 2HXOA 2JMWA 3AG2H 1IAWA 2HYGD 1MMGA 3CC7I 2IJLA 2HVSA 1YW9A 1OR7A 4I99C 1Z21A 4UB6C 2HZDA 5E1XA 3KFWX 4D0PA 1ZR4A 2AO9A 2E1MB 2FX0A 3AFHA 1MKMA 4M9XA 2D45A 3CCRI 5CQEA 3IAS2 1XSVA 3ABUA 2DJIA 1BL0A 4BKXA 2ZJ2A 3NRVA 2P6SA 2ICWG 2FOWA 3LFKA 4P9FA 4XLHA 5M5WJ 2X9DA 2X6OA 1L0OC 4UB8C 4B1RA 1FT9A 1JXSA 2ZXHA 4WWCA 4PJ0C 4BJ6C 4YG2F 3BP8A 2Z9OA 4HLXA 5CVJA 4IZZA 2LKXA 4LK1F 1ZRFA 1I6XA 1Z77A 4NQWB 1R36A 4IHSA 2O5RA 4G9YA 4XLCA 1R4MB 3QWLA 4CDGA 3I4NJ 2P7CB 2XUBA 3BTJA 4KN7X 2K9MA 2VXZA 3OY9A 1VQPI 1R49A 2XF5A 3SEZA 1J5YA 2EFOA 3I4MJ 1YFHA 2XF7A 3GUDA 1TQPA 2P5LC 2L01A 3K1NA 4ZYDA 1XX5A 1G3TA 4LIVA 3PSFA 2CSOA 2K5CA 1IN5A 2H27A 2H6CA 1HC8A 2OZ6A 3ZQHA 2HTJA 2DA7A 1P6RA 4BJTA 3QP6A 3WU0A 1VNDA 4D5CA 4EVIA 3V42A 2HS5A 2KMUA 3CDHA 2DA3A 1Y0NA 4E7JA 1V5EA 2CQKA 4B43A 2LBFA 3E97A 3L2VA 1OCTC 1MGTA 5FRNA 1YITI 2V9VA 4E7SA 4ZDPA 1U5TA 2ZXJA 3OWTA 4HQEA 3TGNA 1MBFA 2B0LA 2VC0A 3GZ6A 3TKYA 4G6TB 4H0EA 1WZ2A 1PJRA 3ZRGA 4KNYA 2VPRA 1I5ZA 1O3TA 1STZA 2OJED 3C2HA 3TMOA 1HW5A 4B44A 4BHBA 3BG7A 3GTJJ 2CWEA 4EATA 1BI1A 5K1YA 3W3CA 3CMYA 1R00A 2G7HA 4XLAA 3CLOA 3GYHX 1EH6A 1A36A 2DA1A 3GTMJ 2DOAA 2HQRA 1EA3A 1KQ8A 1MMAA 2COMA 3KP4A 1ZH5A 3F3XA 4XNFA 3ZR8X 3C18A 3GEZA 2PFBA 4A69C 2M7AA 5E20A 1CF7A 2BZTA 3FMSA 1SAUA 5M3MJ 5C3EJ 3MFKA 1T08B 2E7WA 2F5FA 4UXNA 4XMYA 4S04A 3W2AA 5F27A 1R7JA 1ETYA 2VASA 3CMMA 1T2KA 3DV8A 5FKLA 2XPUA 4GGGA 2OPTA 3A0BC 2PLYA 1WH7A 3I0TA 3RSNA 4XKWA 1WJ5A 2L7KA 3OYFA 1E17A 2RGVA 2K9NA 2MLKA 3DPLC 2BW3B 4DW6A 5F1JA 1VQ7I 3WTZA 4UUTA 5D4SA 5IYDJ 1DGRM 1SFEA 2BVLA 4ZTJA 2K27A 2DBBA 4HNTA 3QYFA 3LSRA 5EGOB 4JX5A 2LF7A 2MA3A 2PMHA 2XHKA 3DBLB 3OYJA 1ZR2A 2OV7A 4XN3A 3RDIA 4D7MA 1QHHD 4BE0A 3GCMA 3FM5A 2Q2EA 4CZZA 3BTIA 4RAFA 2CFOA 2HQ5A 1OKRA 1S7EA 5ICCA 3OYAA 5KAFC 4HAMA 3LQRA 3BG5A 1XDUA 1IN4A 3LSMA 4M3BA 5FB2A 1NG7A 2LKSA 1ZRCA 3ELKA 3QU6A 2EFNA 1U2WA 2P0WA 4XKVA 5HS9A 4A3IJ 1PUFB 2OCEA 3S1MJ 2VONA 1YW8A 3N05A 1MDMA 3RKYA 2L7MP 2Y69H 2BY0A 4I7HA 3HRTA 1W7PA 1OCPA 3CCVI 1KU7A 1YRNA 4OWRB 3PQJA 5GPCA 4WF2A 3FDYA 4YIFA 3I64A 2DK5A 4RAYA 2Z3YA 2XB5A 1G3WA 3V7CA 3I54A 5LBQA 3M4OJ 2QKLB 4ZTFA 3GZ5A 2ZNYA 2HFHA 5JI6A 2HQNA 4HNVA 5FO5A 2QQ9A 2FBHA 3OYLA 1X2MA 4LIUA 2LOOA 2O7OA 2F5EA 2O9LA 3CF5F 2NNNA 1LNWA 3BQYA 5H2FC 2NS8A 1N78A 3UR3C 2EZHA 4X1EA 5FJ8J 3PUBA 1UMQA 1JGGA 5ILVA 2HXIA 4ENMA 2GOXB 2IS6A 4A3BJ 4DOZA 3ESWB 1LVAA 2HWVA 2V1XA 2H94A 5IT9K 4AIHA 2HYJA 1WFXA 1VQLI 4EJTA 3TQNA 3CCYA 2DYSH 4RDUA 2X85A 2HEOA 2CUEA 4XLEA 1Y56A 2PN6A 2V26A 2GWRA 4W97A 1A31A 3IKTA 4PDKA 4AYBA 3AG3H 2PMZA 3L00A 2EK5A 1MBEA 1LKXA 1WVRA 3A0HC 2EZIA 4Z2YA 2ZFWA 3RPUA 3S3OA 5FRMA 2E36A 2VC1A 4DBRA 3CD6I 1MNDA 4EGZA 2OD5A 4LB5A 2LMDA 2HPMA 2NAZA 3QRFF 1X1BA 4Q48A 2IW5A 2AS5F 2XC7A 3BT9A 4JK1X 2ZMEA 5HLIA 2X6YA 3HRSA 3VYRB 2K3FA 4HNUA 3VB2A 5L3FA 2BXYA 3BG6A 3OS2A 2QYOA 5FKMA 2IBDA 2LDUA 1OYYA 4LK0F 3NAUA 1HF0A 4WCGA 1VQKI 2ESHA 3FHNA 3HTSB 1NTCA 4FX0A 1BIAA 2FJ1A 4BBSJ 3C1DA 2OF7A 3EDPA 5ICEA 2DA2A 3BR1A 1MSFC 5DUKA 2FMYA 2WAQA 2E2JJ 1OLTA 2QBYA 1MD0A 4BEHA 2DI3A 1HA8A 1JUPA 4I09A 4BXFA 1IN6A 5IP7J 3I71A 5DD8A 3JAMK 3WHBA 1ORKA 1IRXA 3H5AA 5F0FA 2QA4I 3F21A 1WJDA 3R0AA 1LJ9A 2HPIA 3GBGA 3Q0UA 4BUPA 3TDUC 2GAUA 3V7RA 1SAXA 2L3DA 1R71A 3ERED 1ZN2A 4OOIA 3QPSA 4U0VA 1Y6IA 3CP2A 3GTOJ 3TO6A 1VZ0A 3BR2A 2RV8A 4HEA2 3M1EA 3HB9A 1FTTA 2FBIA 3OYCA 3PO2J 2RNJA 5E3LA 4KITB 4CCLA 1B4AA 4I98B 3ASOH 4MQVA 5E3OA 3WTSC 3J7AY 4OAZA 5JR3A 3UNGC 2L9SA 3L2CA 4J01A 4Y33A 3ABTA 3QPHA 3H5NA 3V4GA 2IA1A 2VBYA 5LRSA 5HODA 4W1UA 1VQOI 2CS3A 3HTUA 1R23A 3ECOA 3MKYB 2ZSHB 2JRMA 3OL3A 4CCOA 2OU2A 3M8JA 2JA6J 4P55A 4QSHA 2O03A 4UV8A 3ZMVA 2DU9A 1S29A 4XLPF 4ESJA 3OOUA 4BDYA 2JUCA 2GOMA 1FTZA 3ISPA 1JT0A 5BS6A 1ZG1A 2CQNA 1IV8A 1TWGJ 2PJRB 1ON2A 1D3YA 1T56A 2ZMEC 5F0CA 2CW7A 2DOFA 2LNBA 3AG4H 3DU6A 5TRDA 4G7OF 3AKZA 2DMNA 5CLSA 5K7FA 2QZ8A 1W1WE 3TW6A 1O57A 3HGYA 5LRRA 3TL4X 1LE8B 1ON1A 4OMZA 5DS9A 4UUVA 4EJOA 3SJMA 2CJJA 3BTCA 3TOBA 1MBGA 2OQRA 4IXAA 1CGPA 4PFPA 2GIZA 1X1CA 4XR6A 2W84A 1YOVB 1DP3A 1B9NA 3EUKL 4BH9A 2Z33A 2DJNA 3DWLE 2CGPA 4LG0B 4ZDLA 3D5RC 1E2XA 5F64A 2QWWA 4PZJA 1D5VA 3JAMZ 3IUOA 2RREA 2P8TA 2NVUB 4A0YA 3AL0B 2FNAA 3NARA 3RKXA 1EH8A 1ZKGA 1W36D 1BW6A 2M7BA 4S0HB 2GIVA 2VKVA 2N8GA 1U8RA 4D5FA 5GPAA 2XGCA 2R0QC 1HCRA 1XSDA 3EYYA 3M8EA 4NBQA 2A07F 2D2WA 3BCAA 1BN5A 1QQIA 4KIFA 2ID3A 3WTXC 5H6RA 1Y0UA 5CYVA 2KIMA 4EGYA 4O3MA 4N4OB 2VXDA 2HGCA 1FY7A 4X6AJ 1LUJB 3D0SA 1F9NA 3S93A 3LSIA 3LSHA 2LVSA 1X2NA 2IS1A 1ZQ3P 4HDVA 4HYEA 5M5YJ 2KL4A 3H35A 1RNLA 2DCEA 4Y17A 3FKIJ 2DTRA 1YI2I 2XIGA 1BM9A 5L3BA 3DLAA 5FFXA 4NC7A 1ZREA 1D0YA 3P9IA 4OIRF 1P4XA 1XCVA 1J59A 1V54H 4FETA 3P9CA 1I6HJ 5LEKA 2KISA 3CCQI 3P9KA 2KZGA 3FWEA 4CYDA 5TISC 3GTLJ 5D5WB 1YIJI 2MBFA 3KZYA 5BQTA 4KYWA 2QSHX 2L9VA 4XLFA 3A01A 4BAYA 3DXJF 2WB1A 3LSKA 3VFZA 4OMYA 2BYVE 2VJJA 1DUXC 4F92B 1WJAA 2MYSA 3S14J 1BI2A 1GXPA 1ETQA 3OYDA 1T33A 2R92J 1MBKA 2M0MA 1OFCX 3CO7C 1BIBA 1DU0A 4Y13A 2YU3A 3IKVA 4RGRA 4UUSA 1NK3P 1UHWA 4XM3A 2V9PA 4G6DA 1VFCA 3T1BA 5J4YA 3S3MA 4R1HA 3R6SA 2E2HJ 2BHYA 3GLXA 5L3EA 3CJNA 2GZWA 2Q0OA 5ED4A 4KIBA 1N75A 1XMKA 3E1SA 3JRGA 2D5VA 4A12A 1M1EB 2D1VA 2PX9A 3KP6A 4XORA 4JX6A 5B1BH 3GX4X 5D5XB 5D5VB 3MMYB 3EUHA 1G3SA 1LDJA 1LEBA 3OOPA 2ME0A 1ODDA 4RA2A 3RPUD 2OBPA 4EJWA 1IDYA 4CCKA 5B3SH 1GLNA 4XRFA 2F4OB 2QEXI 1MNMC 2GXAA 1KYZA 1WI3A 5KK1A 1WPKA 4MQ9F 5EZHA 1Z7UA 4E4HA 2MFZA 3ASNH 1V4RA 1ZHFA 2VOOA 3DCFA 2LBFB 3DBRB 2VKHA 2MD0A 2EINH 1X3WB 1ZG3A 1U5TB 3BPXA 2JPCA 1JTXA 3KEYA 1YO5C 1Y1WJ 2ECCA 1BJZA 4DNCA 3OYBA 1PUEE 2F4IA 3B6AA 1MBJA 3GWZA 2DXIA 4OIPF 4YIIA 4AIKA 2Z99A 3G1OA 1FSEA 4UY8I 1AKHA 5J8FA 2DOEA 3CDIA 3V8JA 4A3MJ 4G94A 2WBMA 3L2RA 5JLXA 1G4DA 1P4AA 2FEZA 4V19K 3ZMUA 3FHZA 1XN7A 3FMQA 3TO9A 3J80K 1A6QA 2V79A 2ELKA 4AVPA 3FBIB 1Z7LA 4IRHA 4MGRA 2X48A 3W2WA 2KLOA 3BC8A 1CF7B 2OC6A 3WTWC 2IAIA 3GMEA 2JA2A 3EUAA 1MH4A 3DKXA 1XGOA 4QPOA 4ESFA 4PGHA 2B9SA 1Z9CA 2A5YB 5EEHA 3DBHB 4ASNA 3PQKA 1XC5A 3SXYA 2FA5A 3KIOA 1YTYA 1G8XA 1JHHA 4AUXA 4KDPA 3OS1A 3WTUC 3F23A 4BQAA 3JSPA 5DEQA 5B5EC 1TTYA 2H1LA 3RYRA 1MMSA 5L3CA 2LC2A 3HOXJ 4RM2A 2FRHA 5J1UA 2EV0A 2XAHA 1RC9A 1ETKA 1QO0D 1RETA 3H5RA 4BJ5C 3G3ZA 2VOPA 3H1CA 2H8RA 3EUHC 2K4JA 3BJAA 4N9IA 2Q2EB 2XAGA 3IP4B 4M73A 5CVRA 2ZCWA 1HKSA 3JTHA 1FP2A 2UWMA 4OAYA 1B6AA 4BACA 3CC2I 1K6OA 3NWSA 2CYYA 1RKWA 4MLOA 4HOBA 1RESA 1UZCA 2HKXA 3TP0A 3EYIA 5GP9A 1FWZA 3I9V2 4Y15A 3LOCA 4EM0B 4EV0A 5GADJ 1O4XA 1MDMB 3KEOA 3M7GA 4B09A 4M3FA 3CDLA 3TBIA 3CO6C 3CCMI 1W7PB 2DDAA 3K2AA 1LDDA 1UG2A 3RIRA 1YRNB 4AC0A 1RUOA 2LH9A 3DU5A 2R7DA 3CUQA 1V55H 2UXNA 4HF0A 1BI0A 4ENKA 3ZOBA 2UZKA 2LYCA 2STTA 3CC4I 3QODA 2GXGA 4E7LA 2FXAA 4GDFA 2L2OA 2XAFA 4JYKA 3JTGA 1FOXA 4PFOA 3MQ0A 3K4MA 3I4PA 3SQNA 2X1EA 2OTJI 2DFFA 3OIOA 1QPIA 2R7FA 3AAFA 2ISZA 1YE9A 3RCOA 2MSYA 3ZCOA 4V2FA 3DP7A 2ETHA 3GFLA 1FOYA 3HUGA 4X0GA 2DA5A 3I55I 1JUSA 2DMQA 4HX8A 3D5SC 4RLFA 2W00A 3CJQB 1ERDA 2ZJRF 2O0YA 1VF9A 4KIGA 1WWXA 2CQ7A 1OJLA 4PJMA 5KAIC 3Q0WA 3IHUA 2K3PA 1APLC 1JI8A 1WQ2A 3L2QA 1X4PA 2JRTA 4G7HF 2Z16A 5DYMA 2FQ3A 2DAOA 2IGMA 4A3DJ 3VEPA 1WJEA 4HSRA 4WXHA 3J7YJ 3R60A 2I5UA 3ZMTA 2HZTA 1R22A 3DTEA 5D6FA 1RIOH 2CUFA 2DPUA 4UHTA 3HL2A 3BDDA 1O3SA 1KU2A 2G9WA 3EPZA 2MABA 1LB2A 2KRFA 3ZN0A 3RI4A 3FXJA 3D5LA 5E8IA 5C4XJ 3ABKH 2ZMEB 3E5XA 3OSGA 3GTQJ 2YPRA 3LSJA 2VN2A 2E19A 1PYVA 2A3SA 4EM1A 3K7AJ 1JKPC 1G3YA 2L7ZA 1I50J 1U9OA 3DF8A 2M2EA 2LLKA 3FXQA 2X1CA 2IRFG 2FOKA 2VLAA 5BPDA 3H9GA 2RN7A 3G2BA 1QVTA 1ZELA 2QENA 1GVDA 4PJJA 4UVAA 5FD5A 3J81Z 2ZJPF 2VKEA 2KP6A 1QBJA 2W82A 2Y31A 1Y8QB 4L5JA 2QQAA 3G6EI 3I5UA 1R1VA 3VWBA 1Z6RA 3DEEA 4HRIA 1FPQA 2QBYB 4IL6C 4BEHB 2DLLA 2V6EA 2XSDC 2YS9A 1WKMA 4A6DA 4I0AA 2WWYA 3RZDJ 3CUQC 4TV7A 4ESBA 5E3MA 3HZJA 2CV2A 2R7ZJ 1XG1A 2OAZA 1IV6A 5BOXA 2JK3A 1GT0C 4PJNA 5LGUA 4CYCA 4OIOF 3C3WA 2KIQA 1TT5B 2WC2A 4DBQA 4HG2A 3BTLA 2K85A 5E1ZB 1B72A 3B73A 4PK4A 2EV6A 2AXLA 1HSJA 2Z1DA 3A02A 5A2QK 5KHDA 1WJFA 2TCTA 4XL9A 1Y1VJ 5KNLA 3BLYA 2HDCA 4RAGA 2VE9A 5EEGA 4EEFG 1MJAA 1QNTA 2WV0A 3FISA 5LEJA 1ETXA 1FBUA 1YIOA 5AONA 2KDZA 4RB1A 1LFBA 2F5DA 3I53A 3KP3A 3ZQIA 4I76A 5DM7F 4IF4A 1IGNA 1TWHJ 2EIJH 1VI0A 1U3EM 1VQ4I 2Y0SA 4BQNA 1LEAA 2G7UA 1IW7F 4A3CJ 1AA7A 2WTEA 1T95A 2KHMA 2IP2A 3ZQFA 4PJLA 2K9SA 1YG2A 2STWA 1QZZA 2ZBKA 3JREA 5K5QA 2MH2A 4WXCA 2MLGA 4FE4A 3V8KA 5DDGA 2PMUA 1OCZH 3RPQA 2XPWA 1SMYF 2QQBA 1G6NA 1DPUA 3CMEI 2RAEA 3PIPF 3FZVA 3CJRB 1JJ8C 2JN6A 3HEFA 4IHTA 2NOJB 3ABLH 3U1KA 2XGDA 2JWTA 3MKWB 3PL8A 1MMNA 1QPMA 1D1AA 4HX7A 1S72I 1YYVA 4JOMA 3X2QH 1QVUA 1S3JA 1U9NA 4L9VA 3W6VA 4D9JA 2PQ8A 2OCCH 2K86A 3ZXSA 2NS7A 2CU7A 4A5NA 1HOMA 1VQ8I 2CMPA 4YIRX 4IRIA 2R93J 1USTA 1X1PA 3DEUA 1JJ6C 1T8IA 2KRCA 2O61A 3SZTA 3MN2A 2QSGX 3HOYJ 3ML6A 4CH7A 2BVMA 3ZMZA 5ERIA 2PBIA 1WRJA 2FF4A 4ZYAA 1D1BA 5D5UB 2XASA 1IZ1A 2EA2A 1OPCA 4ENJA 1ENHA 3OL4A 1XS9A 5FROA 1BR2A 4R8HA 2R7UA 4LLLA 1RPWA 1JKQC 1MMDA 1BOAA 5ILUA 3Q3SA 3HOSA 5J1RA 3Q9SA 2DK8A 1GV2A 3MKLA 1MZBA 2V7FA 3ZQQA 4MEYF 4XOPA 2DQLA 3WGHA 1KU9A 5TJJA 4C2MJ 1I3QJ 2WAFA 1X1AA 3JRBA 5K7HA 1PP7U 1E3PA 3CCLI 3PUFA 2LFBA 2OUMA 2MGQA 3ZMSA 3FF5A 4FE7A 3K9TA 1O3QA 3SFIA 5E18F 5BPIA 3OV8A 1BJAA 1I1GA 2LY2A 2I8DA 4BXUA 3WU1B 2XRLA 2CW8A 1NK2P 2BE5F 1UG0A 2V4JC 3B02A 3L7WA 4ABZA 3CMAI 2HU9A 2X1DA 1AU7A 4P9UA 2GA1A 5B1AH 3BR0A 1JKRC 2LK2A 2Y2ZA 2F5CA 2CUZA 3DTKA 4ZYHA 2E1NA 3U9GA 2FSWA 4AM3A 4QWQA 1G2HA 3KZZA 4EJUA 2YUSA 4LLGF 5J4VA 3Q9VA 4Z6YA 3IH3A 5KCMA 4LLNA 3IRQA 1X1DA 3T8RA 4DJAA 4NHJA 1XD7A 3E3VA 4M6XA 3GXOA 5FD6A 1RKTA 1YJ9I 2P6TA 4CZCA 3BR6A 3REOA 4UUSB 4HV5A 1S9HA 1S7OA 4G12A 1W5SA 3BG9A 1TNTA 3LA3A 3K4NA 5FKKA 1S7AA 2DMPA 1GUUA 2KKOA 2B7EA 3GTGJ 4LITA 4QTRA 2ZO4A 1R5GA 1VTNC 2IT0A 2M30A 3MKZA 2E1MC 2YX7A 4IHWA 3HOWJ 4A3EJ 4AIDA 2KIUA 2V1DA 1NG6A 3HOUJ 4IOAF 1TL8A 3LNQA 2DO7A 1U78A 5IT9Z 4S05A 2AHQA 1D8JA 3J7AO 1P2FA 3G73A 3L1PA 3BQZA 4F7ZA 5GTHC 4ON0A 4YFXF 1T39A 2VPLA 1VQ6I 4BY7J 1HKTA 2DW4A 4LJZF 4CCMA 1X19A 2M0CA 3RYPA 2QQ8A 4A3KJ 1XGMA 1K6YA 5J6XA 1XDSA 2DA4A 2L4AA 5C4JJ 4NNJA 2NS0A 1A04A 3K1PA 1I39A 4A93J 1W4MA 3CP8A 1YX3A 3COAC 4XOTA 3K1MA 5DM6F 3QOPA 1TW3A 2W7NA 3N97A 4XKCA 4HA8A 2GBYA 1AKHB 1W5CC 2HNHA 1SFXA 3PFYA 3VYUB 4CXFA 3K70C 1ETOA 4M6VA 3ZMDA 3BR3A 3PIOF 3PM1A 1SC7A 2NVTJ 4GO1A 4BL0B 5EG0A 1XSXA 3Q0VA 4XBFA 6PAXA 3S1NJ 2W57A 3BG3A 4D7NA 1XMXA 1Q1VA 5HLGA 4IOCF 1H8AC 2P5KA 1S6LA 3RTRA 5H20A 2DFIA 3IH2A 2EB7A 4A3JJ 1R6RA 3KP5A 4CSWA 2A68F 4P1WA 2BY3A 3OYNA 1P9QC 4Q47A 3F6VA 1H88C 2QF7A 1HLVA 3QU3A 2HOTA 1IJWC 3KPHA 3ABMH 1QZYA 3K6GA 4IQ4A 2EH3A 1MBHA 5FKNA 3IRRA 2PG4A 1U8BA 2IGKA 1EV7A 3KZIC 5DV5A 2E2IJ 4Q4ZF 1Z91A 2K40A 4DZPA 4EM2A 1E0EA 3BWGA 2VJ4A 3VSLA 1HW2A 3SYTA 4E7HA 2JA8J 5K5RA 1GHCA 4OU0A 4L18B 2F6CA 1VQNI 3M3YJ 1HDPA 3I58A 3HOTA 2L7FP 2CQXA 3HGGA 3CZ6A 5LGNA 4IEJA 5HDNA 2QLZA 1MH3A 3WGGA 4FCYA 2JPBA 1O7LA 1FMWA 5GAEJ 1FC3A 3H0DA 1BA5A 1T98A 1ULYA 4I2OA 2L0KA 2VT3A 1ZARA 3QQAA 5L3GA 2NRAC 2W24A 2GQQA 2VQHA 4QIWN 1OMIA 3O8HA 4XIDA 3F9KA 2L5QA 5GTIC 4C3IJ 4GXOA 5JHFA 2HVQA 1W7PD 3F8NA 5H6QA 1IXCA 3PJRA 2XKOA 1U6GA 1ZTRA 3JRFA 2ZFUA 4EQQA 4BNCA 2DYRH 5AIQA 2JTVA 4KUMA 3O8GA 5EJCA 2FQ4A 4V2GA 3NEUA 2C6YA 2LRDA 2JA5J 1K61A 3BZCA 3TOAA 3WODF 3C2BA 1KA8A 2UV1A 1G59A 3W2VA 4KISA 4I01A 4KN4X 1R1TA 2Y0MA 1KGSA 1BC8C 1DGWY 4L5EA 1RR8C 3HUGB 1LFUP 1L3LA 3K0LA 3RQIA 4C2TA 2M1BA 5IP9J 1XB4A 2AQEA 3FMRA 4FTHA 2J5OA 2P5VA 1DPRA 4O6JA 3ZQLA 3I59A 4C2UA 5EF6A 1N25A 4HV6A 4XRSG 2KQRA 2BBYA 3LWFA 3VODA 2DDBA 4FASD 1PP8F 2V9KA 1R5HA 2E60A 2QGUA 1J0RA 2VE8A 3O6BB 2L9RA 3I3LA 4HQMA 4LB6B 2R7TA 2XRNA 4MFDA 3ZQCA 1FLIA 1H9GA 2XB0X 2VL8A 1OYWA 2ELJA 4M9SA 3RJPA 3HM5A 2DA6A 5BNGA 4GYIA 3JRAA 3FM3A 4DGWB 4RLQA 1SVLA 5LFAA 4IRGA 4J19A 3M07A 3CTAA 3LAJA 3KETA 1T38A 4FISA 3S16J 2E1OA 2VI6A 4AYBN 3H9QA 3T0YA 5J3LA 1YS7A 3G4SI 1XGNA 4A3LJ 5ICGA 2QUFA 3DPUA 3KYCB 5CVUA 3GTKJ 4RGSA 9ANTA 4PSXA 1RZ4A 4RM3A 2A6HF 1TC3C 1B9MA 2DFHA 4E7ZA 3KYDB 2PEXA 1H9TA 4C3JJ 3GFJA 4I6ZA 4IHYA 3S1QJ 4FQGA 1USSA 4HF2A 1J09A 4U7BA 1SVOA 4MO7A 2M9HA 2MC4A 4U87A 4ZZDA 4CYCB 4U0WA 1QA6A 1D0XA 1V5FA 2F48A 2WADA 2Y75A 1SVMA 4IX7A 3G1MA 3FBNB 3IL2A 1B72B 2WAQN 1WI9A 1K4SA 2MD5A 1GV5A 3KCCA 1Q1HA 2BY2A 3OYGA 5LHIA 2JT1A 2H8WA 3KLOA 1FNNA 3MAJA 4AVZA 1UCRA 1ZGAA 3DEWA 1MIJA 2X6XA 4XLNF 5HDKA 4BE1A 3S2HJ 1ZLJA 5IY5H 4XSXF 2DT5A 4ZYEA 3GFMA 3IWZA 4RBOA 2E5ZA 3HSRA 4M6YA 3FXMA 3R4KA 4WXDA 3C7JA 3BZKA 3G71I 3CCSI 3PFIA 4AWXB 3I56I 2F5VA 3NWTA 1ZLKA 3HSFA 4IHXA 3H9JA 4MEXF 1K79A 4Q5SF 2B63J 3H0GJ 5K5OA 5LHHA 3OYIA 3IWFA 2XAJA 2AQFA 2FMLA 3HHHA 2DN0A 1LPQA 3HDDA 2Y48A 2QKMB 1OCCH 2AXTC 4B48A 4XONA 1B1BA 2ZKZA 1WSUA 4BXXJ 4DIQA 2HOSA 3WG7H 1IUYA 2KFDA 1IUFA 4BQOA 3CESA 2Z5UA 2RKHA 1OISA 1ZYRF 1AWCA 4C3HJ 5JVTA 1SANA 2W1OA 3K4JA 2KPMA 2R7OA 3LQQA 4RB0A 1J2XA 2A6EF 2R7WA 2NNYA 2H1KA 1ZAOA 2XKPA 2GA2A 5GAHJ 1R9TJ 2ZB9A 3HRMA 1Z67A 1BC7C 3RKWA 3MVPA 3O3KA 4AU7A 4XK4A 3J80Z 1FX7A 3LSPA 2YX4A 3PNVA 3H36A 4R79A 5J8CA 2YSRA 4F55A 2EQRA 3CF2A 3HPGA 2RQQA 5CKTA 1MNEA 3F8MA 3H3UA 3PNYA 2EFQA 1B8IA 2E34A 4ZDOA 2QSFX 2R5ZA 1OYIA 1R5ID 3MWMA 3IV5A 4AIJA 1IG7A 3MEXA 2LG4A 3P5JA 2O8XA 4YFKF 1EF4A 3KEQA 1POGA 1TZLA 4O5VA 2A61A 3FXKA 4G8XA 4UVCA 5IP6A 2DFEA 2CW0F 3QAHA 4LD5A 3U1DA 3L9FA 4BE2A 3WG9A 3GFIA 3ECHA 3CJTB 1A5JA 2XGEA 2BEOA 3M8FA 1A6IA 1IRGA 3ZGKA 5CVVA 4DYQA 3F8FA 2L02A 4B4CA 4D1QA 1LVKA 2IS4A 4OINF 1KQ9A 1RR7A 5F0HA 2UXXA 4ZZLA 3TO7A 4PCQA 3ERMA 3WHCA 4C9YA 2M87A 4BDZA 2BGCA 3AL0C 4M71A 2HDWA 4U0YA 2MC3A 5K7ZA 4HW0A 2JQ7A 4NB5A 1R4NB 3OMYA 2ISYA 2V6CA 1WHUA 3SDBA 2EZLA 2LTPA 3OS0A 2BXZA 5HS7A 4EMSA 3ZPLA 4H4KC 5FFZA 1ZGWA 1IRFA 2ZJQF 4WK8F 2EILH 1FYLA 5EEAA 4XN0A 1SFUA 1XTAA 5L3DA 5F1RA 3A4CA 4CICA 1MW7A 2XVCA 1H89C 4MNUA 5BMZA 1FIAA 2KJCA 1MJBA 3B6CA 4E6KG 1DDNA 2OZUA 4MIMA 1ETWA 2CO5A 4GCVA 2HYFA 4ZH4F 2ZSIB 2LR8A 2VQGA 3H3ZA 2R5YA 2R7SA 2KJBA 1W0UA 4L9TA 3P7NA 3ZQGA 4L0ZB 1R1UA 4KT5C 1DP7P 1SD6A 3DPTA 2RNGA 1KU3A 3WGIA 1LQ1A 2CRGA 5JLWA 5HNHA 1ONVA 3VYTB 1GDTA 2M34A 4C30A 3S17J 4UVBA 2WB1N 3S2WA 2HVRA 3JRIA 2DMTA 3A1YA 1OR7C 3LSGA 4ZC3A 5IYCJ 4E7KA 1D8KA 4ITVA 4DZJA 1OCOH 3HOZJ 4LFUA 4K2EA 4E70A 1K78A 3GO5A 3HBLA 4BS9A 2IXSA 3S3NA 3FKJA 4RB2C 3W6KB 3M9AA 1HSTA 2P4WA 2KRHA 5E79C 5HLHA 4RB3C 2D1HA 1KZHA 3RKQA 4IJAA 3GTPJ 2PI0A 4A0XA 2BOLA 3U21A 2IA0A 1S5LC 5EZGA 1QZEA 2LSOA 2FE3A 2UUZA 2LF8A 2VIXA 3TDZC 2P7VB 2VKDA 1TWAJ 2M3AA 1QU3A 1Y8RB 2FBKA 1HDDC 3J7ZI 3QPLA 5FLMJ 4F91B 3DQVC 4L9JA 2HQAA 2FD5A 2LD5A 1X58A 1JT6A 2M5WA 2HDDA 5DUIA 1PVEA 3F8BA 2ZNZA 3K4KA 2CQQA 4F52A 1NHAA 5DCMA 5LD2C 2BY1A 4JP0A 2XSJC 4CCNA 1UELB 5FLVA 4N0BA 2WY7Q 5EG0B 2O8KA 2HR3A 4BQQA 2R7XA 1FEXA 1YJNI 1VQ9I 4FX4A 2MG4A 2CV0A 3MD2A 3FXUA 4MTEA 1HBXG 1I27A 3GZNB 4KT6A 3V8LA 4Y4RA 2JUGA 3E0JB 3HKZN 4I02A 4HBLA 1EH7A 2DT6A 2JA7J 1CQTA 1U5TC 4CO8A 2VBXA 1J75A 2IVMA 3SFZA 1EKEA 4MFEA 4NUBA 4KA4A 3HC7A 5F08A 5ICFA 1IN8A 4Y3OA 4MTDA 4IPAA 1YJWI 4U88A 4KMUX 4LOCA 3WTYC 2Y9YA 2VBWA 4PGGA 4CGZA 1IXSB 1ITYA 5A2QZ 4GRIA 4DYCA 5JHUA 2Q8KA 2M4KA 3CCUI 3JSOA 2GXBA 1ETVA 1X3UA 4BHCA 2K02A 3E6BA 1F1ZA 5DCFA 2WAEA 2EZKA 2VJIA 3LSTA 1RUNA 4A3FJ 4NQWA 3MZHA 3JRCA 2EPFA 1RI7A 1HXDA 1UJ8A 2E7XA 1J7KA 1ZG5A 3Q5FA 1P4WA 1GVJA 2L54A 3E6CC 1JKOC 4BHPA 2CG4A 1W36C 4P96A 2FUG2 2JVGA 1FMVA 1F4KA 2RC4A 3OYEA 2M45A 3KYLA 1SFOJ 3FIWA 2M8GX 2WY8Q 2O3FA 1IRZA 3K69A 3LAPA 4XSZF 5HOOA 2NOGA 4P5OA 2W48A 5D8LB 2OQGA 1VQ5I 1K83J 3NQOA 2XAQA 4YRVA 3S8PA 3CUOA 1TT0A 3UKGA 1PDNC 4DQ2A 2ZXWH 1WJBA 2A05A 3A01B 1BR4A 4LGWA 2E5NA 5C44J 4ZYGA 1IXRC 3S1RJ 5AIPA 2HOAA 1ACIA 3QPTA 2W25A 5HNFA 1P7JA 1R58A 3WE3A 1XMAA 2VODA 3A2KA 1GXQA 3LMMA 3E6MA 1O7FA 2H6BA 3JRHA 1BI3A 2LP0A 4HZFA 4RAZA 3A03A 3EETA 3SHFA 3CCEI 3OIPA 2NVYJ 2IS2A 3I59B 3KE2A 3HHGA 3OYHA 3AG1H 1SEUA 3F72A 4LG3A 5D6EA 4JBAA 2LKPA 2XPVA 5KVRA 2EIKH 4G6QA 5FKOA 3CCJI 1REPC 4RS8A 4F3QA 1IO2A 2VT2A 3DKWA 4XICA 1MSEC 1OQYA 2IA2A 5IOYA 1SFKA 2CFXA 4HLYA 4CCJA 4BGDA 1I3AA 1TW2A 1FJLA 5F04A 4Y7NJ 4HX4A 1IF1A 2V1UA 1ZGJA 1UFMA 3WE2A 3FX3A 2EJRA 2R4GA 1UHMA 1TBXA 1Z3XA 4KFCA 4F93B 1T0FA 1FYMA 4JX4A 3EQLF 2BW3A 5FGMA 2EV5A 1YX5A 1FYKA 2M4GA 3ONQA 2ACJA 4RGXA 5EDNA 4B3AA 4NC8A 1XCBA 3HRUA 1MJ9A 4G7ZF 5HDGA 3S32A 5EGOA 1OCRH 1H0MA 2E1CA 3CLQA 1ZK8A 3SZGA 3OYKA 3D1NI 1IDZA 1JE8A 1QRYA 4FT8A 4HPQA 1TP4A 2YR2A 4B3XA 3V7SA 1KONA 1XGSA 1BOBA 5IYBJ 4M9ZA 5ILSA 3JRDA 2RVCA 2G0EA 3TP3A 4ENNA 3PNTA 2V1NA 3T8TA 2QM3A 4A2UA 2F2EA 2K9QA 2XGXA 5JFRA 4II3A 3U2RA 1JTYA 1IN7A 2E35A 2DPDA 3C2GA 1PUFA 4I0BA 4EJVA 2Z2SB 2O6GE 1KQ0A 2A6TA 1S8NA 3BJOA 1Z1DA 1E3OC 1X3ZB 3F8CA 3JCUC 4WX9A 4BY1J 1FIPA 5J47A 3K2ZA 1Z05A 2VBZA 2A5WA 1B59A 3DLLF 2ZXIA 3FXLA 3IAM2 1SMTA 1WGXA 3FK7A 1HKQA 2JVHA 4BBRJ 5LGTA 2NVQJ 5F6FA 3OIQA 2IEKA 4UNOA 1WCMJ 2X0LA 4AD9A 1FOKA 4IVNA 1J9IA 1K7AA 3E6DA 2X51A 3VDXA 2ADUA 4QPQA 3T5XA 3K4CA 1RRJA 4XRMA 1Z0XA 4A6EA 4M74A 1A35A 4L0YB 3FXOA 1P92A 1HQCA 3BY6A 3PSIA 3O2PE 2R3SA 3F6OA 3GF2A 4U7DA 3OYMA 5DTDA 2EA4A 2IPQX 1D1CA 1T0FC 1SD7A 1WJCA 2KDOA 2Y0SN 4HDUA 2XF6A 1JGSA 3GLLA 1SD4A 3BJ6A 1QGPA 2BHZA 2VQCA 4M3EA 4RMNA 2P81A 1TQIA 4KMFA 5FLXK 2EIMH 2A69F 2BV6A 1P7IA 2NYXA 4IHVA 3ZQ7A 4A0ZA 3JR9A 3CUQB 3R61A 1FBQA 4HSTA 1WH5A 1N77A 1IC8A 1BBYA 3BROA 2GM4A 4CUGA 3RZOJ 1LFPA 3DFGA 3G1LA 4FHTA 3F22A 2ID6A 4KICA 3LFUA 2I10A 2X4HA 4ANJA 3ULQB 5M5XJ 5IOZA 5D4RA 1VQMI 2QCOA 2R7RA 3BR5A 2K9LA 1JUMA 4YEJA 2HI3A 1Y39A 1JHFA 5D8KB 1B8IB 3HG9A 1I1SA 1TNSA 2F4MB 3FXRA 5JVGF 2R5ZB 2IGNA 1O3RA 4MHGA 1Z6TA 3KX2A 4IO9F 2MH9A 3R0JA 2NVXJ 3QYEA 2VUMJ 4BYYA 3SEQA 3BPVA 2OA4A 4E7IA 5CPRB 3E5UA 4YELA 2WV1A 2CUJA 3HSEA 5CVIA 1QHGA 4XKBA 2EFWA 2R7VA 3H92A 5HLTA 3K10A 5IPAA 4M3GA 4II2A 3QYBA 3LL7A 3VSKA 1YQAA 2EFPA 4L5IA 3BCBA 4IQJA 5LHGA 2FU4A 3BZ6A 2K4BA 4DYRA 4OIQF 1SD5A 2R7QA 3W6JB 2ESNA 1YLFA 2DODA 1NH3A 2ECBA 1UHSA 3LA7A 3S15J 1T6SA 4IKFA 3HOVJ 3ROUA 2DT7B 5E3NA
chains in the Genus database with same CATH topology
2ELHA 2M8EA 4QLCU 1YW7A 2JSCA 3HYIA 3JW4A 3GW2A 3WTTC 3L09A 5DD4A 2HOEA 3ZP5A 1F5TA 1AOYA 1FZPB 5FLXZ 2KIFA 3GVAA 2L4MA 3IC7A 1KYWA 1ZRDA 4LMYA 2H09A 4CHUA 2J5PA 1FP1D 1W5TA 3KP7A 2RQPA 2QVOA 3KLNA 2EWNA 5LLQA 5HS8A 2K7LA 3HIFA 1LDKB 1HW1A 2HKOA 4HF1A 5IT3A 1K78B 3WTVC 2XROA 5E8GA 4RGUA 4LG0A 3LA2A 1TQMA 4B8XA 4JQFA 4YFNF 1V3FA 1FBSA 1C0WA 4L9NA 2RDPA 2W85A 2JZYA 5CJ9A 4ETSA 3MZYA 2XV4S 3ZN1A 1TLHB 5E17F 3SZPA 3QP5A 1UB9A 2HTSA 3N4MA 4A5MA 4GYGA 3MCZA 5DCMB 3VOEA 3KP2A 3E5QA 1YS6A 2PJPA 5HVQC 3BOQA 1FSHA 2TDXA 2FNPA 4UV9A 3J81K 4M72A 4N9HA 2DQRA 5E1WA 1IAWA 2HYGD 2IJLA 1YW9A 1OR7A 4D0PA 5E1XA 3KFWX 4M9XA 2D45A 1MKMA 1XSVA 3ABUA 2ZJ2A 3NRVA 2P6SA 3LFKA 4P9FA 1L0OC 1FT9A 1JXSA 4WWCA 4YG2F 3BP8A 2Z9OA 4HLXA 5CVJA 4LK1F 1ZRFA 1I6XA 1R36A 4IHSA 4G9YA 4CDGA 2P7CB 2XUBA 4KN7X 2VXZA 1J5YA 2EFOA 1YFHA 3GUDA 1TQPA 2P5LC 2L01A 3K1NA 4ZYDA 1G3TA 2CSOA 1IN5A 2H27A 2H6CA 2OZ6A 2HTJA 1P6RA 3QP6A 3WU0A 4EVIA 2HS5A 3CDHA 2CQKA 3E97A 1MGTA 2V9VA 1U5TA 2ZXJA 4HQEA 3TGNA 2B0LA 2VC0A 3GZ6A 3TKYA 4H0EA 4KNYA 1O3TA 1I5ZA 1STZA 1HW5A 4BHBA 2CWEA 1BI1A 5K1YA 1R00A 2G7HA 3GYHX 3CLOA 1EH6A 2HQRA 1KQ8A 3KP4A 2COMA 1ZH5A 3F3XA 3C18A 3GEZA 2PFBA 5E20A 1CF7A 3FMSA 3MFKA 2E7WA 2F5FA 4UXNA 4S04A 1R7JA 1T2KA 3DV8A 4GGGA 2PLYA 3I0TA 1E17A 2RGVA 3DPLC 2MLKA 3WTZA 5D4SA 1SFEA 2K27A 2DBBA 2LF7A 2MA3A 2PMHA 2XHKA 3RDIA 3FM5A 2Q2EA 4CZZA 1OKRA 5ICCA 4HAMA 3LQRA 1XDUA 1IN4A 5FB2A 1ZRCA 3ELKA 3QU6A 2EFNA 1U2WA 5HS9A 2VONA 1YW8A 1MDMA 3RKYA 4I7HA 3HRTA 1W7PA 1KU7A 3PQJA 4WF2A 4YIFA 3I64A 2DK5A 4RAYA 2Z3YA 1G3WA 3V7CA 3I54A 5LBQA 3GZ5A 2ZNYA 2HFHA 5JI6A 2HQNA 5FO5A 2QQ9A 2FBHA 2F5EA 2NNNA 1LNWA 5ILVA 4ENMA 1LVAA 2HWVA 2V1XA 2H94A 5IT9K 4AIHA 4EJTA 3TQNA 2HEOA 2PN6A 2GWRA 3IKTA 4PDKA 3L00A 2EK5A 4Z2YA 3RPUA 2ZFWA 2VC1A 4EGZA 2OD5A 4LB5A 2NAZA 3QRFF 4Q48A 2IW5A 2AS5F 4JK1X 2ZMEA 5HLIA 3HRSA 3VB2A 5L3FA 2QYOA 2LDUA 4LK0F 1OYYA 4WCGA 3HTSB 2ESHA 4FX0A 1BIAA 3C1DA 3EDPA 5ICEA 5DUKA 2FMYA 2QBYA 1MD0A 2DI3A 4I09A 1IN6A 3I71A 5DD8A 3JAMK 3F21A 3R0AA 1LJ9A 3TDUC 2GAUA 3V7RA 1SAXA 2L3DA 3ERED 1ZN2A 4OOIA 4U0VA 3TO6A 2RV8A 3M1EA 2FBIA 2RNJA 1B4AA 4I98B 4MQVA 3WTSC 5JR3A 3L2CA 3ABTA 3QPHA 3V4GA 2IA1A 2VBYA 5LRSA 3HTUA 1R23A 3ECOA 2OU2A 4P55A 2O03A 4UV8A 3ZMVA 2DU9A 1S29A 4XLPF 4ESJA 3ISPA 5BS6A 1ZG1A 1ON2A 1D3YA 2LNBA 4G7OF 5TRDA 5CLSA 2QZ8A 1O57A 5LRRA 1ON1A 4OMZA 4UUVA 4EJOA 3TOBA 2OQRA 4IXAA 1CGPA 2W84A 1B9NA 4BH9A 2Z33A 2CGPA 4LG0B 1E2XA 5F64A 2QWWA 4PZJA 1D5VA 3JAMZ 2P8TA 4A0YA 2FNAA 3RKXA 1EH8A 2GIVA 1U8RA 1XSDA 3EYYA 3M8EA 2A07F 2D2WA 1BN5A 1QQIA 4KIFA 3WTXC 5H6RA 1Y0UA 5CYVA 2KIMA 4EGYA 4O3MA 2HGCA 1FY7A 3D0SA 1F9NA 4HDVA 4HYEA 1RNLA 4Y17A 2DTRA 2XIGA 1BM9A 5L3BA 5FFXA 1ZREA 3P9IA 4OIRF 1P4XA 1XCVA 1J59A 3P9CA 5LEKA 3P9KA 3FWEA 4CYDA 5D5WB 2MBFA 3KZYA 5BQTA 4KYWA 4BAYA 3DXJF 3VFZA 4OMYA 2BYVE 1DUXC 1BI2A 1GXPA 3CO7C 1BIBA 4Y13A 2YU3A 3IKVA 4RGRA 1UHWA 4G6DA 3T1BA 4R1HA 3R6SA 3GLXA 5L3EA 3CJNA 2GZWA 2Q0OA 5ED4A 4KIBA 1XMKA 4A12A 2D1VA 3KP6A 3GX4X 5D5XB 5D5VB 3EUHA 1G3SA 1LDJA 1LEBA 3OOPA 1ODDA 2OBPA 4EJWA 4XRFA 1KYZA 5KK1A 4MQ9F 1Z7UA 1V4RA 1ZHFA 2VOOA 1ZG3A 1U5TB 3BPXA 2JPCA 1YO5C 4DNCA 1PUEE 3GWZA 4OIPF 4YIIA 4AIKA 2Z99A 1FSEA 5J8FA 3V8JA 4G94A 1G4DA 1P4AA 2FEZA 3ZMUA 3FHZA 1XN7A 3FMQA 3TO9A 3J80K 2V79A 4AVPA 4IRHA 4MGRA 1CF7B 3WTWC 1XGOA 4ESFA 4PGHA 1Z9CA 2A5YB 5EEHA 4ASNA 3PQKA 3SXYA 2FA5A 1YTYA 1JHHA 4KDPA 3WTUC 3F23A 4BQAA 3JSPA 5DEQA 1TTYA 3RYRA 5L3CA 2FRHA 2EV0A 2XAHA 1QO0D 3G3ZA 2VOPA 2K4JA 3BJAA 4N9IA 2XAGA 4M73A 5CVRA 2ZCWA 1HKSA 3JTHA 1FP2A 2UWMA 1B6AA 1K6OA 2CYYA 4HOBA 2HKXA 3EYIA 1FWZA 4Y15A 4EM0B 4EV0A 1MDMB 3KEOA 3M7GA 4B09A 3CO6C 1W7PB 3RIRA 1LDDA 1RUOA 2R7DA 3CUQA 2UXNA 4HF0A 1BI0A 4ENKA 2UZKA 2STTA 2GXGA 2FXAA 2XAFA 3JTGA 3MQ0A 3SQNA 3I4PA 2R7FA 3AAFA 2ISZA 3DP7A 2ETHA 3GFLA 3HUGA 4HX8A 2O0YA 4KIGA 1WWXA 3IHUA 1WQ2A 2JRTA 4G7HF 5DYMA 2FQ3A 2DAOA 3VEPA 4WXHA 3R60A 3ZMTA 2HZTA 1R22A 5D6FA 1RIOH 2DPUA 4UHTA 3BDDA 1O3SA 1KU2A 2G9WA 1LB2A 2KRFA 3ZN0A 3RI4A 5E8IA 3D5LA 3E5XA 2ZMEB 2YPRA 2VN2A 2A3SA 4EM1A 1G3YA 3DF8A 3FXQA 2IRFG 2FOKA 5BPDA 2RN7A 4UVAA 2QENA 3J81Z 5FD5A 1QBJA 4L5JA 2QQAA 3I5UA 1R1VA 1Z6RA 1FPQA 2QBYB 2DLLA 1WKMA 4A6DA 4I0AA 2WWYA 3CUQC 4TV7A 4ESBA 2OAZA 5BOXA 5LGUA 4OIOF 3C3WA 2WC2A 5E1ZB 3B73A 2EV6A 2AXLA 1HSJA 5A2QK 2HDCA 2VE9A 5EEGA 1MJAA 1QNTA 2WV0A 5LEJA 1YIOA 1FBUA 5AONA 4RB1A 2F5DA 3I53A 3KP3A 4IF4A 1U3EM 1LEAA 2G7UA 1IW7F 2WTEA 2IP2A 2STWA 1YG2A 1QZZA 2ZBKA 5K5QA 2MH2A 4WXCA 2MLGA 3V8KA 5DDGA 2PMUA 3RPQA 1SMYF 2QQBA 1G6NA 1DPUA 3FZVA 4IHTA 1QPMA 4HX7A 1YYVA 1S3JA 4L9VA 2PQ8A 2K86A 4A5NA 4IRIA 1USTA 3DEUA 2O61A 3SZTA 3ML6A 3ZMZA 5ERIA 2PBIA 1WRJA 2FF4A 5D5UB 2XASA 1IZ1A 2EA2A 1OPCA 4ENJA 4R8HA 4LLLA 1BOAA 5ILUA 3HOSA 3Q9SA 2DK8A 1MZBA 4MEYF 3WGHA 2DQLA 1KU9A 5TJJA 1PP7U 3ZMSA 3FF5A 3K9TA 1O3QA 5E18F 5BPIA 3OV8A 1BJAA 1I1GA 4BXUA 3WU1B 2BE5F 3B02A 3L7WA 4P9UA 2GA1A 2F5CA 4ZYHA 2E1NA 3U9GA 2FSWA 4QWQA 3KZZA 4EJUA 4LLGF 3Q9VA 4LLNA 3IRQA 3T8RA 4NHJA 1XD7A 3E3VA 4M6XA 3GXOA 5FD6A 2P6TA 3REOA 4HV5A 1S7OA 1W5SA 1TNTA 3LA3A 1S7AA 2KKOA 2ZO4A 1R5GA 1VTNC 2IT0A 2M30A 2YX7A 2KIUA 2V1DA 2DO7A 1U78A 5IT9Z 4S05A 1D8JA 3J7AO 1P2FA 3G73A 4F7ZA 4ON0A 4YFXF 1T39A 1HKTA 2DW4A 4LJZF 3RYPA 1XGMA 5J6XA 1XDSA 2L4AA 2NS0A 1A04A 3K1PA 1W4MA 3COAC 3K1MA 3QOPA 1TW3A 3N97A 4HA8A 1SFXA 4CXFA 3ZMDA 4GO1A 1XSXA 4XBFA 6PAXA 2W57A 5HLGA 2P5KA 1S6LA 3RTRA 5H20A 2DFIA 2EB7A 3KP5A 2A68F 4Q47A 3F6VA 3QU3A 1QZYA 3IRRA 2PG4A 1EV7A 5DV5A 4Q4ZF 1Z91A 4EM2A 3BWGA 1HW2A 5K5RA 1GHCA 4OU0A 4L18B 3I58A 3HOTA 5LGNA 5HDNA 2QLZA 3WGGA 2JPBA 1O7LA 1FC3A 1T98A 1ULYA 4I2OA 2VT3A 1ZARA 5L3GA 2NRAC 2W24A 2GQQA 1OMIA 4GXOA 1W7PD 3F8NA 5H6QA 1IXCA 2XKOA 1U6GA 4EQQA 4BNCA 5AIQA 2JTVA 4KUMA 2C6YA 3NEUA 3TOAA 3WODF 1KA8A 4I01A 4KN4X 1R1TA 2Y0MA 1KGSA 1BC8C 1L3LA 3K0LA 2M1BA 1XB4A 3FMRA 2J5OA 2P5VA 1DPRA 4O6JA 3I59A 4HV6A 2BBYA 3LWFA 3VODA 1PP8F 1R5HA 2VE8A 1J0RA 3O6BB 4HQMA 4LB6B 2XRNA 1FLIA 1H9GA 4M9SA 1OYWA 3RJPA 4GYIA 3FM3A 4IRGA 3CTAA 3LAJA 3KETA 1T38A 3T0YA 1YS7A 1XGNA 5ICGA 2QUFA 5CVUA 4RGSA 1RZ4A 2A6HF 1B9MA 2PEXA 1H9TA 3GFJA 1USSA 4HF2A 4U7BA 4ZZDA 4U0WA 2Y75A 3IL2A 1WI9A 2MD5A 3KCCA 1Q1HA 5LHIA 2JT1A 3KLOA 3MAJA 1FNNA 1UCRA 1ZGAA 4XLNF 5HDKA 1ZLJA 4XSXF 2DT5A 4ZYEA 3GFMA 3IWZA 3HSRA 4M6YA 3R4KA 4WXDA 3C7JA 3PFIA 4AWXB 1ZLKA 3HSFA 4MEXF 1K79A 4Q5SF 5K5OA 5LHHA 3IWFA 2XAJA 2FMLA 3HHHA 2Y48A 1B1BA 2ZKZA 1WSUA 1IUYA 2Z5UA 2RKHA 1ZYRF 1AWCA 5JVTA 3LQQA 4RB0A 1J2XA 2A6EF 2NNYA 1ZAOA 2XKPA 2GA2A 3HRMA 1BC7C 3RKWA 3O3KA 3J80Z 1FX7A 2YX4A 4R79A 5J8CA 2YSRA 3F8MA 3H3UA 2EFQA 1OYIA 3MWMA 4AIJA 3MEXA 2O8XA 4YFKF 3KEQA 4O5VA 2A61A 4G8XA 4UVCA 2CW0F 3QAHA 3U1DA 4LD5A 3L9FA 3WG9A 3GFIA 3ECHA 3M8FA 2BEOA 1IRGA 5CVVA 3F8FA 2L02A 4OINF 1KQ9A 2UXXA 4ZZLA 3TO7A 4PCQA 2M87A 2BGCA 4M71A 4U0YA 2MC3A 4HW0A 4NB5A 2ISYA 2V6CA 5HS7A 4EMSA 3ZPLA 5FFZA 1IRFA 4WK8F 1FYLA 1SFUA 5L3DA 5F1RA 4CICA 2XVCA 4MNUA 5BMZA 2KJCA 1MJBA 1DDNA 2OZUA 2CO5A 4GCVA 2HYFA 4ZH4F 3H3ZA 2KJBA 4L9TA 3P7NA 4L0ZB 1R1UA 4KT5C 1DP7P 1SD6A 3DPTA 1KU3A 3WGIA 1LQ1A 1ONVA 4UVBA 3S2WA 1D8KA 4LFUA 4K2EA 4E70A 1K78A 3GO5A 4RB2C 3W6KB 3M9AA 1HSTA 2P4WA 5HLHA 4RB3C 2D1HA 4IJAA 2PI0A 4A0XA 2IA0A 2LSOA 2FE3A 2LF8A 3TDZC 2P7VB 2FBKA 3DQVC 4L9JA 2M5WA 5DUIA 3F8BA 2ZNZA 1NHAA 5DCMA 4N0BA 2HR3A 4FX4A 4MTEA 3FXUA 1HBXG 1I27A 3V8LA 4I02A 4HBLA 1EH7A 1U5TC 4CO8A 2VBXA 1J75A 2IVMA 3SFZA 4KA4A 5ICFA 1IN8A 4MTDA 4IPAA 4U88A 4KMUX 3WTYC 2VBWA 4PGGA 4CGZA 1IXSB 5A2QZ 5JHUA 2Q8KA 3JSOA 2GXBA 4BHCA 1X3UA 2K02A 3E6BA 1F1ZA 5DCFA 1RUNA 3LSTA 4NQWA 3MZHA 1RI7A 1HXDA 1ZG5A 2E7XA 1J7KA 3Q5FA 1P4WA 1GVJA 2L54A 3E6CC 4BHPA 2CG4A 4P96A 1F4KA 2RC4A 2M45A 2O3FA 3K69A 3LAPA 4XSZF 5HOOA 4P5OA 5D8LB 2OQGA 3NQOA 2XAQA 3CUOA 1PDNC 4DQ2A 4LGWA 4ZYGA 1IXRC 5AIPA 3QPTA 2W25A 1R58A 3WE3A 1XMAA 2VODA 1GXQA 3E6MA 1O7FA 2H6BA 1BI3A 4HZFA 4RAZA 3EETA 3SHFA 3I59B 3KE2A 3HHGA 3F72A 5D6EA 4JBAA 2LKPA 5KVRA 4G6QA 1REPC 4RS8A 3DKWA 2VT2A 2IA2A 2CFXA 4HLYA 1TW2A 4HX4A 1IF1A 2V1UA 1ZGJA 1UFMA 3WE2A 3FX3A 2EJRA 1UHMA 1TBXA 4KFCA 1T0FA 1FYMA 3EQLF 5FGMA 2EV5A 1FYKA 2ACJA 4RGXA 1XCBA 3HRUA 1MJ9A 4G7ZF 5HDGA 1H0MA 2E1CA 1JE8A 4FT8A 2YR2A 3V7SA 1XGSA 4M9ZA 5ILSA 2RVCA 4ENNA 3T8TA 2QM3A 4A2UA 2F2EA 2XGXA 5JFRA 3U2RA 1IN7A 2DPDA 4I0BA 4EJVA 2O6GE 1KQ0A 1S8NA 3BJOA 1Z1DA 3F8CA 4WX9A 3K2ZA 1Z05A 2VBZA 1B59A 1SMTA 1HKQA 5LGTA 5F6FA 4UNOA 2X0LA 4AD9A 1FOKA 4IVNA 1J9IA 1K7AA 3E6DA 2ADUA 3T5XA 4A6EA 4M74A 4L0YB 1P92A 1HQCA 3BY6A 3O2PE 2R3SA 3F6OA 3GF2A 4U7DA 2EA4A 2IPQX 1SD7A 4HDUA 1JGSA 1SD4A 3BJ6A 1QGPA 5FLXK 1TQIA 4KMFA 2A69F 2BV6A 2NYXA 3ZQ7A 4A0ZA 3CUQB 3R61A 1FBQA 1BBYA 3BROA 3DFGA 4FHTA 3F22A 4KICA 2X4HA 3ULQB 5D4RA 1JHFA 5D8KB 1I1SA 1TNSA 3FXRA 1O3RA 4MHGA 1Z6TA 2MH9A 3R0JA 4BYYA 3BPVA 2OA4A 3E5UA 3HSEA 5CVIA 2EFWA 3H92A 1YQAA 2EFPA 4L5IA 5LHGA 2FU4A 3BZ6A 2K4BA 4OIQF 1SD5A 3W6JB 2ESNA 1YLFA 3LA7A 1T6SA 3ROUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELH A;  2M8E A;  4QLC U;  1YW7 A;  2JSC A;  3HYI A;  3JW4 A;  3GW2 A;  3WTT C;  3L09 A;  5DD4 A;  2HOE A;  3ZP5 A;  1F5T A;  1AOY A;  1FZP B;  5FLX Z;  2KIF A;  3GVA A;  2L4M A;  3IC7 A;  1KYW A;  1ZRD A;  4LMY A;  2H09 A;  4CHU A;  2J5P A;  1FP1 D;  1W5T A;  3KP7 A;  2RQP A;  2QVO A;  3KLN A;  2EWN A;  5LLQ A;  5HS8 A;  2K7L A;  3HIF A;  1LDK B;  1HW1 A;  2HKO A;  4HF1 A;  5IT3 A;  1K78 B;  3WTV C;  2XRO A;  5E8G A;  4RGU A;  4LG0 A;  3LA2 A;  1TQM A;  4B8X A;  4JQF A;  4YFN F;  1V3F A;  1FBS A;  1C0W A;  4L9N A;  2RDP A;  2W85 A;  2JZY A;  5CJ9 A;  4ETS A;  3MZY A;  2XV4 S;  3ZN1 A;  1TLH B;  5E17 F;  3SZP A;  3QP5 A;  1UB9 A;  2HTS A;  3N4M A;  4A5M A;  4GYG A;  3MCZ A;  5DCM B;  3VOE A;  3KP2 A;  3E5Q A;  1YS6 A;  2PJP A;  5HVQ C;  3BOQ A;  1FSH A;  2TDX A;  2FNP A;  4UV9 A;  3J81 K;  4M72 A;  4N9H A;  2DQR A;  5E1W A;  1IAW A;  2HYG D;  2IJL A;  1YW9 A;  1OR7 A;  4D0P A;  5E1X A;  3KFW X;  4M9X A;  2D45 A;  1MKM A;  1XSV A;  3ABU A;  2ZJ2 A;  3NRV A;  2P6S A;  3LFK A;  4P9F A;  1L0O C;  1FT9 A;  1JXS A;  4WWC A;  4YG2 F;  3BP8 A;  2Z9O A;  4HLX A;  5CVJ A;  4LK1 F;  1ZRF A;  1I6X A;  1R36 A;  4IHS A;  4G9Y A;  4CDG A;  2P7C B;  2XUB A;  4KN7 X;  2VXZ A;  1J5Y A;  2EFO A;  1YFH A;  3GUD A;  1TQP A;  2P5L C;  2L01 A;  3K1N A;  4ZYD A;  1G3T A;  2CSO A;  1IN5 A;  2H27 A;  2H6C A;  2OZ6 A;  2HTJ A;  1P6R A;  3QP6 A;  3WU0 A;  4EVI A;  2HS5 A;  3CDH A;  2CQK A;  3E97 A;  1MGT A;  2V9V A;  1U5T A;  2ZXJ A;  4HQE A;  3TGN A;  2B0L A;  2VC0 A;  3GZ6 A;  3TKY A;  4H0E A;  4KNY A;  1O3T A;  1I5Z A;  1STZ A;  1HW5 A;  4BHB A;  2CWE A;  1BI1 A;  5K1Y A;  1R00 A;  2G7H A;  3GYH X;  3CLO A;  1EH6 A;  2HQR A;  1KQ8 A;  3KP4 A;  2COM A;  1ZH5 A;  3F3X A;  3C18 A;  3GEZ A;  2PFB A;  5E20 A;  1CF7 A;  3FMS A;  3MFK A;  2E7W A;  2F5F A;  4UXN A;  4S04 A;  1R7J A;  1T2K A;  3DV8 A;  4GGG A;  2PLY A;  3I0T A;  1E17 A;  2RGV A;  3DPL C;  2MLK A;  3WTZ A;  5D4S A;  1SFE A;  2K27 A;  2DBB A;  2LF7 A;  2MA3 A;  2PMH A;  2XHK A;  3RDI A;  3FM5 A;  2Q2E A;  4CZZ A;  1OKR A;  5ICC A;  4HAM A;  3LQR A;  1XDU A;  1IN4 A;  5FB2 A;  1ZRC A;  3ELK A;  3QU6 A;  2EFN A;  1U2W A;  5HS9 A;  2VON A;  1YW8 A;  1MDM A;  3RKY A;  4I7H A;  3HRT A;  1W7P A;  1KU7 A;  3PQJ A;  4WF2 A;  4YIF A;  3I64 A;  2DK5 A;  4RAY A;  2Z3Y A;  1G3W A;  3V7C A;  3I54 A;  5LBQ A;  3GZ5 A;  2ZNY A;  2HFH A;  5JI6 A;  2HQN A;  5FO5 A;  2QQ9 A;  2FBH A;  2F5E A;  2NNN A;  1LNW A;  5ILV A;  4ENM A;  1LVA A;  2HWV A;  2V1X A;  2H94 A;  5IT9 K;  4AIH A;  4EJT A;  3TQN A;  2HEO A;  2PN6 A;  2GWR A;  3IKT A;  4PDK A;  3L00 A;  2EK5 A;  4Z2Y A;  3RPU A;  2ZFW A;  2VC1 A;  4EGZ A;  2OD5 A;  4LB5 A;  2NAZ A;  3QRF F;  4Q48 A;  2IW5 A;  2AS5 F;  4JK1 X;  2ZME A;  5HLI A;  3HRS A;  3VB2 A;  5L3F A;  2QYO A;  2LDU A;  4LK0 F;  1OYY A;  4WCG A;  3HTS B;  2ESH A;  4FX0 A;  1BIA A;  3C1D A;  3EDP A;  5ICE A;  5DUK A;  2FMY A;  2QBY A;  1MD0 A;  2DI3 A;  4I09 A;  1IN6 A;  3I71 A;  5DD8 A;  3JAM K;  3F21 A;  3R0A A;  1LJ9 A;  3TDU C;  2GAU A;  3V7R A;  1SAX A;  2L3D A;  3ERE D;  1ZN2 A;  4OOI A;  4U0V A;  3TO6 A;  2RV8 A;  3M1E A;  2FBI A;  2RNJ A;  1B4A A;  4I98 B;  4MQV A;  3WTS C;  5JR3 A;  3L2C A;  3ABT A;  3QPH A;  3V4G A;  2IA1 A;  2VBY A;  5LRS A;  3HTU A;  1R23 A;  3ECO A;  2OU2 A;  4P55 A;  2O03 A;  4UV8 A;  3ZMV A;  2DU9 A;  1S29 A;  4XLP F;  4ESJ A;  3ISP A;  5BS6 A;  1ZG1 A;  1ON2 A;  1D3Y A;  2LNB A;  4G7O F;  5TRD A;  5CLS A;  2QZ8 A;  1O57 A;  5LRR A;  1ON1 A;  4OMZ A;  4UUV A;  4EJO A;  3TOB A;  2OQR A;  4IXA A;  1CGP A;  2W84 A;  1B9N A;  4BH9 A;  2Z33 A;  2CGP A;  4LG0 B;  1E2X A;  5F64 A;  2QWW A;  4PZJ A;  1D5V A;  3JAM Z;  2P8T A;  4A0Y A;  2FNA A;  3RKX A;  1EH8 A;  2GIV A;  1U8R A;  1XSD A;  3EYY A;  3M8E A;  2A07 F;  2D2W A;  1BN5 A;  1QQI A;  4KIF A;  3WTX C;  5H6R A;  1Y0U A;  5CYV A;  2KIM A;  4EGY A;  4O3M A;  2HGC A;  1FY7 A;  3D0S A;  1F9N A;  4HDV A;  4HYE A;  1RNL A;  4Y17 A;  2DTR A;  2XIG A;  1BM9 A;  5L3B A;  5FFX A;  1ZRE A;  3P9I A;  4OIR F;  1P4X A;  1XCV A;  1J59 A;  3P9C A;  5LEK A;  3P9K A;  3FWE A;  4CYD A;  5D5W B;  2MBF A;  3KZY A;  5BQT A;  4KYW A;  4BAY A;  3DXJ F;  3VFZ A;  4OMY A;  2BYV E;  1DUX C;  1BI2 A;  1GXP A;  3CO7 C;  1BIB A;  4Y13 A;  2YU3 A;  3IKV A;  4RGR A;  1UHW A;  4G6D A;  3T1B A;  4R1H A;  3R6S A;  3GLX A;  5L3E A;  3CJN A;  2GZW A;  2Q0O A;  5ED4 A;  4KIB A;  1XMK A;  4A12 A;  2D1V A;  3KP6 A;  3GX4 X;  5D5X B;  5D5V B;  3EUH A;  1G3S A;  1LDJ A;  1LEB A;  3OOP A;  1ODD A;  2OBP A;  4EJW A;  4XRF A;  1KYZ A;  5KK1 A;  4MQ9 F;  1Z7U A;  1V4R A;  1ZHF A;  2VOO A;  1ZG3 A;  1U5T B;  3BPX A;  2JPC A;  1YO5 C;  4DNC A;  1PUE E;  3GWZ A;  4OIP F;  4YII A;  4AIK A;  2Z99 A;  1FSE A;  5J8F A;  3V8J A;  4G94 A;  1G4D A;  1P4A A;  2FEZ A;  3ZMU A;  3FHZ A;  1XN7 A;  3FMQ A;  3TO9 A;  3J80 K;  2V79 A;  4AVP A;  4IRH A;  4MGR A;  1CF7 B;  3WTW C;  1XGO A;  4ESF A;  4PGH A;  1Z9C A;  2A5Y B;  5EEH A;  4ASN A;  3PQK A;  3SXY A;  2FA5 A;  1YTY A;  1JHH A;  4KDP A;  3WTU C;  3F23 A;  4BQA A;  3JSP A;  5DEQ A;  1TTY A;  3RYR A;  5L3C A;  2FRH A;  2EV0 A;  2XAH A;  1QO0 D;  3G3Z A;  2VOP A;  2K4J A;  3BJA A;  4N9I A;  2XAG A;  4M73 A;  5CVR A;  2ZCW A;  1HKS A;  3JTH A;  1FP2 A;  2UWM A;  1B6A A;  1K6O A;  2CYY A;  4HOB A;  2HKX A;  3EYI A;  1FWZ A;  4Y15 A;  4EM0 B;  4EV0 A;  1MDM B;  3KEO A;  3M7G A;  4B09 A;  3CO6 C;  1W7P B;  3RIR A;  1LDD A;  1RUO A;  2R7D A;  3CUQ A;  2UXN A;  4HF0 A;  1BI0 A;  4ENK A;  2UZK A;  2STT A;  2GXG A;  2FXA A;  2XAF A;  3JTG A;  3MQ0 A;  3SQN A;  3I4P A;  2R7F A;  3AAF A;  2ISZ A;  3DP7 A;  2ETH A;  3GFL A;  3HUG A;  4HX8 A;  2O0Y A;  4KIG A;  1WWX A;  3IHU A;  1WQ2 A;  2JRT A;  4G7H F;  5DYM A;  2FQ3 A;  2DAO A;  3VEP A;  4WXH A;  3R60 A;  3ZMT A;  2HZT A;  1R22 A;  5D6F A;  1RIO H;  2DPU A;  4UHT A;  3BDD A;  1O3S A;  1KU2 A;  2G9W A;  1LB2 A;  2KRF A;  3ZN0 A;  3RI4 A;  5E8I A;  3D5L A;  3E5X A;  2ZME B;  2YPR A;  2VN2 A;  2A3S A;  4EM1 A;  1G3Y A;  3DF8 A;  3FXQ A;  2IRF G;  2FOK A;  5BPD A;  2RN7 A;  4UVA A;  2QEN A;  3J81 Z;  5FD5 A;  1QBJ A;  4L5J A;  2QQA A;  3I5U A;  1R1V A;  1Z6R A;  1FPQ A;  2QBY B;  2DLL A;  1WKM A;  4A6D A;  4I0A A;  2WWY A;  3CUQ C;  4TV7 A;  4ESB A;  2OAZ A;  5BOX A;  5LGU A;  4OIO F;  3C3W A;  2WC2 A;  5E1Z B;  3B73 A;  2EV6 A;  2AXL A;  1HSJ A;  5A2Q K;  2HDC A;  2VE9 A;  5EEG A;  1MJA A;  1QNT A;  2WV0 A;  5LEJ A;  1YIO A;  1FBU A;  5AON A;  4RB1 A;  2F5D A;  3I53 A;  3KP3 A;  4IF4 A;  1U3E M;  1LEA A;  2G7U A;  1IW7 F;  2WTE A;  2IP2 A;  2STW A;  1YG2 A;  1QZZ A;  2ZBK A;  5K5Q A;  2MH2 A;  4WXC A;  2MLG A;  3V8K A;  5DDG A;  2PMU A;  3RPQ A;  1SMY F;  2QQB A;  1G6N A;  1DPU A;  3FZV A;  4IHT A;  1QPM A;  4HX7 A;  1YYV A;  1S3J A;  4L9V A;  2PQ8 A;  2K86 A;  4A5N A;  4IRI A;  1UST A;  3DEU A;  2O61 A;  3SZT A;  3ML6 A;  3ZMZ A;  5ERI A;  2PBI A;  1WRJ A;  2FF4 A;  5D5U B;  2XAS A;  1IZ1 A;  2EA2 A;  1OPC A;  4ENJ A;  4R8H A;  4LLL A;  1BOA A;  5ILU A;  3HOS A;  3Q9S A;  2DK8 A;  1MZB A;  4MEY F;  3WGH A;  2DQL A;  1KU9 A;  5TJJ A;  1PP7 U;  3ZMS A;  3FF5 A;  3K9T A;  1O3Q A;  5E18 F;  5BPI A;  3OV8 A;  1BJA A;  1I1G A;  4BXU A;  3WU1 B;  2BE5 F;  3B02 A;  3L7W A;  4P9U A;  2GA1 A;  2F5C A;  4ZYH A;  2E1N A;  3U9G A;  2FSW A;  4QWQ A;  3KZZ A;  4EJU A;  4LLG F;  3Q9V A;  4LLN A;  3IRQ A;  3T8R A;  4NHJ A;  1XD7 A;  3E3V A;  4M6X A;  3GXO A;  5FD6 A;  2P6T A;  3REO A;  4HV5 A;  1S7O A;  1W5S A;  1TNT A;  3LA3 A;  1S7A A;  2KKO A;  2ZO4 A;  1R5G A;  1VTN C;  2IT0 A;  2M30 A;  2YX7 A;  2KIU A;  2V1D A;  2DO7 A;  1U78 A;  5IT9 Z;  4S05 A;  1D8J A;  3J7A O;  1P2F A;  3G73 A;  4F7Z A;  4ON0 A;  4YFX F;  1T39 A;  1HKT A;  2DW4 A;  4LJZ F;  3RYP A;  1XGM A;  5J6X A;  1XDS A;  2L4A A;  2NS0 A;  1A04 A;  3K1P A;  1W4M A;  3COA C;  3K1M A;  3QOP A;  1TW3 A;  3N97 A;  4HA8 A;  1SFX A;  4CXF A;  3ZMD A;  4GO1 A;  1XSX A;  4XBF A;  6PAX A;  2W57 A;  5HLG A;  2P5K A;  1S6L A;  3RTR A;  5H20 A;  2DFI A;  2EB7 A;  3KP5 A;  2A68 F;  4Q47 A;  3F6V A;  3QU3 A;  1QZY A;  3IRR A;  2PG4 A;  1EV7 A;  5DV5 A;  4Q4Z F;  1Z91 A;  4EM2 A;  3BWG A;  1HW2 A;  5K5R A;  1GHC A;  4OU0 A;  4L18 B;  3I58 A;  3HOT A;  5LGN A;  5HDN A;  2QLZ A;  3WGG A;  2JPB A;  1O7L A;  1FC3 A;  1T98 A;  1ULY A;  4I2O A;  2VT3 A;  1ZAR A;  5L3G A;  2NRA C;  2W24 A;  2GQQ A;  1OMI A;  4GXO A;  1W7P D;  3F8N A;  5H6Q A;  1IXC A;  2XKO A;  1U6G A;  4EQQ A;  4BNC A;  5AIQ A;  2JTV A;  4KUM A;  2C6Y A;  3NEU A;  3TOA A;  3WOD F;  1KA8 A;  4I01 A;  4KN4 X;  1R1T A;  2Y0M A;  1KGS A;  1BC8 C;  1L3L A;  3K0L A;  2M1B A;  1XB4 A;  3FMR A;  2J5O A;  2P5V A;  1DPR A;  4O6J A;  3I59 A;  4HV6 A;  2BBY A;  3LWF A;  3VOD A;  1PP8 F;  1R5H A;  2VE8 A;  1J0R A;  3O6B B;  4HQM A;  4LB6 B;  2XRN A;  1FLI A;  1H9G A;  4M9S A;  1OYW A;  3RJP A;  4GYI A;  3FM3 A;  4IRG A;  3CTA A;  3LAJ A;  3KET A;  1T38 A;  3T0Y A;  1YS7 A;  1XGN A;  5ICG A;  2QUF A;  5CVU A;  4RGS A;  1RZ4 A;  2A6H F;  1B9M A;  2PEX A;  1H9T A;  3GFJ A;  1USS A;  4HF2 A;  4U7B A;  4ZZD A;  4U0W A;  2Y75 A;  3IL2 A;  1WI9 A;  2MD5 A;  3KCC A;  1Q1H A;  5LHI A;  2JT1 A;  3KLO A;  3MAJ A;  1FNN A;  1UCR A;  1ZGA A;  4XLN F;  5HDK A;  1ZLJ A;  4XSX F;  2DT5 A;  4ZYE A;  3GFM A;  3IWZ A;  3HSR A;  4M6Y A;  3R4K A;  4WXD A;  3C7J A;  3PFI A;  4AWX B;  1ZLK A;  3HSF A;  4MEX F;  1K79 A;  4Q5S F;  5K5O A;  5LHH A;  3IWF A;  2XAJ A;  2FML A;  3HHH A;  2Y48 A;  1B1B A;  2ZKZ A;  1WSU A;  1IUY A;  2Z5U A;  2RKH A;  1ZYR F;  1AWC A;  5JVT A;  3LQQ A;  4RB0 A;  1J2X A;  2A6E F;  2NNY A;  1ZAO A;  2XKP A;  2GA2 A;  3HRM A;  1BC7 C;  3RKW A;  3O3K A;  3J80 Z;  1FX7 A;  2YX4 A;  4R79 A;  5J8C A;  2YSR A;  3F8M A;  3H3U A;  2EFQ A;  1OYI A;  3MWM A;  4AIJ A;  3MEX A;  2O8X A;  4YFK F;  3KEQ A;  4O5V A;  2A61 A;  4G8X A;  4UVC A;  2CW0 F;  3QAH A;  3U1D A;  4LD5 A;  3L9F A;  3WG9 A;  3GFI A;  3ECH A;  3M8F A;  2BEO A;  1IRG A;  5CVV A;  3F8F A;  2L02 A;  4OIN F;  1KQ9 A;  2UXX A;  4ZZL A;  3TO7 A;  4PCQ A;  2M87 A;  2BGC A;  4M71 A;  4U0Y A;  2MC3 A;  4HW0 A;  4NB5 A;  2ISY A;  2V6C A;  5HS7 A;  4EMS A;  3ZPL A;  5FFZ A;  1IRF A;  4WK8 F;  1FYL A;  1SFU A;  5L3D A;  5F1R A;  4CIC A;  2XVC A;  4MNU A;  5BMZ A;  2KJC A;  1MJB A;  1DDN A;  2OZU A;  2CO5 A;  4GCV A;  2HYF A;  4ZH4 F;  3H3Z A;  2KJB A;  4L9T A;  3P7N A;  4L0Z B;  1R1U A;  4KT5 C;  1DP7 P;  1SD6 A;  3DPT A;  1KU3 A;  3WGI A;  1LQ1 A;  1ONV A;  4UVB A;  3S2W A;  1D8K A;  4LFU A;  4K2E A;  4E70 A;  1K78 A;  3GO5 A;  4RB2 C;  3W6K B;  3M9A A;  1HST A;  2P4W A;  5HLH A;  4RB3 C;  2D1H A;  4IJA A;  2PI0 A;  4A0X A;  2IA0 A;  2LSO A;  2FE3 A;  2LF8 A;  3TDZ C;  2P7V B;  2FBK A;  3DQV C;  4L9J A;  2M5W A;  5DUI A;  3F8B A;  2ZNZ A;  1NHA A;  5DCM A;  4N0B A;  2HR3 A;  4FX4 A;  4MTE A;  3FXU A;  1HBX G;  1I27 A;  3V8L A;  4I02 A;  4HBL A;  1EH7 A;  1U5T C;  4CO8 A;  2VBX A;  1J75 A;  2IVM A;  3SFZ A;  4KA4 A;  5ICF A;  1IN8 A;  4MTD A;  4IPA A;  4U88 A;  4KMU X;  3WTY C;  2VBW A;  4PGG A;  4CGZ A;  1IXS B;  5A2Q Z;  5JHU A;  2Q8K A;  3JSO A;  2GXB A;  4BHC A;  1X3U A;  2K02 A;  3E6B A;  1F1Z A;  5DCF A;  1RUN A;  3LST A;  4NQW A;  3MZH A;  1RI7 A;  1HXD A;  1ZG5 A;  2E7X A;  1J7K A;  3Q5F A;  1P4W A;  1GVJ A;  2L54 A;  3E6C C;  4BHP A;  2CG4 A;  4P96 A;  1F4K A;  2RC4 A;  2M45 A;  2O3F A;  3K69 A;  3LAP A;  4XSZ F;  5HOO A;  4P5O A;  5D8L B;  2OQG A;  3NQO A;  2XAQ A;  3CUO A;  1PDN C;  4DQ2 A;  4LGW A;  4ZYG A;  1IXR C;  5AIP A;  3QPT A;  2W25 A;  1R58 A;  3WE3 A;  1XMA A;  2VOD A;  1GXQ A;  3E6M A;  1O7F A;  2H6B A;  1BI3 A;  4HZF A;  4RAZ A;  3EET A;  3SHF A;  3I59 B;  3KE2 A;  3HHG A;  3F72 A;  5D6E A;  4JBA A;  2LKP A;  5KVR A;  4G6Q A;  1REP C;  4RS8 A;  3DKW A;  2VT2 A;  2IA2 A;  2CFX A;  4HLY A;  1TW2 A;  4HX4 A;  1IF1 A;  2V1U A;  1ZGJ A;  1UFM A;  3WE2 A;  3FX3 A;  2EJR A;  1UHM A;  1TBX A;  4KFC A;  1T0F A;  1FYM A;  3EQL F;  5FGM A;  2EV5 A;  1FYK A;  2ACJ A;  4RGX A;  1XCB A;  3HRU A;  1MJ9 A;  4G7Z F;  5HDG A;  1H0M A;  2E1C A;  1JE8 A;  4FT8 A;  2YR2 A;  3V7S A;  1XGS A;  4M9Z A;  5ILS A;  2RVC A;  4ENN A;  3T8T A;  2QM3 A;  4A2U A;  2F2E A;  2XGX A;  5JFR A;  3U2R A;  1IN7 A;  2DPD A;  4I0B A;  4EJV A;  2O6G E;  1KQ0 A;  1S8N A;  3BJO A;  1Z1D A;  3F8C A;  4WX9 A;  3K2Z A;  1Z05 A;  2VBZ A;  1B59 A;  1SMT A;  1HKQ A;  5LGT A;  5F6F A;  4UNO A;  2X0L A;  4AD9 A;  1FOK A;  4IVN A;  1J9I A;  1K7A A;  3E6D A;  2ADU A;  3T5X A;  4A6E A;  4M74 A;  4L0Y B;  1P92 A;  1HQC A;  3BY6 A;  3O2P E;  2R3S A;  3F6O A;  3GF2 A;  4U7D A;  2EA4 A;  2IPQ X;  1SD7 A;  4HDU A;  1JGS A;  1SD4 A;  3BJ6 A;  1QGP A;  5FLX K;  1TQI A;  4KMF A;  2A69 F;  2BV6 A;  2NYX A;  3ZQ7 A;  4A0Z A;  3CUQ B;  3R61 A;  1FBQ A;  1BBY A;  3BRO A;  3DFG A;  4FHT A;  3F22 A;  4KIC A;  2X4H A;  3ULQ B;  5D4R A;  1JHF A;  5D8K B;  1I1S A;  1TNS A;  3FXR A;  1O3R A;  4MHG A;  1Z6T A;  2MH9 A;  3R0J A;  4BYY A;  3BPV A;  2OA4 A;  3E5U A;  3HSE A;  5CVI A;  2EFW A;  3H92 A;  1YQA A;  2EFP A;  4L5I A;  5LHG A;  2FU4 A;  3BZ6 A;  2K4B A;  4OIQ F;  1SD5 A;  3W6J B;  2ESN A;  1YLF A;  3LA7 A;  1T6S A;  3ROU A; 
#chains in the Genus database with same CATH topology
 2ELH A;  2PMZ N;  2Q1Z B;  2M8E A;  3K70 D;  3DTI A;  4QLC U;  1D0Z A;  1YW7 A;  4N4N B;  5J40 A;  2JSC A;  3HYI A;  3JW4 A;  5B66 C;  4KJZ A;  1DU6 A;  3MZ8 A;  3GW2 A;  1V5G A;  5TGT A;  3WTT C;  3L09 A;  2TRT A;  3VYS B;  4XRS A;  3M1C A;  5DD4 A;  2HOE A;  3ZP5 A;  2IGO A;  1F5T A;  2KZV A;  3CQZ J;  2XDV A;  1AOY A;  1FZP B;  1X4O A;  5FLX Z;  3HJE A;  2KIF A;  3GVA A;  2L9N A;  2L4M A;  3IC7 A;  1KYW A;  3VPR A;  4GFB A;  3FK6 A;  4NDL A;  4ZJZ A;  4LMY A;  4XQF A;  2DMU A;  2R5Y B;  1ZRD A;  1BR1 A;  2H09 A;  4CHU A;  2E71 A;  2J5P A;  1FP1 D;  3HXL A;  3HKZ A;  2PJR A;  3K4B A;  3OR1 C;  1W5T A;  3KP7 A;  2RQP A;  2XAU A;  4B47 A;  1EJ9 A;  2CV1 A;  2QVO A;  4PUS A;  3KLN A;  2EWN A;  5LLQ A;  5HS8 A;  1BW5 A;  2Y9Z A;  5CQG A;  2K7L A;  3HIF A;  2WA0 A;  4J00 A;  1LE8 A;  3K4L A;  3TED A;  1LDK B;  2X6W A;  3S2D J;  2LY1 A;  1HW1 A;  2HKO A;  3L2U A;  4HF1 A;  1F43 A;  1F36 A;  5IT3 A;  3WU2 C;  1AHD P;  2COB A;  1K78 B;  3WTV C;  2JJ7 A;  2XRO A;  3E7L A;  5E8G A;  4CA0 A;  1D5Y A;  1XPX A;  4RGU A;  4LG0 A;  2LRE A;  3PO3 J;  3OR2 C;  3LA2 A;  4Y52 J;  3DKY A;  1TQM A;  3HPH A;  4B8X A;  1U0J A;  2ME6 A;  4JQF A;  4A3G J;  4YFN F;  1V3F A;  1FBS A;  5J1Y A;  2YU9 J;  1UAA A;  3QOE A;  3SDG A;  1C0W A;  1TWC J;  4L9N A;  2RDP A;  2NXN B;  2W85 A;  2MW8 A;  1TWF J;  2JZY A;  3IH4 A;  1DQU A;  5CJ9 A;  5GAG J;  4ETS A;  3MZY A;  2XV4 S;  3ZN1 A;  1TLH B;  2KT0 A;  5E17 F;  3SZP A;  2OTL I;  3QP5 A;  4NC6 A;  4PSW A;  2Y30 A;  2JSP A;  1UB9 A;  2HTS A;  5EYR A;  1K4T A;  1W0T A;  3L2W A;  2EBI A;  3H3V K;  4M3D A;  3N4M A;  4A5M A;  4GYG A;  3MCZ A;  5DCM B;  3VOE A;  3KP2 A;  3E5Q A;  1YS6 A;  4BU2 A;  1E3H A;  2LY9 A;  5M3F J;  1FOW A;  2DTZ A;  5HVQ C;  1YHQ I;  2PJP A;  2W4S A;  3RQ4 A;  3BOQ A;  3OSF A;  3F0C A;  1FSH A;  2TDX A;  2GLO A;  2VQL A;  2ZC2 A;  2VB6 A;  2FNP A;  4UV9 A;  3J81 K;  4M72 A;  1Z3Y A;  4N9H A;  2DQR A;  2CH0 A;  2VJ5 A;  3TW7 A;  5E1W A;  2HXO A;  2JMW A;  3AG2 H;  1IAW A;  2HYG D;  1MMG A;  3CC7 I;  2IJL A;  2HVS A;  1YW9 A;  1OR7 A;  4I99 C;  1Z21 A;  4UB6 C;  2HZD A;  5E1X A;  3KFW X;  4D0P A;  1ZR4 A;  2AO9 A;  2E1M B;  2FX0 A;  3AFH A;  1MKM A;  4M9X A;  2D45 A;  3CCR I;  5CQE A;  3IAS 2;  1XSV A;  3ABU A;  2DJI A;  1BL0 A;  4BKX A;  2ZJ2 A;  3NRV A;  2P6S A;  2ICW G;  2FOW A;  3LFK A;  4P9F A;  4XLH A;  5M5W J;  2X9D A;  2X6O A;  1L0O C;  4UB8 C;  4B1R A;  1FT9 A;  1JXS A;  2ZXH A;  4WWC A;  4PJ0 C;  4BJ6 C;  4YG2 F;  3BP8 A;  2Z9O A;  4HLX A;  5CVJ A;  4IZZ A;  2LKX A;  4LK1 F;  1ZRF A;  1I6X A;  1Z77 A;  4NQW B;  1R36 A;  4IHS A;  2O5R A;  4G9Y A;  4XLC A;  1R4M B;  3QWL A;  4CDG A;  3I4N J;  2P7C B;  2XUB A;  3BTJ A;  4KN7 X;  2K9M A;  2VXZ A;  3OY9 A;  1VQP I;  1R49 A;  2XF5 A;  3SEZ A;  1J5Y A;  2EFO A;  3I4M J;  1YFH A;  2XF7 A;  3GUD A;  1TQP A;  2P5L C;  2L01 A;  3K1N A;  4ZYD A;  1XX5 A;  1G3T A;  4LIV A;  3PSF A;  2CSO A;  2K5C A;  1IN5 A;  2H27 A;  2H6C A;  1HC8 A;  2OZ6 A;  3ZQH A;  2HTJ A;  2DA7 A;  1P6R A;  4BJT A;  3QP6 A;  3WU0 A;  1VND A;  4D5C A;  4EVI A;  3V42 A;  2HS5 A;  2KMU A;  3CDH A;  2DA3 A;  1Y0N A;  4E7J A;  1V5E A;  2CQK A;  4B43 A;  2LBF A;  3E97 A;  3L2V A;  1OCT C;  1MGT A;  5FRN A;  1YIT I;  2V9V A;  4E7S A;  4ZDP A;  1U5T A;  2ZXJ A;  3OWT A;  4HQE A;  3TGN A;  1MBF A;  2B0L A;  2VC0 A;  3GZ6 A;  3TKY A;  4G6T B;  4H0E A;  1WZ2 A;  1PJR A;  3ZRG A;  4KNY A;  2VPR A;  1I5Z A;  1O3T A;  1STZ A;  2OJE D;  3C2H A;  3TMO A;  1HW5 A;  4B44 A;  4BHB A;  3BG7 A;  3GTJ J;  2CWE A;  4EAT A;  1BI1 A;  5K1Y A;  3W3C A;  3CMY A;  1R00 A;  2G7H A;  4XLA A;  3CLO A;  3GYH X;  1EH6 A;  1A36 A;  2DA1 A;  3GTM J;  2DOA A;  2HQR A;  1EA3 A;  1KQ8 A;  1MMA A;  2COM A;  3KP4 A;  1ZH5 A;  3F3X A;  4XNF A;  3ZR8 X;  3C18 A;  3GEZ A;  2PFB A;  4A69 C;  2M7A A;  5E20 A;  1CF7 A;  2BZT A;  3FMS A;  1SAU A;  5M3M J;  5C3E J;  3MFK A;  1T08 B;  2E7W A;  2F5F A;  4UXN A;  4XMY A;  4S04 A;  3W2A A;  5F27 A;  1R7J A;  1ETY A;  2VAS A;  3CMM A;  1T2K A;  3DV8 A;  5FKL A;  2XPU A;  4GGG A;  2OPT A;  3A0B C;  2PLY A;  1WH7 A;  3I0T A;  3RSN A;  4XKW A;  1WJ5 A;  2L7K A;  3OYF A;  1E17 A;  2RGV A;  2K9N A;  2MLK A;  3DPL C;  2BW3 B;  4DW6 A;  5F1J A;  1VQ7 I;  3WTZ A;  4UUT A;  5D4S A;  5IYD J;  1DGR M;  1SFE A;  2BVL A;  4ZTJ A;  2K27 A;  2DBB A;  4HNT A;  3QYF A;  3LSR A;  5EGO B;  4JX5 A;  2LF7 A;  2MA3 A;  2PMH A;  2XHK A;  3DBL B;  3OYJ A;  1ZR2 A;  2OV7 A;  4XN3 A;  3RDI A;  4D7M A;  1QHH D;  4BE0 A;  3GCM A;  3FM5 A;  2Q2E A;  4CZZ A;  3BTI A;  4RAF A;  2CFO A;  2HQ5 A;  1OKR A;  1S7E A;  5ICC A;  3OYA A;  5KAF C;  4HAM A;  3LQR A;  3BG5 A;  1XDU A;  1IN4 A;  3LSM A;  4M3B A;  5FB2 A;  1NG7 A;  2LKS A;  1ZRC A;  3ELK A;  3QU6 A;  2EFN A;  1U2W A;  2P0W A;  4XKV A;  5HS9 A;  4A3I J;  1PUF B;  2OCE A;  3S1M J;  2VON A;  1YW8 A;  3N05 A;  1MDM A;  3RKY A;  2L7M P;  2Y69 H;  2BY0 A;  4I7H A;  3HRT A;  1W7P A;  1OCP A;  3CCV I;  1KU7 A;  1YRN A;  4OWR B;  3PQJ A;  5GPC A;  4WF2 A;  3FDY A;  4YIF A;  3I64 A;  2DK5 A;  4RAY A;  2Z3Y A;  2XB5 A;  1G3W A;  3V7C A;  3I54 A;  5LBQ A;  3M4O J;  2QKL B;  4ZTF A;  3GZ5 A;  2ZNY A;  2HFH A;  5JI6 A;  2HQN A;  4HNV A;  5FO5 A;  2QQ9 A;  2FBH A;  3OYL A;  1X2M A;  4LIU A;  2LOO A;  2O7O A;  2F5E A;  2O9L A;  3CF5 F;  2NNN A;  1LNW A;  3BQY A;  5H2F C;  2NS8 A;  1N78 A;  3UR3 C;  2EZH A;  4X1E A;  5FJ8 J;  3PUB A;  1UMQ A;  1JGG A;  5ILV A;  2HXI A;  4ENM A;  2GOX B;  2IS6 A;  4A3B J;  4DOZ A;  3ESW B;  1LVA A;  2HWV A;  2V1X A;  2H94 A;  5IT9 K;  4AIH A;  2HYJ A;  1WFX A;  1VQL I;  4EJT A;  3TQN A;  3CCY A;  2DYS H;  4RDU A;  2X85 A;  2HEO A;  2CUE A;  4XLE A;  1Y56 A;  2PN6 A;  2V26 A;  2GWR A;  4W97 A;  1A31 A;  3IKT A;  4PDK A;  4AYB A;  3AG3 H;  2PMZ A;  3L00 A;  2EK5 A;  1MBE A;  1LKX A;  1WVR A;  3A0H C;  2EZI A;  4Z2Y A;  2ZFW A;  3RPU A;  3S3O A;  5FRM A;  2E36 A;  2VC1 A;  4DBR A;  3CD6 I;  1MND A;  4EGZ A;  2OD5 A;  4LB5 A;  2LMD A;  2HPM A;  2NAZ A;  3QRF F;  1X1B A;  4Q48 A;  2IW5 A;  2AS5 F;  2XC7 A;  3BT9 A;  4JK1 X;  2ZME A;  5HLI A;  2X6Y A;  3HRS A;  3VYR B;  2K3F A;  4HNU A;  3VB2 A;  5L3F A;  2BXY A;  3BG6 A;  3OS2 A;  2QYO A;  5FKM A;  2IBD A;  2LDU A;  1OYY A;  4LK0 F;  3NAU A;  1HF0 A;  4WCG A;  1VQK I;  2ESH A;  3FHN A;  3HTS B;  1NTC A;  4FX0 A;  1BIA A;  2FJ1 A;  4BBS J;  3C1D A;  2OF7 A;  3EDP A;  5ICE A;  2DA2 A;  3BR1 A;  1MSF C;  5DUK A;  2FMY A;  2WAQ A;  2E2J J;  1OLT A;  2QBY A;  1MD0 A;  4BEH A;  2DI3 A;  1HA8 A;  1JUP A;  4I09 A;  4BXF A;  1IN6 A;  5IP7 J;  3I71 A;  5DD8 A;  3JAM K;  3WHB A;  1ORK A;  1IRX A;  3H5A A;  5F0F A;  2QA4 I;  3F21 A;  1WJD A;  3R0A A;  1LJ9 A;  2HPI A;  3GBG A;  3Q0U A;  4BUP A;  3TDU C;  2GAU A;  3V7R A;  1SAX A;  2L3D A;  1R71 A;  3ERE D;  1ZN2 A;  4OOI A;  3QPS A;  4U0V A;  1Y6I A;  3CP2 A;  3GTO J;  3TO6 A;  1VZ0 A;  3BR2 A;  2RV8 A;  4HEA 2;  3M1E A;  3HB9 A;  1FTT A;  2FBI A;  3OYC A;  3PO2 J;  2RNJ A;  5E3L A;  4KIT B;  4CCL A;  1B4A A;  4I98 B;  3ASO H;  4MQV A;  5E3O A;  3WTS C;  3J7A Y;  4OAZ A;  5JR3 A;  3UNG C;  2L9S A;  3L2C A;  4J01 A;  4Y33 A;  3ABT A;  3QPH A;  3H5N A;  3V4G A;  2IA1 A;  2VBY A;  5LRS A;  5HOD A;  4W1U A;  1VQO I;  2CS3 A;  3HTU A;  1R23 A;  3ECO A;  3MKY B;  2ZSH B;  2JRM A;  3OL3 A;  4CCO A;  2OU2 A;  3M8J A;  2JA6 J;  4P55 A;  4QSH A;  2O03 A;  4UV8 A;  3ZMV A;  2DU9 A;  1S29 A;  4XLP F;  4ESJ A;  3OOU A;  4BDY A;  2JUC A;  2GOM A;  1FTZ A;  3ISP A;  1JT0 A;  5BS6 A;  1ZG1 A;  2CQN A;  1IV8 A;  1TWG J;  2PJR B;  1ON2 A;  1D3Y A;  1T56 A;  2ZME C;  5F0C A;  2CW7 A;  2DOF A;  2LNB A;  3AG4 H;  3DU6 A;  5TRD A;  4G7O F;  3AKZ A;  2DMN A;  5CLS A;  5K7F A;  2QZ8 A;  1W1W E;  3TW6 A;  1O57 A;  3HGY A;  5LRR A;  3TL4 X;  1LE8 B;  1ON1 A;  4OMZ A;  5DS9 A;  4UUV A;  4EJO A;  3SJM A;  2CJJ A;  3BTC A;  3TOB A;  1MBG A;  2OQR A;  4IXA A;  1CGP A;  4PFP A;  2GIZ A;  1X1C A;  4XR6 A;  2W84 A;  1YOV B;  1DP3 A;  1B9N A;  3EUK L;  4BH9 A;  2Z33 A;  2DJN A;  3DWL E;  2CGP A;  4LG0 B;  4ZDL A;  3D5R C;  1E2X A;  5F64 A;  2QWW A;  4PZJ A;  1D5V A;  3JAM Z;  3IUO A;  2RRE A;  2P8T A;  2NVU B;  4A0Y A;  3AL0 B;  2FNA A;  3NAR A;  3RKX A;  1EH8 A;  1ZKG A;  1W36 D;  1BW6 A;  2M7B A;  4S0H B;  2GIV A;  2VKV A;  2N8G A;  1U8R A;  4D5F A;  5GPA A;  2XGC A;  2R0Q C;  1HCR A;  1XSD A;  3EYY A;  3M8E A;  4NBQ A;  2A07 F;  2D2W A;  3BCA A;  1BN5 A;  1QQI A;  4KIF A;  2ID3 A;  3WTX C;  5H6R A;  1Y0U A;  5CYV A;  2KIM A;  4EGY A;  4O3M A;  4N4O B;  2VXD A;  2HGC A;  1FY7 A;  4X6A J;  1LUJ B;  3D0S A;  1F9N A;  3S93 A;  3LSI A;  3LSH A;  2LVS A;  1X2N A;  2IS1 A;  1ZQ3 P;  4HDV A;  4HYE A;  5M5Y J;  2KL4 A;  3H35 A;  1RNL A;  2DCE A;  4Y17 A;  3FKI J;  2DTR A;  1YI2 I;  2XIG A;  1BM9 A;  5L3B A;  3DLA A;  5FFX A;  4NC7 A;  1ZRE A;  1D0Y A;  3P9I A;  4OIR F;  1P4X A;  1XCV A;  1J59 A;  1V54 H;  4FET A;  3P9C A;  1I6H J;  5LEK A;  2KIS A;  3CCQ I;  3P9K A;  2KZG A;  3FWE A;  4CYD A;  5TIS C;  3GTL J;  5D5W B;  1YIJ I;  2MBF A;  3KZY A;  5BQT A;  4KYW A;  2QSH X;  2L9V A;  4XLF A;  3A01 A;  4BAY A;  3DXJ F;  2WB1 A;  3LSK A;  3VFZ A;  4OMY A;  2BYV E;  2VJJ A;  1DUX C;  4F92 B;  1WJA A;  2MYS A;  3S14 J;  1BI2 A;  1GXP A;  1ETQ A;  3OYD A;  1T33 A;  2R92 J;  1MBK A;  2M0M A;  1OFC X;  3CO7 C;  1BIB A;  1DU0 A;  4Y13 A;  2YU3 A;  3IKV A;  4RGR A;  4UUS A;  1NK3 P;  1UHW A;  4XM3 A;  2V9P A;  4G6D A;  1VFC A;  3T1B A;  5J4Y A;  3S3M A;  4R1H A;  3R6S A;  2E2H J;  2BHY A;  3GLX A;  5L3E A;  3CJN A;  2GZW A;  2Q0O A;  5ED4 A;  4KIB A;  1N75 A;  1XMK A;  3E1S A;  3JRG A;  2D5V A;  4A12 A;  1M1E B;  2D1V A;  2PX9 A;  3KP6 A;  4XOR A;  4JX6 A;  5B1B H;  3GX4 X;  5D5X B;  5D5V B;  3MMY B;  3EUH A;  1G3S A;  1LDJ A;  1LEB A;  3OOP A;  2ME0 A;  1ODD A;  4RA2 A;  3RPU D;  2OBP A;  4EJW A;  1IDY A;  4CCK A;  5B3S H;  1GLN A;  4XRF A;  2F4O B;  2QEX I;  1MNM C;  2GXA A;  1KYZ A;  1WI3 A;  5KK1 A;  1WPK A;  4MQ9 F;  5EZH A;  1Z7U A;  4E4H A;  2MFZ A;  3ASN H;  1V4R A;  1ZHF A;  2VOO A;  3DCF A;  2LBF B;  3DBR B;  2VKH A;  2MD0 A;  2EIN H;  1X3W B;  1ZG3 A;  1U5T B;  3BPX A;  2JPC A;  1JTX A;  3KEY A;  1YO5 C;  1Y1W J;  2ECC A;  1BJZ A;  4DNC A;  3OYB A;  1PUE E;  2F4I A;  3B6A A;  1MBJ A;  3GWZ A;  2DXI A;  4OIP F;  4YII A;  4AIK A;  2Z99 A;  3G1O A;  1FSE A;  4UY8 I;  1AKH A;  5J8F A;  2DOE A;  3CDI A;  3V8J A;  4A3M J;  4G94 A;  2WBM A;  3L2R A;  5JLX A;  1G4D A;  1P4A A;  2FEZ A;  4V19 K;  3ZMU A;  3FHZ A;  1XN7 A;  3FMQ A;  3TO9 A;  3J80 K;  1A6Q A;  2V79 A;  2ELK A;  4AVP A;  3FBI B;  1Z7L A;  4IRH A;  4MGR A;  2X48 A;  3W2W A;  2KLO A;  3BC8 A;  1CF7 B;  2OC6 A;  3WTW C;  2IAI A;  3GME A;  2JA2 A;  3EUA A;  1MH4 A;  3DKX A;  1XGO A;  4QPO A;  4ESF A;  4PGH A;  2B9S A;  1Z9C A;  2A5Y B;  5EEH A;  3DBH B;  4ASN A;  3PQK A;  1XC5 A;  3SXY A;  2FA5 A;  3KIO A;  1YTY A;  1G8X A;  1JHH A;  4AUX A;  4KDP A;  3OS1 A;  3WTU C;  3F23 A;  4BQA A;  3JSP A;  5DEQ A;  5B5E C;  1TTY A;  2H1L A;  3RYR A;  1MMS A;  5L3C A;  2LC2 A;  3HOX J;  4RM2 A;  2FRH A;  5J1U A;  2EV0 A;  2XAH A;  1RC9 A;  1ETK A;  1QO0 D;  1RET A;  3H5R A;  4BJ5 C;  3G3Z A;  2VOP A;  3H1C A;  2H8R A;  3EUH C;  2K4J A;  3BJA A;  4N9I A;  2Q2E B;  2XAG A;  3IP4 B;  4M73 A;  5CVR A;  2ZCW A;  1HKS A;  3JTH A;  1FP2 A;  2UWM A;  4OAY A;  1B6A A;  4BAC A;  3CC2 I;  1K6O A;  3NWS A;  2CYY A;  1RKW A;  4MLO A;  4HOB A;  1RES A;  1UZC A;  2HKX A;  3TP0 A;  3EYI A;  5GP9 A;  1FWZ A;  3I9V 2;  4Y15 A;  3LOC A;  4EM0 B;  4EV0 A;  5GAD J;  1O4X A;  1MDM B;  3KEO A;  3M7G A;  4B09 A;  4M3F A;  3CDL A;  3TBI A;  3CO6 C;  3CCM I;  1W7P B;  2DDA A;  3K2A A;  1LDD A;  1UG2 A;  3RIR A;  1YRN B;  4AC0 A;  1RUO A;  2LH9 A;  3DU5 A;  2R7D A;  3CUQ A;  1V55 H;  2UXN A;  4HF0 A;  1BI0 A;  4ENK A;  3ZOB A;  2UZK A;  2LYC A;  2STT A;  3CC4 I;  3QOD A;  2GXG A;  4E7L A;  2FXA A;  4GDF A;  2L2O A;  2XAF A;  4JYK A;  3JTG A;  1FOX A;  4PFO A;  3MQ0 A;  3K4M A;  3I4P A;  3SQN A;  2X1E A;  2OTJ I;  2DFF A;  3OIO A;  1QPI A;  2R7F A;  3AAF A;  2ISZ A;  1YE9 A;  3RCO A;  2MSY A;  3ZCO A;  4V2F A;  3DP7 A;  2ETH A;  3GFL A;  1FOY A;  3HUG A;  4X0G A;  2DA5 A;  3I55 I;  1JUS A;  2DMQ A;  4HX8 A;  3D5S C;  4RLF A;  2W00 A;  3CJQ B;  1ERD A;  2ZJR F;  2O0Y A;  1VF9 A;  4KIG A;  1WWX A;  2CQ7 A;  1OJL A;  4PJM A;  5KAI C;  3Q0W A;  3IHU A;  2K3P A;  1APL C;  1JI8 A;  1WQ2 A;  3L2Q A;  1X4P A;  2JRT A;  4G7H F;  2Z16 A;  5DYM A;  2FQ3 A;  2DAO A;  2IGM A;  4A3D J;  3VEP A;  1WJE A;  4HSR A;  4WXH A;  3J7Y J;  3R60 A;  2I5U A;  3ZMT A;  2HZT A;  1R22 A;  3DTE A;  5D6F A;  1RIO H;  2CUF A;  2DPU A;  4UHT A;  3HL2 A;  3BDD A;  1O3S A;  1KU2 A;  2G9W A;  3EPZ A;  2MAB A;  1LB2 A;  2KRF A;  3ZN0 A;  3RI4 A;  3FXJ A;  3D5L A;  5E8I A;  5C4X J;  3ABK H;  2ZME B;  3E5X A;  3OSG A;  3GTQ J;  2YPR A;  3LSJ A;  2VN2 A;  2E19 A;  1PYV A;  2A3S A;  4EM1 A;  3K7A J;  1JKP C;  1G3Y A;  2L7Z A;  1I50 J;  1U9O A;  3DF8 A;  2M2E A;  2LLK A;  3FXQ A;  2X1C A;  2IRF G;  2FOK A;  2VLA A;  5BPD A;  3H9G A;  2RN7 A;  3G2B A;  1QVT A;  1ZEL A;  2QEN A;  1GVD A;  4PJJ A;  4UVA A;  5FD5 A;  3J81 Z;  2ZJP F;  2VKE A;  2KP6 A;  1QBJ A;  2W82 A;  2Y31 A;  1Y8Q B;  4L5J A;  2QQA A;  3G6E I;  3I5U A;  1R1V A;  3VWB A;  1Z6R A;  3DEE A;  4HRI A;  1FPQ A;  2QBY B;  4IL6 C;  4BEH B;  2DLL A;  2V6E A;  2XSD C;  2YS9 A;  1WKM A;  4A6D A;  4I0A A;  2WWY A;  3RZD J;  3CUQ C;  4TV7 A;  4ESB A;  5E3M A;  3HZJ A;  2CV2 A;  2R7Z J;  1XG1 A;  2OAZ A;  1IV6 A;  5BOX A;  2JK3 A;  1GT0 C;  4PJN A;  5LGU A;  4CYC A;  4OIO F;  3C3W A;  2KIQ A;  1TT5 B;  2WC2 A;  4DBQ A;  4HG2 A;  3BTL A;  2K85 A;  5E1Z B;  1B72 A;  3B73 A;  4PK4 A;  2EV6 A;  2AXL A;  1HSJ A;  2Z1D A;  3A02 A;  5A2Q K;  5KHD A;  1WJF A;  2TCT A;  4XL9 A;  1Y1V J;  5KNL A;  3BLY A;  2HDC A;  4RAG A;  2VE9 A;  5EEG A;  4EEF G;  1MJA A;  1QNT A;  2WV0 A;  3FIS A;  5LEJ A;  1ETX A;  1FBU A;  1YIO A;  5AON A;  2KDZ A;  4RB1 A;  1LFB A;  2F5D A;  3I53 A;  3KP3 A;  3ZQI A;  4I76 A;  5DM7 F;  4IF4 A;  1IGN A;  1TWH J;  2EIJ H;  1VI0 A;  1U3E M;  1VQ4 I;  2Y0S A;  4BQN A;  1LEA A;  2G7U A;  1IW7 F;  4A3C J;  1AA7 A;  2WTE A;  1T95 A;  2KHM A;  2IP2 A;  3ZQF A;  4PJL A;  2K9S A;  1YG2 A;  2STW A;  1QZZ A;  2ZBK A;  3JRE A;  5K5Q A;  2MH2 A;  4WXC A;  2MLG A;  4FE4 A;  3V8K A;  5DDG A;  2PMU A;  1OCZ H;  3RPQ A;  2XPW A;  1SMY F;  2QQB A;  1G6N A;  1DPU A;  3CME I;  2RAE A;  3PIP F;  3FZV A;  3CJR B;  1JJ8 C;  2JN6 A;  3HEF A;  4IHT A;  2NOJ B;  3ABL H;  3U1K A;  2XGD A;  2JWT A;  3MKW B;  3PL8 A;  1MMN A;  1QPM A;  1D1A A;  4HX7 A;  1S72 I;  1YYV A;  4JOM A;  3X2Q H;  1QVU A;  1S3J A;  1U9N A;  4L9V A;  3W6V A;  4D9J A;  2PQ8 A;  2OCC H;  2K86 A;  3ZXS A;  2NS7 A;  2CU7 A;  4A5N A;  1HOM A;  1VQ8 I;  2CMP A;  4YIR X;  4IRI A;  2R93 J;  1UST A;  1X1P A;  3DEU A;  1JJ6 C;  1T8I A;  2KRC A;  2O61 A;  3SZT A;  3MN2 A;  2QSG X;  3HOY J;  3ML6 A;  4CH7 A;  2BVM A;  3ZMZ A;  5ERI A;  2PBI A;  1WRJ A;  2FF4 A;  4ZYA A;  1D1B A;  5D5U B;  2XAS A;  1IZ1 A;  2EA2 A;  1OPC A;  4ENJ A;  1ENH A;  3OL4 A;  1XS9 A;  5FRO A;  1BR2 A;  4R8H A;  2R7U A;  4LLL A;  1RPW A;  1JKQ C;  1MMD A;  1BOA A;  5ILU A;  3Q3S A;  3HOS A;  5J1R A;  3Q9S A;  2DK8 A;  1GV2 A;  3MKL A;  1MZB A;  2V7F A;  3ZQQ A;  4MEY F;  4XOP A;  2DQL A;  3WGH A;  1KU9 A;  5TJJ A;  4C2M J;  1I3Q J;  2WAF A;  1X1A A;  3JRB A;  5K7H A;  1PP7 U;  1E3P A;  3CCL I;  3PUF A;  2LFB A;  2OUM A;  2MGQ A;  3ZMS A;  3FF5 A;  4FE7 A;  3K9T A;  1O3Q A;  3SFI A;  5E18 F;  5BPI A;  3OV8 A;  1BJA A;  1I1G A;  2LY2 A;  2I8D A;  4BXU A;  3WU1 B;  2XRL A;  2CW8 A;  1NK2 P;  2BE5 F;  1UG0 A;  2V4J C;  3B02 A;  3L7W A;  4ABZ A;  3CMA I;  2HU9 A;  2X1D A;  1AU7 A;  4P9U A;  2GA1 A;  5B1A H;  3BR0 A;  1JKR C;  2LK2 A;  2Y2Z A;  2F5C A;  2CUZ A;  3DTK A;  4ZYH A;  2E1N A;  3U9G A;  2FSW A;  4AM3 A;  4QWQ A;  1G2H A;  3KZZ A;  4EJU A;  2YUS A;  4LLG F;  5J4V A;  3Q9V A;  4Z6Y A;  3IH3 A;  5KCM A;  4LLN A;  3IRQ A;  1X1D A;  3T8R A;  4DJA A;  4NHJ A;  1XD7 A;  3E3V A;  4M6X A;  3GXO A;  5FD6 A;  1RKT A;  1YJ9 I;  2P6T A;  4CZC A;  3BR6 A;  3REO A;  4UUS B;  4HV5 A;  1S9H A;  1S7O A;  4G12 A;  1W5S A;  3BG9 A;  1TNT A;  3LA3 A;  3K4N A;  5FKK A;  1S7A A;  2DMP A;  1GUU A;  2KKO A;  2B7E A;  3GTG J;  4LIT A;  4QTR A;  2ZO4 A;  1R5G A;  1VTN C;  2IT0 A;  2M30 A;  3MKZ A;  2E1M C;  2YX7 A;  4IHW A;  3HOW J;  4A3E J;  4AID A;  2KIU A;  2V1D A;  1NG6 A;  3HOU J;  4IOA F;  1TL8 A;  3LNQ A;  2DO7 A;  1U78 A;  5IT9 Z;  4S05 A;  2AHQ A;  1D8J A;  3J7A O;  1P2F A;  3G73 A;  3L1P A;  3BQZ A;  4F7Z A;  5GTH C;  4ON0 A;  4YFX F;  1T39 A;  2VPL A;  1VQ6 I;  4BY7 J;  1HKT A;  2DW4 A;  4LJZ F;  4CCM A;  1X19 A;  2M0C A;  3RYP A;  2QQ8 A;  4A3K J;  1XGM A;  1K6Y A;  5J6X A;  1XDS A;  2DA4 A;  2L4A A;  5C4J J;  4NNJ A;  2NS0 A;  1A04 A;  3K1P A;  1I39 A;  4A93 J;  1W4M A;  3CP8 A;  1YX3 A;  3COA C;  4XOT A;  3K1M A;  5DM6 F;  3QOP A;  1TW3 A;  2W7N A;  3N97 A;  4XKC A;  4HA8 A;  2GBY A;  1AKH B;  1W5C C;  2HNH A;  1SFX A;  3PFY A;  3VYU B;  4CXF A;  3K70 C;  1ETO A;  4M6V A;  3ZMD A;  3BR3 A;  3PIO F;  3PM1 A;  1SC7 A;  2NVT J;  4GO1 A;  4BL0 B;  5EG0 A;  1XSX A;  3Q0V A;  4XBF A;  6PAX A;  3S1N J;  2W57 A;  3BG3 A;  4D7N A;  1XMX A;  1Q1V A;  5HLG A;  4IOC F;  1H8A C;  2P5K A;  1S6L A;  3RTR A;  5H20 A;  2DFI A;  3IH2 A;  2EB7 A;  4A3J J;  1R6R A;  3KP5 A;  4CSW A;  2A68 F;  4P1W A;  2BY3 A;  3OYN A;  1P9Q C;  4Q47 A;  3F6V A;  1H88 C;  2QF7 A;  1HLV A;  3QU3 A;  2HOT A;  1IJW C;  3KPH A;  3ABM H;  1QZY A;  3K6G A;  4IQ4 A;  2EH3 A;  1MBH A;  5FKN A;  3IRR A;  2PG4 A;  1U8B A;  2IGK A;  1EV7 A;  3KZI C;  5DV5 A;  2E2I J;  4Q4Z F;  1Z91 A;  2K40 A;  4DZP A;  4EM2 A;  1E0E A;  3BWG A;  2VJ4 A;  3VSL A;  1HW2 A;  3SYT A;  4E7H A;  2JA8 J;  5K5R A;  1GHC A;  4OU0 A;  4L18 B;  2F6C A;  1VQN I;  3M3Y J;  1HDP A;  3I58 A;  3HOT A;  2L7F P;  2CQX A;  3HGG A;  3CZ6 A;  5LGN A;  4IEJ A;  5HDN A;  2QLZ A;  1MH3 A;  3WGG A;  4FCY A;  2JPB A;  1O7L A;  1FMW A;  5GAE J;  1FC3 A;  3H0D A;  1BA5 A;  1T98 A;  1ULY A;  4I2O A;  2L0K A;  2VT3 A;  1ZAR A;  3QQA A;  5L3G A;  2NRA C;  2W24 A;  2GQQ A;  2VQH A;  4QIW N;  1OMI A;  3O8H A;  4XID A;  3F9K A;  2L5Q A;  5GTI C;  4C3I J;  4GXO A;  5JHF A;  2HVQ A;  1W7P D;  3F8N A;  5H6Q A;  1IXC A;  3PJR A;  2XKO A;  1U6G A;  1ZTR A;  3JRF A;  2ZFU A;  4EQQ A;  4BNC A;  2DYR H;  5AIQ A;  2JTV A;  4KUM A;  3O8G A;  5EJC A;  2FQ4 A;  4V2G A;  3NEU A;  2C6Y A;  2LRD A;  2JA5 J;  1K61 A;  3BZC A;  3TOA A;  3WOD F;  3C2B A;  1KA8 A;  2UV1 A;  1G59 A;  3W2V A;  4KIS A;  4I01 A;  4KN4 X;  1R1T A;  2Y0M A;  1KGS A;  1BC8 C;  1DGW Y;  4L5E A;  1RR8 C;  3HUG B;  1LFU P;  1L3L A;  3K0L A;  3RQI A;  4C2T A;  2M1B A;  5IP9 J;  1XB4 A;  2AQE A;  3FMR A;  4FTH A;  2J5O A;  2P5V A;  1DPR A;  4O6J A;  3ZQL A;  3I59 A;  4C2U A;  5EF6 A;  1N25 A;  4HV6 A;  4XRS G;  2KQR A;  2BBY A;  3LWF A;  3VOD A;  2DDB A;  4FAS D;  1PP8 F;  2V9K A;  1R5H A;  2E60 A;  2QGU A;  1J0R A;  2VE8 A;  3O6B B;  2L9R A;  3I3L A;  4HQM A;  4LB6 B;  2R7T A;  2XRN A;  4MFD A;  3ZQC A;  1FLI A;  1H9G A;  2XB0 X;  2VL8 A;  1OYW A;  2ELJ A;  4M9S A;  3RJP A;  3HM5 A;  2DA6 A;  5BNG A;  4GYI A;  3JRA A;  3FM3 A;  4DGW B;  4RLQ A;  1SVL A;  5LFA A;  4IRG A;  4J19 A;  3M07 A;  3CTA A;  3LAJ A;  3KET A;  1T38 A;  4FIS A;  3S16 J;  2E1O A;  2VI6 A;  4AYB N;  3H9Q A;  3T0Y A;  5J3L A;  1YS7 A;  3G4S I;  1XGN A;  4A3L J;  5ICG A;  2QUF A;  3DPU A;  3KYC B;  5CVU A;  3GTK J;  4RGS A;  9ANT A;  4PSX A;  1RZ4 A;  4RM3 A;  2A6H F;  1TC3 C;  1B9M A;  2DFH A;  4E7Z A;  3KYD B;  2PEX A;  1H9T A;  4C3J J;  3GFJ A;  4I6Z A;  4IHY A;  3S1Q J;  4FQG A;  1USS A;  4HF2 A;  1J09 A;  4U7B A;  1SVO A;  4MO7 A;  2M9H A;  2MC4 A;  4U87 A;  4ZZD A;  4CYC B;  4U0W A;  1QA6 A;  1D0X A;  1V5F A;  2F48 A;  2WAD A;  2Y75 A;  1SVM A;  4IX7 A;  3G1M A;  3FBN B;  3IL2 A;  1B72 B;  2WAQ N;  1WI9 A;  1K4S A;  2MD5 A;  1GV5 A;  3KCC A;  1Q1H A;  2BY2 A;  3OYG A;  5LHI A;  2JT1 A;  2H8W A;  3KLO A;  1FNN A;  3MAJ A;  4AVZ A;  1UCR A;  1ZGA A;  3DEW A;  1MIJ A;  2X6X A;  4XLN F;  5HDK A;  4BE1 A;  3S2H J;  1ZLJ A;  5IY5 H;  4XSX F;  2DT5 A;  4ZYE A;  3GFM A;  3IWZ A;  4RBO A;  2E5Z A;  3HSR A;  4M6Y A;  3FXM A;  3R4K A;  4WXD A;  3C7J A;  3BZK A;  3G71 I;  3CCS I;  3PFI A;  4AWX B;  3I56 I;  2F5V A;  3NWT A;  1ZLK A;  3HSF A;  4IHX A;  3H9J A;  4MEX F;  1K79 A;  4Q5S F;  2B63 J;  3H0G J;  5K5O A;  5LHH A;  3OYI A;  3IWF A;  2XAJ A;  2AQF A;  2FML A;  3HHH A;  2DN0 A;  1LPQ A;  3HDD A;  2Y48 A;  2QKM B;  1OCC H;  2AXT C;  4B48 A;  4XON A;  1B1B A;  2ZKZ A;  1WSU A;  4BXX J;  4DIQ A;  2HOS A;  3WG7 H;  1IUY A;  2KFD A;  1IUF A;  4BQO A;  3CES A;  2Z5U A;  2RKH A;  1OIS A;  1ZYR F;  1AWC A;  4C3H J;  5JVT A;  1SAN A;  2W1O A;  3K4J A;  2KPM A;  2R7O A;  3LQQ A;  4RB0 A;  1J2X A;  2A6E F;  2R7W A;  2NNY A;  2H1K A;  1ZAO A;  2XKP A;  2GA2 A;  5GAH J;  1R9T J;  2ZB9 A;  3HRM A;  1Z67 A;  1BC7 C;  3RKW A;  3MVP A;  3O3K A;  4AU7 A;  4XK4 A;  3J80 Z;  1FX7 A;  3LSP A;  2YX4 A;  3PNV A;  3H36 A;  4R79 A;  5J8C A;  2YSR A;  4F55 A;  2EQR A;  3CF2 A;  3HPG A;  2RQQ A;  5CKT A;  1MNE A;  3F8M A;  3H3U A;  3PNY A;  2EFQ A;  1B8I A;  2E34 A;  4ZDO A;  2QSF X;  2R5Z A;  1OYI A;  1R5I D;  3MWM A;  3IV5 A;  4AIJ A;  1IG7 A;  3MEX A;  2LG4 A;  3P5J A;  2O8X A;  4YFK F;  1EF4 A;  3KEQ A;  1POG A;  1TZL A;  4O5V A;  2A61 A;  3FXK A;  4G8X A;  4UVC A;  5IP6 A;  2DFE A;  2CW0 F;  3QAH A;  4LD5 A;  3U1D A;  3L9F A;  4BE2 A;  3WG9 A;  3GFI A;  3ECH A;  3CJT B;  1A5J A;  2XGE A;  2BEO A;  3M8F A;  1A6I A;  1IRG A;  3ZGK A;  5CVV A;  4DYQ A;  3F8F A;  2L02 A;  4B4C A;  4D1Q A;  1LVK A;  2IS4 A;  4OIN F;  1KQ9 A;  1RR7 A;  5F0H A;  2UXX A;  4ZZL A;  3TO7 A;  4PCQ A;  3ERM A;  3WHC A;  4C9Y A;  2M87 A;  4BDZ A;  2BGC A;  3AL0 C;  4M71 A;  2HDW A;  4U0Y A;  2MC3 A;  5K7Z A;  4HW0 A;  2JQ7 A;  4NB5 A;  1R4N B;  3OMY A;  2ISY A;  2V6C A;  1WHU A;  3SDB A;  2EZL A;  2LTP A;  3OS0 A;  2BXZ A;  5HS7 A;  4EMS A;  3ZPL A;  4H4K C;  5FFZ A;  1ZGW A;  1IRF A;  2ZJQ F;  4WK8 F;  2EIL H;  1FYL A;  5EEA A;  4XN0 A;  1SFU A;  1XTA A;  5L3D A;  5F1R A;  3A4C A;  4CIC A;  1MW7 A;  2XVC A;  1H89 C;  4MNU A;  5BMZ A;  1FIA A;  2KJC A;  1MJB A;  3B6C A;  4E6K G;  1DDN A;  2OZU A;  4MIM A;  1ETW A;  2CO5 A;  4GCV A;  2HYF A;  4ZH4 F;  2ZSI B;  2LR8 A;  2VQG A;  3H3Z A;  2R5Y A;  2R7S A;  2KJB A;  1W0U A;  4L9T A;  3P7N A;  3ZQG A;  4L0Z B;  1R1U A;  4KT5 C;  1DP7 P;  1SD6 A;  3DPT A;  2RNG A;  1KU3 A;  3WGI A;  1LQ1 A;  2CRG A;  5JLW A;  5HNH A;  1ONV A;  3VYT B;  1GDT A;  2M34 A;  4C30 A;  3S17 J;  4UVB A;  2WB1 N;  3S2W A;  2HVR A;  3JRI A;  2DMT A;  3A1Y A;  1OR7 C;  3LSG A;  4ZC3 A;  5IYC J;  4E7K A;  1D8K A;  4ITV A;  4DZJ A;  1OCO H;  3HOZ J;  4LFU A;  4K2E A;  4E70 A;  1K78 A;  3GO5 A;  3HBL A;  4BS9 A;  2IXS A;  3S3N A;  3FKJ A;  4RB2 C;  3W6K B;  3M9A A;  1HST A;  2P4W A;  2KRH A;  5E79 C;  5HLH A;  4RB3 C;  2D1H A;  1KZH A;  3RKQ A;  4IJA A;  3GTP J;  2PI0 A;  4A0X A;  2BOL A;  3U21 A;  2IA0 A;  1S5L C;  5EZG A;  1QZE A;  2LSO A;  2FE3 A;  2UUZ A;  2LF8 A;  2VIX A;  3TDZ C;  2P7V B;  2VKD A;  1TWA J;  2M3A A;  1QU3 A;  1Y8R B;  2FBK A;  1HDD C;  3J7Z I;  3QPL A;  5FLM J;  4F91 B;  3DQV C;  4L9J A;  2HQA A;  2FD5 A;  2LD5 A;  1X58 A;  1JT6 A;  2M5W A;  2HDD A;  5DUI A;  1PVE A;  3F8B A;  2ZNZ A;  3K4K A;  2CQQ A;  4F52 A;  1NHA A;  5DCM A;  5LD2 C;  2BY1 A;  4JP0 A;  2XSJ C;  4CCN A;  1UEL B;  5FLV A;  4N0B A;  2WY7 Q;  5EG0 B;  2O8K A;  2HR3 A;  4BQQ A;  2R7X A;  1FEX A;  1YJN I;  1VQ9 I;  4FX4 A;  2MG4 A;  2CV0 A;  3MD2 A;  3FXU A;  4MTE A;  1HBX G;  1I27 A;  3GZN B;  4KT6 A;  3V8L A;  4Y4R A;  2JUG A;  3E0J B;  3HKZ N;  4I02 A;  4HBL A;  1EH7 A;  2DT6 A;  2JA7 J;  1CQT A;  1U5T C;  4CO8 A;  2VBX A;  1J75 A;  2IVM A;  3SFZ A;  1EKE A;  4MFE A;  4NUB A;  4KA4 A;  3HC7 A;  5F08 A;  5ICF A;  1IN8 A;  4Y3O A;  4MTD A;  4IPA A;  1YJW I;  4U88 A;  4KMU X;  4LOC A;  3WTY C;  2Y9Y A;  2VBW A;  4PGG A;  4CGZ A;  1IXS B;  1ITY A;  5A2Q Z;  4GRI A;  4DYC A;  5JHU A;  2Q8K A;  2M4K A;  3CCU I;  3JSO A;  2GXB A;  1ETV A;  1X3U A;  4BHC A;  2K02 A;  3E6B A;  1F1Z A;  5DCF A;  2WAE A;  2EZK A;  2VJI A;  3LST A;  1RUN A;  4A3F J;  4NQW A;  3MZH A;  3JRC A;  2EPF A;  1RI7 A;  1HXD A;  1UJ8 A;  2E7X A;  1J7K A;  1ZG5 A;  3Q5F A;  1P4W A;  1GVJ A;  2L54 A;  3E6C C;  1JKO C;  4BHP A;  2CG4 A;  1W36 C;  4P96 A;  2FUG 2;  2JVG A;  1FMV A;  1F4K A;  2RC4 A;  3OYE A;  2M45 A;  3KYL A;  1SFO J;  3FIW A;  2M8G X;  2WY8 Q;  2O3F A;  1IRZ A;  3K69 A;  3LAP A;  4XSZ F;  5HOO A;  2NOG A;  4P5O A;  2W48 A;  5D8L B;  2OQG A;  1VQ5 I;  1K83 J;  3NQO A;  2XAQ A;  4YRV A;  3S8P A;  3CUO A;  1TT0 A;  3UKG A;  1PDN C;  4DQ2 A;  2ZXW H;  1WJB A;  2A05 A;  3A01 B;  1BR4 A;  4LGW A;  2E5N A;  5C44 J;  4ZYG A;  1IXR C;  3S1R J;  5AIP A;  2HOA A;  1ACI A;  3QPT A;  2W25 A;  5HNF A;  1P7J A;  1R58 A;  3WE3 A;  1XMA A;  2VOD A;  3A2K A;  1GXQ A;  3LMM A;  3E6M A;  1O7F A;  2H6B A;  3JRH A;  1BI3 A;  2LP0 A;  4HZF A;  4RAZ A;  3A03 A;  3EET A;  3SHF A;  3CCE I;  3OIP A;  2NVY J;  2IS2 A;  3I59 B;  3KE2 A;  3HHG A;  3OYH A;  3AG1 H;  1SEU A;  3F72 A;  4LG3 A;  5D6E A;  4JBA A;  2LKP A;  2XPV A;  5KVR A;  2EIK H;  4G6Q A;  5FKO A;  3CCJ I;  1REP C;  4RS8 A;  4F3Q A;  1IO2 A;  2VT2 A;  3DKW A;  4XIC A;  1MSE C;  1OQY A;  2IA2 A;  5IOY A;  1SFK A;  2CFX A;  4HLY A;  4CCJ A;  4BGD A;  1I3A A;  1TW2 A;  1FJL A;  5F04 A;  4Y7N J;  4HX4 A;  1IF1 A;  2V1U A;  1ZGJ A;  1UFM A;  3WE2 A;  3FX3 A;  2EJR A;  2R4G A;  1UHM A;  1TBX A;  1Z3X A;  4KFC A;  4F93 B;  1T0F A;  1FYM A;  4JX4 A;  3EQL F;  2BW3 A;  5FGM A;  2EV5 A;  1YX5 A;  1FYK A;  2M4G A;  3ONQ A;  2ACJ A;  4RGX A;  5EDN A;  4B3A A;  4NC8 A;  1XCB A;  3HRU A;  1MJ9 A;  4G7Z F;  5HDG A;  3S32 A;  5EGO A;  1OCR H;  1H0M A;  2E1C A;  3CLQ A;  1ZK8 A;  3SZG A;  3OYK A;  3D1N I;  1IDZ A;  1JE8 A;  1QRY A;  4FT8 A;  4HPQ A;  1TP4 A;  2YR2 A;  4B3X A;  3V7S A;  1KON A;  1XGS A;  1BOB A;  5IYB J;  4M9Z A;  5ILS A;  3JRD A;  2RVC A;  2G0E A;  3TP3 A;  4ENN A;  3PNT A;  2V1N A;  3T8T A;  2QM3 A;  4A2U A;  2F2E A;  2K9Q A;  2XGX A;  5JFR A;  4II3 A;  3U2R A;  1JTY A;  1IN7 A;  2E35 A;  2DPD A;  3C2G A;  1PUF A;  4I0B A;  4EJV A;  2Z2S B;  2O6G E;  1KQ0 A;  2A6T A;  1S8N A;  3BJO A;  1Z1D A;  1E3O C;  1X3Z B;  3F8C A;  3JCU C;  4WX9 A;  4BY1 J;  1FIP A;  5J47 A;  3K2Z A;  1Z05 A;  2VBZ A;  2A5W A;  1B59 A;  3DLL F;  2ZXI A;  3FXL A;  3IAM 2;  1SMT A;  1WGX A;  3FK7 A;  1HKQ A;  2JVH A;  4BBR J;  5LGT A;  2NVQ J;  5F6F A;  3OIQ A;  2IEK A;  4UNO A;  1WCM J;  2X0L A;  4AD9 A;  1FOK A;  4IVN A;  1J9I A;  1K7A A;  3E6D A;  2X51 A;  3VDX A;  2ADU A;  4QPQ A;  3T5X A;  3K4C A;  1RRJ A;  4XRM A;  1Z0X A;  4A6E A;  4M74 A;  1A35 A;  4L0Y B;  3FXO A;  1P92 A;  1HQC A;  3BY6 A;  3PSI A;  3O2P E;  2R3S A;  3F6O A;  3GF2 A;  4U7D A;  3OYM A;  5DTD A;  2EA4 A;  2IPQ X;  1D1C A;  1T0F C;  1SD7 A;  1WJC A;  2KDO A;  2Y0S N;  4HDU A;  2XF6 A;  1JGS A;  3GLL A;  1SD4 A;  3BJ6 A;  1QGP A;  2BHZ A;  2VQC A;  4M3E A;  4RMN A;  2P81 A;  1TQI A;  4KMF A;  5FLX K;  2EIM H;  2A69 F;  2BV6 A;  1P7I A;  2NYX A;  4IHV A;  3ZQ7 A;  4A0Z A;  3JR9 A;  3CUQ B;  3R61 A;  1FBQ A;  4HST A;  1WH5 A;  1N77 A;  1IC8 A;  1BBY A;  3BRO A;  2GM4 A;  4CUG A;  3RZO J;  1LFP A;  3DFG A;  3G1L A;  4FHT A;  3F22 A;  2ID6 A;  4KIC A;  3LFU A;  2I10 A;  2X4H A;  4ANJ A;  3ULQ B;  5M5X J;  5IOZ A;  5D4R A;  1VQM I;  2QCO A;  2R7R A;  3BR5 A;  2K9L A;  1JUM A;  4YEJ A;  2HI3 A;  1Y39 A;  1JHF A;  5D8K B;  1B8I B;  3HG9 A;  1I1S A;  1TNS A;  2F4M B;  3FXR A;  5JVG F;  2R5Z B;  2IGN A;  1O3R A;  4MHG A;  1Z6T A;  3KX2 A;  4IO9 F;  2MH9 A;  3R0J A;  2NVX J;  3QYE A;  2VUM J;  4BYY A;  3SEQ A;  3BPV A;  2OA4 A;  4E7I A;  5CPR B;  3E5U A;  4YEL A;  2WV1 A;  2CUJ A;  3HSE A;  5CVI A;  1QHG A;  4XKB A;  2EFW A;  2R7V A;  3H92 A;  5HLT A;  3K10 A;  5IPA A;  4M3G A;  4II2 A;  3QYB A;  3LL7 A;  3VSK A;  1YQA A;  2EFP A;  4L5I A;  3BCB A;  4IQJ A;  5LHG A;  2FU4 A;  3BZ6 A;  2K4B A;  4DYR A;  4OIQ F;  1SD5 A;  2R7Q A;  3W6J B;  2ESN A;  1YLF A;  2DOD A;  1NH3 A;  2ECB A;  1UHS A;  3LA7 A;  3S15 J;  1T6S A;  4IKF A;  3HOV J;  3ROU A;  2DT7 B;  5E3N A; 
#chains in the Genus database with same CATH homology
 2ELH A;  2M8E A;  4QLC U;  1YW7 A;  2JSC A;  3HYI A;  3JW4 A;  3GW2 A;  3WTT C;  3L09 A;  5DD4 A;  2HOE A;  3ZP5 A;  1F5T A;  1AOY A;  1FZP B;  5FLX Z;  2KIF A;  3GVA A;  2L4M A;  3IC7 A;  1KYW A;  1ZRD A;  4LMY A;  2H09 A;  4CHU A;  2J5P A;  1FP1 D;  1W5T A;  3KP7 A;  2RQP A;  2QVO A;  3KLN A;  2EWN A;  5LLQ A;  5HS8 A;  2K7L A;  3HIF A;  1LDK B;  1HW1 A;  2HKO A;  4HF1 A;  5IT3 A;  1K78 B;  3WTV C;  2XRO A;  5E8G A;  4RGU A;  4LG0 A;  3LA2 A;  1TQM A;  4B8X A;  4JQF A;  4YFN F;  1V3F A;  1FBS A;  1C0W A;  4L9N A;  2RDP A;  2W85 A;  2JZY A;  5CJ9 A;  4ETS A;  3MZY A;  2XV4 S;  3ZN1 A;  1TLH B;  5E17 F;  3SZP A;  3QP5 A;  1UB9 A;  2HTS A;  3N4M A;  4A5M A;  4GYG A;  3MCZ A;  5DCM B;  3VOE A;  3KP2 A;  3E5Q A;  1YS6 A;  2PJP A;  5HVQ C;  3BOQ A;  1FSH A;  2TDX A;  2FNP A;  4UV9 A;  3J81 K;  4M72 A;  4N9H A;  2DQR A;  5E1W A;  1IAW A;  2HYG D;  2IJL A;  1YW9 A;  1OR7 A;  4D0P A;  5E1X A;  3KFW X;  4M9X A;  2D45 A;  1MKM A;  1XSV A;  3ABU A;  2ZJ2 A;  3NRV A;  2P6S A;  3LFK A;  4P9F A;  1L0O C;  1FT9 A;  1JXS A;  4WWC A;  4YG2 F;  3BP8 A;  2Z9O A;  4HLX A;  5CVJ A;  4LK1 F;  1ZRF A;  1I6X A;  1R36 A;  4IHS A;  4G9Y A;  4CDG A;  2P7C B;  2XUB A;  4KN7 X;  2VXZ A;  1J5Y A;  2EFO A;  1YFH A;  3GUD A;  1TQP A;  2P5L C;  2L01 A;  3K1N A;  4ZYD A;  1G3T A;  2CSO A;  1IN5 A;  2H27 A;  2H6C A;  2OZ6 A;  2HTJ A;  1P6R A;  3QP6 A;  3WU0 A;  4EVI A;  2HS5 A;  3CDH A;  2CQK A;  3E97 A;  1MGT A;  2V9V A;  1U5T A;  2ZXJ A;  4HQE A;  3TGN A;  2B0L A;  2VC0 A;  3GZ6 A;  3TKY A;  4H0E A;  4KNY A;  1O3T A;  1I5Z A;  1STZ A;  1HW5 A;  4BHB A;  2CWE A;  1BI1 A;  5K1Y A;  1R00 A;  2G7H A;  3GYH X;  3CLO A;  1EH6 A;  2HQR A;  1KQ8 A;  3KP4 A;  2COM A;  1ZH5 A;  3F3X A;  3C18 A;  3GEZ A;  2PFB A;  5E20 A;  1CF7 A;  3FMS A;  3MFK A;  2E7W A;  2F5F A;  4UXN A;  4S04 A;  1R7J A;  1T2K A;  3DV8 A;  4GGG A;  2PLY A;  3I0T A;  1E17 A;  2RGV A;  3DPL C;  2MLK A;  3WTZ A;  5D4S A;  1SFE A;  2K27 A;  2DBB A;  2LF7 A;  2MA3 A;  2PMH A;  2XHK A;  3RDI A;  3FM5 A;  2Q2E A;  4CZZ A;  1OKR A;  5ICC A;  4HAM A;  3LQR A;  1XDU A;  1IN4 A;  5FB2 A;  1ZRC A;  3ELK A;  3QU6 A;  2EFN A;  1U2W A;  5HS9 A;  2VON A;  1YW8 A;  1MDM A;  3RKY A;  4I7H A;  3HRT A;  1W7P A;  1KU7 A;  3PQJ A;  4WF2 A;  4YIF A;  3I64 A;  2DK5 A;  4RAY A;  2Z3Y A;  1G3W A;  3V7C A;  3I54 A;  5LBQ A;  3GZ5 A;  2ZNY A;  2HFH A;  5JI6 A;  2HQN A;  5FO5 A;  2QQ9 A;  2FBH A;  2F5E A;  2NNN A;  1LNW A;  5ILV A;  4ENM A;  1LVA A;  2HWV A;  2V1X A;  2H94 A;  5IT9 K;  4AIH A;  4EJT A;  3TQN A;  2HEO A;  2PN6 A;  2GWR A;  3IKT A;  4PDK A;  3L00 A;  2EK5 A;  4Z2Y A;  3RPU A;  2ZFW A;  2VC1 A;  4EGZ A;  2OD5 A;  4LB5 A;  2NAZ A;  3QRF F;  4Q48 A;  2IW5 A;  2AS5 F;  4JK1 X;  2ZME A;  5HLI A;  3HRS A;  3VB2 A;  5L3F A;  2QYO A;  2LDU A;  4LK0 F;  1OYY A;  4WCG A;  3HTS B;  2ESH A;  4FX0 A;  1BIA A;  3C1D A;  3EDP A;  5ICE A;  5DUK A;  2FMY A;  2QBY A;  1MD0 A;  2DI3 A;  4I09 A;  1IN6 A;  3I71 A;  5DD8 A;  3JAM K;  3F21 A;  3R0A A;  1LJ9 A;  3TDU C;  2GAU A;  3V7R A;  1SAX A;  2L3D A;  3ERE D;  1ZN2 A;  4OOI A;  4U0V A;  3TO6 A;  2RV8 A;  3M1E A;  2FBI A;  2RNJ A;  1B4A A;  4I98 B;  4MQV A;  3WTS C;  5JR3 A;  3L2C A;  3ABT A;  3QPH A;  3V4G A;  2IA1 A;  2VBY A;  5LRS A;  3HTU A;  1R23 A;  3ECO A;  2OU2 A;  4P55 A;  2O03 A;  4UV8 A;  3ZMV A;  2DU9 A;  1S29 A;  4XLP F;  4ESJ A;  3ISP A;  5BS6 A;  1ZG1 A;  1ON2 A;  1D3Y A;  2LNB A;  4G7O F;  5TRD A;  5CLS A;  2QZ8 A;  1O57 A;  5LRR A;  1ON1 A;  4OMZ A;  4UUV A;  4EJO A;  3TOB A;  2OQR A;  4IXA A;  1CGP A;  2W84 A;  1B9N A;  4BH9 A;  2Z33 A;  2CGP A;  4LG0 B;  1E2X A;  5F64 A;  2QWW A;  4PZJ A;  1D5V A;  3JAM Z;  2P8T A;  4A0Y A;  2FNA A;  3RKX A;  1EH8 A;  2GIV A;  1U8R A;  1XSD A;  3EYY A;  3M8E A;  2A07 F;  2D2W A;  1BN5 A;  1QQI A;  4KIF A;  3WTX C;  5H6R A;  1Y0U A;  5CYV A;  2KIM A;  4EGY A;  4O3M A;  2HGC A;  1FY7 A;  3D0S A;  1F9N A;  4HDV A;  4HYE A;  1RNL A;  4Y17 A;  2DTR A;  2XIG A;  1BM9 A;  5L3B A;  5FFX A;  1ZRE A;  3P9I A;  4OIR F;  1P4X A;  1XCV A;  1J59 A;  3P9C A;  5LEK A;  3P9K A;  3FWE A;  4CYD A;  5D5W B;  2MBF A;  3KZY A;  5BQT A;  4KYW A;  4BAY A;  3DXJ F;  3VFZ A;  4OMY A;  2BYV E;  1DUX C;  1BI2 A;  1GXP A;  3CO7 C;  1BIB A;  4Y13 A;  2YU3 A;  3IKV A;  4RGR A;  1UHW A;  4G6D A;  3T1B A;  4R1H A;  3R6S A;  3GLX A;  5L3E A;  3CJN A;  2GZW A;  2Q0O A;  5ED4 A;  4KIB A;  1XMK A;  4A12 A;  2D1V A;  3KP6 A;  3GX4 X;  5D5X B;  5D5V B;  3EUH A;  1G3S A;  1LDJ A;  1LEB A;  3OOP A;  1ODD A;  2OBP A;  4EJW A;  4XRF A;  1KYZ A;  5KK1 A;  4MQ9 F;  1Z7U A;  1V4R A;  1ZHF A;  2VOO A;  1ZG3 A;  1U5T B;  3BPX A;  2JPC A;  1YO5 C;  4DNC A;  1PUE E;  3GWZ A;  4OIP F;  4YII A;  4AIK A;  2Z99 A;  1FSE A;  5J8F A;  3V8J A;  4G94 A;  1G4D A;  1P4A A;  2FEZ A;  3ZMU A;  3FHZ A;  1XN7 A;  3FMQ A;  3TO9 A;  3J80 K;  2V79 A;  4AVP A;  4IRH A;  4MGR A;  1CF7 B;  3WTW C;  1XGO A;  4ESF A;  4PGH A;  1Z9C A;  2A5Y B;  5EEH A;  4ASN A;  3PQK A;  3SXY A;  2FA5 A;  1YTY A;  1JHH A;  4KDP A;  3WTU C;  3F23 A;  4BQA A;  3JSP A;  5DEQ A;  1TTY A;  3RYR A;  5L3C A;  2FRH A;  2EV0 A;  2XAH A;  1QO0 D;  3G3Z A;  2VOP A;  2K4J A;  3BJA A;  4N9I A;  2XAG A;  4M73 A;  5CVR A;  2ZCW A;  1HKS A;  3JTH A;  1FP2 A;  2UWM A;  1B6A A;  1K6O A;  2CYY A;  4HOB A;  2HKX A;  3EYI A;  1FWZ A;  4Y15 A;  4EM0 B;  4EV0 A;  1MDM B;  3KEO A;  3M7G A;  4B09 A;  3CO6 C;  1W7P B;  3RIR A;  1LDD A;  1RUO A;  2R7D A;  3CUQ A;  2UXN A;  4HF0 A;  1BI0 A;  4ENK A;  2UZK A;  2STT A;  2GXG A;  2FXA A;  2XAF A;  3JTG A;  3MQ0 A;  3SQN A;  3I4P A;  2R7F A;  3AAF A;  2ISZ A;  3DP7 A;  2ETH A;  3GFL A;  3HUG A;  4HX8 A;  2O0Y A;  4KIG A;  1WWX A;  3IHU A;  1WQ2 A;  2JRT A;  4G7H F;  5DYM A;  2FQ3 A;  2DAO A;  3VEP A;  4WXH A;  3R60 A;  3ZMT A;  2HZT A;  1R22 A;  5D6F A;  1RIO H;  2DPU A;  4UHT A;  3BDD A;  1O3S A;  1KU2 A;  2G9W A;  1LB2 A;  2KRF A;  3ZN0 A;  3RI4 A;  5E8I A;  3D5L A;  3E5X A;  2ZME B;  2YPR A;  2VN2 A;  2A3S A;  4EM1 A;  1G3Y A;  3DF8 A;  3FXQ A;  2IRF G;  2FOK A;  5BPD A;  2RN7 A;  4UVA A;  2QEN A;  3J81 Z;  5FD5 A;  1QBJ A;  4L5J A;  2QQA A;  3I5U A;  1R1V A;  1Z6R A;  1FPQ A;  2QBY B;  2DLL A;  1WKM A;  4A6D A;  4I0A A;  2WWY A;  3CUQ C;  4TV7 A;  4ESB A;  2OAZ A;  5BOX A;  5LGU A;  4OIO F;  3C3W A;  2WC2 A;  5E1Z B;  3B73 A;  2EV6 A;  2AXL A;  1HSJ A;  5A2Q K;  2HDC A;  2VE9 A;  5EEG A;  1MJA A;  1QNT A;  2WV0 A;  5LEJ A;  1YIO A;  1FBU A;  5AON A;  4RB1 A;  2F5D A;  3I53 A;  3KP3 A;  4IF4 A;  1U3E M;  1LEA A;  2G7U A;  1IW7 F;  2WTE A;  2IP2 A;  2STW A;  1YG2 A;  1QZZ A;  2ZBK A;  5K5Q A;  2MH2 A;  4WXC A;  2MLG A;  3V8K A;  5DDG A;  2PMU A;  3RPQ A;  1SMY F;  2QQB A;  1G6N A;  1DPU A;  3FZV A;  4IHT A;  1QPM A;  4HX7 A;  1YYV A;  1S3J A;  4L9V A;  2PQ8 A;  2K86 A;  4A5N A;  4IRI A;  1UST A;  3DEU A;  2O61 A;  3SZT A;  3ML6 A;  3ZMZ A;  5ERI A;  2PBI A;  1WRJ A;  2FF4 A;  5D5U B;  2XAS A;  1IZ1 A;  2EA2 A;  1OPC A;  4ENJ A;  4R8H A;  4LLL A;  1BOA A;  5ILU A;  3HOS A;  3Q9S A;  2DK8 A;  1MZB A;  4MEY F;  3WGH A;  2DQL A;  1KU9 A;  5TJJ A;  1PP7 U;  3ZMS A;  3FF5 A;  3K9T A;  1O3Q A;  5E18 F;  5BPI A;  3OV8 A;  1BJA A;  1I1G A;  4BXU A;  3WU1 B;  2BE5 F;  3B02 A;  3L7W A;  4P9U A;  2GA1 A;  2F5C A;  4ZYH A;  2E1N A;  3U9G A;  2FSW A;  4QWQ A;  3KZZ A;  4EJU A;  4LLG F;  3Q9V A;  4LLN A;  3IRQ A;  3T8R A;  4NHJ A;  1XD7 A;  3E3V A;  4M6X A;  3GXO A;  5FD6 A;  2P6T A;  3REO A;  4HV5 A;  1S7O A;  1W5S A;  1TNT A;  3LA3 A;  1S7A A;  2KKO A;  2ZO4 A;  1R5G A;  1VTN C;  2IT0 A;  2M30 A;  2YX7 A;  2KIU A;  2V1D A;  2DO7 A;  1U78 A;  5IT9 Z;  4S05 A;  1D8J A;  3J7A O;  1P2F A;  3G73 A;  4F7Z A;  4ON0 A;  4YFX F;  1T39 A;  1HKT A;  2DW4 A;  4LJZ F;  3RYP A;  1XGM A;  5J6X A;  1XDS A;  2L4A A;  2NS0 A;  1A04 A;  3K1P A;  1W4M A;  3COA C;  3K1M A;  3QOP A;  1TW3 A;  3N97 A;  4HA8 A;  1SFX A;  4CXF A;  3ZMD A;  4GO1 A;  1XSX A;  4XBF A;  6PAX A;  2W57 A;  5HLG A;  2P5K A;  1S6L A;  3RTR A;  5H20 A;  2DFI A;  2EB7 A;  3KP5 A;  2A68 F;  4Q47 A;  3F6V A;  3QU3 A;  1QZY A;  3IRR A;  2PG4 A;  1EV7 A;  5DV5 A;  4Q4Z F;  1Z91 A;  4EM2 A;  3BWG A;  1HW2 A;  5K5R A;  1GHC A;  4OU0 A;  4L18 B;  3I58 A;  3HOT A;  5LGN A;  5HDN A;  2QLZ A;  3WGG A;  2JPB A;  1O7L A;  1FC3 A;  1T98 A;  1ULY A;  4I2O A;  2VT3 A;  1ZAR A;  5L3G A;  2NRA C;  2W24 A;  2GQQ A;  1OMI A;  4GXO A;  1W7P D;  3F8N A;  5H6Q A;  1IXC A;  2XKO A;  1U6G A;  4EQQ A;  4BNC A;  5AIQ A;  2JTV A;  4KUM A;  2C6Y A;  3NEU A;  3TOA A;  3WOD F;  1KA8 A;  4I01 A;  4KN4 X;  1R1T A;  2Y0M A;  1KGS A;  1BC8 C;  1L3L A;  3K0L A;  2M1B A;  1XB4 A;  3FMR A;  2J5O A;  2P5V A;  1DPR A;  4O6J A;  3I59 A;  4HV6 A;  2BBY A;  3LWF A;  3VOD A;  1PP8 F;  1R5H A;  2VE8 A;  1J0R A;  3O6B B;  4HQM A;  4LB6 B;  2XRN A;  1FLI A;  1H9G A;  4M9S A;  1OYW A;  3RJP A;  4GYI A;  3FM3 A;  4IRG A;  3CTA A;  3LAJ A;  3KET A;  1T38 A;  3T0Y A;  1YS7 A;  1XGN A;  5ICG A;  2QUF A;  5CVU A;  4RGS A;  1RZ4 A;  2A6H F;  1B9M A;  2PEX A;  1H9T A;  3GFJ A;  1USS A;  4HF2 A;  4U7B A;  4ZZD A;  4U0W A;  2Y75 A;  3IL2 A;  1WI9 A;  2MD5 A;  3KCC A;  1Q1H A;  5LHI A;  2JT1 A;  3KLO A;  3MAJ A;  1FNN A;  1UCR A;  1ZGA A;  4XLN F;  5HDK A;  1ZLJ A;  4XSX F;  2DT5 A;  4ZYE A;  3GFM A;  3IWZ A;  3HSR A;  4M6Y A;  3R4K A;  4WXD A;  3C7J A;  3PFI A;  4AWX B;  1ZLK A;  3HSF A;  4MEX F;  1K79 A;  4Q5S F;  5K5O A;  5LHH A;  3IWF A;  2XAJ A;  2FML A;  3HHH A;  2Y48 A;  1B1B A;  2ZKZ A;  1WSU A;  1IUY A;  2Z5U A;  2RKH A;  1ZYR F;  1AWC A;  5JVT A;  3LQQ A;  4RB0 A;  1J2X A;  2A6E F;  2NNY A;  1ZAO A;  2XKP A;  2GA2 A;  3HRM A;  1BC7 C;  3RKW A;  3O3K A;  3J80 Z;  1FX7 A;  2YX4 A;  4R79 A;  5J8C A;  2YSR A;  3F8M A;  3H3U A;  2EFQ A;  1OYI A;  3MWM A;  4AIJ A;  3MEX A;  2O8X A;  4YFK F;  3KEQ A;  4O5V A;  2A61 A;  4G8X A;  4UVC A;  2CW0 F;  3QAH A;  3U1D A;  4LD5 A;  3L9F A;  3WG9 A;  3GFI A;  3ECH A;  3M8F A;  2BEO A;  1IRG A;  5CVV A;  3F8F A;  2L02 A;  4OIN F;  1KQ9 A;  2UXX A;  4ZZL A;  3TO7 A;  4PCQ A;  2M87 A;  2BGC A;  4M71 A;  4U0Y A;  2MC3 A;  4HW0 A;  4NB5 A;  2ISY A;  2V6C A;  5HS7 A;  4EMS A;  3ZPL A;  5FFZ A;  1IRF A;  4WK8 F;  1FYL A;  1SFU A;  5L3D A;  5F1R A;  4CIC A;  2XVC A;  4MNU A;  5BMZ A;  2KJC A;  1MJB A;  1DDN A;  2OZU A;  2CO5 A;  4GCV A;  2HYF A;  4ZH4 F;  3H3Z A;  2KJB A;  4L9T A;  3P7N A;  4L0Z B;  1R1U A;  4KT5 C;  1DP7 P;  1SD6 A;  3DPT A;  1KU3 A;  3WGI A;  1LQ1 A;  1ONV A;  4UVB A;  3S2W A;  1D8K A;  4LFU A;  4K2E A;  4E70 A;  1K78 A;  3GO5 A;  4RB2 C;  3W6K B;  3M9A A;  1HST A;  2P4W A;  5HLH A;  4RB3 C;  2D1H A;  4IJA A;  2PI0 A;  4A0X A;  2IA0 A;  2LSO A;  2FE3 A;  2LF8 A;  3TDZ C;  2P7V B;  2FBK A;  3DQV C;  4L9J A;  2M5W A;  5DUI A;  3F8B A;  2ZNZ A;  1NHA A;  5DCM A;  4N0B A;  2HR3 A;  4FX4 A;  4MTE A;  3FXU A;  1HBX G;  1I27 A;  3V8L A;  4I02 A;  4HBL A;  1EH7 A;  1U5T C;  4CO8 A;  2VBX A;  1J75 A;  2IVM A;  3SFZ A;  4KA4 A;  5ICF A;  1IN8 A;  4MTD A;  4IPA A;  4U88 A;  4KMU X;  3WTY C;  2VBW A;  4PGG A;  4CGZ A;  1IXS B;  5A2Q Z;  5JHU A;  2Q8K A;  3JSO A;  2GXB A;  4BHC A;  1X3U A;  2K02 A;  3E6B A;  1F1Z A;  5DCF A;  1RUN A;  3LST A;  4NQW A;  3MZH A;  1RI7 A;  1HXD A;  1ZG5 A;  2E7X A;  1J7K A;  3Q5F A;  1P4W A;  1GVJ A;  2L54 A;  3E6C C;  4BHP A;  2CG4 A;  4P96 A;  1F4K A;  2RC4 A;  2M45 A;  2O3F A;  3K69 A;  3LAP A;  4XSZ F;  5HOO A;  4P5O A;  5D8L B;  2OQG A;  3NQO A;  2XAQ A;  3CUO A;  1PDN C;  4DQ2 A;  4LGW A;  4ZYG A;  1IXR C;  5AIP A;  3QPT A;  2W25 A;  1R58 A;  3WE3 A;  1XMA A;  2VOD A;  1GXQ A;  3E6M A;  1O7F A;  2H6B A;  1BI3 A;  4HZF A;  4RAZ A;  3EET A;  3SHF A;  3I59 B;  3KE2 A;  3HHG A;  3F72 A;  5D6E A;  4JBA A;  2LKP A;  5KVR A;  4G6Q A;  1REP C;  4RS8 A;  3DKW A;  2VT2 A;  2IA2 A;  2CFX A;  4HLY A;  1TW2 A;  4HX4 A;  1IF1 A;  2V1U A;  1ZGJ A;  1UFM A;  3WE2 A;  3FX3 A;  2EJR A;  1UHM A;  1TBX A;  4KFC A;  1T0F A;  1FYM A;  3EQL F;  5FGM A;  2EV5 A;  1FYK A;  2ACJ A;  4RGX A;  1XCB A;  3HRU A;  1MJ9 A;  4G7Z F;  5HDG A;  1H0M A;  2E1C A;  1JE8 A;  4FT8 A;  2YR2 A;  3V7S A;  1XGS A;  4M9Z A;  5ILS A;  2RVC A;  4ENN A;  3T8T A;  2QM3 A;  4A2U A;  2F2E A;  2XGX A;  5JFR A;  3U2R A;  1IN7 A;  2DPD A;  4I0B A;  4EJV A;  2O6G E;  1KQ0 A;  1S8N A;  3BJO A;  1Z1D A;  3F8C A;  4WX9 A;  3K2Z A;  1Z05 A;  2VBZ A;  1B59 A;  1SMT A;  1HKQ A;  5LGT A;  5F6F A;  4UNO A;  2X0L A;  4AD9 A;  1FOK A;  4IVN A;  1J9I A;  1K7A A;  3E6D A;  2ADU A;  3T5X A;  4A6E A;  4M74 A;  4L0Y B;  1P92 A;  1HQC A;  3BY6 A;  3O2P E;  2R3S A;  3F6O A;  3GF2 A;  4U7D A;  2EA4 A;  2IPQ X;  1SD7 A;  4HDU A;  1JGS A;  1SD4 A;  3BJ6 A;  1QGP A;  5FLX K;  1TQI A;  4KMF A;  2A69 F;  2BV6 A;  2NYX A;  3ZQ7 A;  4A0Z A;  3CUQ B;  3R61 A;  1FBQ A;  1BBY A;  3BRO A;  3DFG A;  4FHT A;  3F22 A;  4KIC A;  2X4H A;  3ULQ B;  5D4R A;  1JHF A;  5D8K B;  1I1S A;  1TNS A;  3FXR A;  1O3R A;  4MHG A;  1Z6T A;  2MH9 A;  3R0J A;  4BYY A;  3BPV A;  2OA4 A;  3E5U A;  3HSE A;  5CVI A;  2EFW A;  3H92 A;  1YQA A;  2EFP A;  4L5I A;  5LHG A;  2FU4 A;  3BZ6 A;  2K4B A;  4OIQ F;  1SD5 A;  3W6J B;  2ESN A;  1YLF A;  3LA7 A;  1T6S A;  3ROU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...