2LFBA

Homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
MARIDPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LFB1/HNF1 TRANSCRIPTION FACTOR
publication title The NMR solution structure of the non-classical homeodomain from the rat liver LFB1/HNF1 transcription factor.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Dna-binding
total genus 34
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lfbA00
2IBDA 1RESA 2NVTJ 3MKLA 1B8IA 4IHVA 3TEDA 1MH4A 4W97A 5K7HA 1LE8B 3BR3A 3WHCA 3RZDJ 4M3EA 2Y2ZA 1U8BA 1W0UA 5C4XJ 1GVDA 2RAEA 2TCTA 4D7MA 4BKXA 2ID3A 2Y9YA 4B1RA 1PUFA 1U9OA 1X58A 2MSYA 5GPCA 3S1QJ 2XGDA 1I50J 4MO7A 2R5YB 1ETOA 1BW5A 3SJMA 4RBOA 3BT9A 3OSGA 3I4NJ 4A3KJ 1YRNA 1S7EA 1ZGWA 2DA6A 1U78A 3S2HJ 3ZQFA 4BBSJ 4BY1J 2XRLA 5E3MA 2I10A 3CCYA 4M3FA 3FKIJ 1JKOC 2L7ZA 2HI3A 5FKKA 5J3LA 1ZTRA 1JJ8C 2WV1A 1IDYA 1FIPA 2NVYJ 3LOCA 3HM5A 4I6ZA 1FTTA 5F04A 1JUPA 3GTOJ 5F0HA 1JKPC 1GDTA 5FKNA 4J19A 4BY7J 2Y30A 4JP0A 1MBFA 4ABZA 3ZQLA 5F0FA 3DEWA 5IP6A 2W48A 3QQAA 1GT0C 1B72B 3Q0VA 3HBLA 3GTJJ 1SFOJ 2DMNA 2X48A 3BG3A 1ITYA 2YUSA 3JRDA 5C44J 1TWCJ 2XB5A 4IEJA 2CQXA 2D5VA 2EZLA 1GV5A 4DYQA 3TP3A 1HF0A 2DTZA 4GFBA 3NAUA 3FK7A 1QVTA 1JKRC 2HXOA 4A3BJ 2VPRA 1BW6A 1H89C 1ETWA 1EF4A 1VF9A 2E2HJ 4W1UA 4A3DJ 2M34A 3IH3A 5J1RA 1LE8A 5IYCJ 1MBGA 1TWGJ 2WB1N 2EZHA 2NOGA 1AKHB 1XC5A 3OOUA 3JRFA 1WH5A 4A3MJ 1OFCX 4G12A 2K40A 4AUXA 1QVUA 4MLOA 3O8GA 1MBKA 3OIOA 3GTGJ 1IDZA 2DMPA 2Y0SN 5DTDA 2HDDA 3JRIA 2M8GX 5K7FA 4RDUA 3Q0WA 2R5YA 2H8RA 5FKMA 3SFIA 3HOXJ 2L7MP 3F0CA 2COBA 3G1LA 1UMQA 1ETYA 4FE4A 5FLMJ 3GBGA 3VPRA 1T56A 2JA8J 2HOAA 4M3DA 5EEAA 1WPKA 5C3EJ 3K2AA 4UUSB 1ETQA 1O4XA 5E3OA 5IP7J 4A3IJ 3BR5A 3IH4A 1WI3A 3CQZJ 4JX4A 2JWTA 4S0HB 2HOTA 2DJNA 4X1EA 2P81A 4C3JJ 2LKXA 2EZIA 3HOZJ 5BNGA 1B72A 2JA7J 3M3YJ 1Y1VJ 1X2NA 2MG4A 1ETXA 3A01B 1ZR2A 1JTXA 5F1JA 2EBIA 1SANA 4L5EA 3H0GJ 2HOSA 4IHXA 2X6OA 2YS9A 5E3NA 2LVSA 2JMWA 1IC8A 3DCFA 2AHQA 3TP0A 5EGOB 3PO2J 2EQRA 4A3GJ 3JRHA 3JR9A 2CQQA 5M5XJ 2E2JJ 3JRAA 3WHBA 2XGEA 1FJLA 1ZKGA 1BA5A 3D1NI 3BQYA 3QPLA 2LD5A 2ECBA 3BR6A 2JK3A 2XGCA 4D5FA 1AKHA 1ETKA 3S1RJ 4X6AJ 5IOYA 1HOMA 3BR2A 5M5YJ 1F36A 3E7LA 2PMZN 4QIWN 3G1OA 2LFBA 3JRBA 3BG9A 1G2HA 1NTCA 2XSDC 2WAQN 1HDDC 4A93J 1OJLA 2OF7A 4DZPA 4DW6A 1MSEC 1JKQC 5EZGA 1WH7A 3MVPA 3BQZA 2DA7A 5HODA 4FTHA 4C3IJ 5J1YA 2VKVA 2K9NA 4UUSA 4I76A 2DA4A 2GLOA 2H1KA 4NDLA 2DA2A 3BTLA 5JLXA 3S1NJ 1Q1VA 3HOWJ 4XIDA 2TRTA 1MH3A 3S14J 1R9TJ 1AHDP 1NK2P 2XPWA 4M3GA 4HNVA 5FKOA 2R5ZB 4XRSG 2EZKA 1IRZA 3JREA 3HGGA 1Z77A 2R7ZJ 2E1OA 4XRSA 5EYRA 1A5JA 2LK2A 2GBYA 3FISA 4FISA 1ETVA 3HKZN 2AO9A 3BR0A 3A01A 3W6VA 1MBEA 1OCPA 4C3HJ 1NK3P 3LNQA 2NS8A 4A3JJ 4QTRA 1JTYA 1JT0A 3LSRA 3K7AJ 3G1MA 5FKLA 5JLWA 2CJJA 3PO3J 3BR1A 2XPVA 5EGOA 4Y7NJ 4JYKA 1QPIA 1K61A 2JA5J 4A3CJ 5IOZA 1RKWA 3ZQGA 2MGQA 2JJ7A 2FQ4A 1FIAA 5M3FJ 1VI0A 4CYCB 3ZQCA 2Y9ZA 2ME6A 4MFDA 2ZB9A 1GUUA 3I4MJ 1JGGA 4V2FA 5DS9A 2L0KA 4BXXJ 4A3EJ 2K9SA 2L9RA 2MW8A 1TWAJ 1JUMA 3B6AA 1JJ6C 1W0TA 4IHWA 4JX6A 2E2IJ 1AU7A 1RR7A 1HCRA 1DU0A 1ZR4A 1IJWC 3JRCA 4DYCA 5FJ8J 3CDLA 1FTZA 1GV2A 1VNDA 2M2EA 4QSHA 2FD5A 4C2MJ 1ZQ3P 3HDDA 1ORKA 3S17J 5K7ZA 2ID6A 5GP9A 2QF7A 2VKEA 1I6HJ 1LFUP 1IG7A 3Q0UA 2K9QA 5GPAA 2HXIA 4JX5A 3UKGA 3GTKJ 4XK4A 2LP0A 2O7OA 3BTJA 4M6VA 1FEXA 1JT6A 3GTQJ 3S16J 2R5ZA 1POGA 4IHYA 2LY9A 1F43A 3PM1A 1VFCA 4LOCA 1QRYA 2DN0A 3ZQHA 4AYBN 2G0EA 4XRMA 2R92J 1UHSA 3M4OJ 1TWHJ 2NS7A 4FCYA 2ELKA 1A6IA 5FLVA 5EDNA 2QCOA 3BG5A 4DZJA 4A69C 2XB0X 3GTMJ 3BTCA 2OPTA 5F27A 1K83J 3TW7A 5EG0B 3FIWA 4UUTA 3C2BA 5IYBJ 2YU9J 2KT0A 3HOUJ 2XPUA 1Y1WJ 1LFBA 2DA1A 2X9DA 4CYCA 2VUMJ 1XG1A 4B4CA 4D5CA 3CMYA 2CRGA 3S2DJ 3LSJA 1BJZA 2EH3A 4BBRJ 1HDPA 2IEKA 2O9LA 1RPWA 3Q3SA 2N8GA 1MBHA 3RKQA 1B8IB 3O8HA 5EF6A 1XS9A 5J1UA 1HLVA 5EZHA 2CUEA 2ECCA 5C4JJ 4D7NA 1IGNA 4Y52J 5F0CA 1E3OC 3GTLJ 4A3LJ 2HYJA 4M3BA 3LSGA 3QPSA 3B6CA 4AC0A 5M5WJ 3RZOJ 3GTPJ 3MN2A 1RETA 4DYRA 5IPAA 2DMQA 1PUFB 3SDGA 2NVQJ 2LR8A 4XICA 1APLC 3OSFA 1I3QJ 4V2GA 3A02A 1X2MA 1MNMC 4A3FJ 2NVXJ 2Y31A 3HEFA 3HOYJ 1WCMJ 3IH2A 5IP9J 3BTIA 3S1MJ 2ME0A 3HB9A 1YRNB 1P7IA 2M0CA 5F08A 3JRGA 2KDZA 3HGYA 3L1PA 1MSFC 1DU6A 2R0QC 2FX0A 1JUSA 2IAIA 1WGXA 2CUFA 1ZK8A 2JA6J 1U9NA 3RQIA 1BL0A 3A03A 3IV5A 2LTPA 1TC3C 3TW6A 2B63J 4MIMA 5IYDJ 3H3VK 1CQTA 4FE7A 4B3AA 1D5YA 4MFEA 5EG0A 2LLKA 1IV6A 1UG2A 2DA3A 2FJ1A 1IUFA 5M3MJ 2HQ5A 2O8KA 1RKTA 3FK6A 1TWFJ 1MBJA 1H8AC 3HOVJ 3ZOBA 2JN6A 3S15J 2DMTA 3ZQIA 1ENHA 5E3LA 4EEFG 2CU7A 2L7FP 2DA5A 9ANTA 1T33A 2M9HA 2GM4A 2VI6A 1P7JA 3LSPA 2E19A 1Z0XA 2DMUA 2R93J 3NARA 1OCTC 1H88C
chains in the Genus database with same CATH superfamily
4HDUA 3OYKA 4C9YA 4L5IA 5DD8A 1B8IA 2XRNA 2ZXHA 4ZDPA 3E0JB 4HA8A 4W97A 1Z3YA 4QPOA 4J00A 4S05A 5H20A 3BR3A 5FB2A 4NHJA 2IW5A 2XUBA 1FBSA 2Y2ZA 4M3EA 3CJTB 3DLLF 3PSFA 2QM3A 4ENMA 1ZRDA 2TCTA 4IPAA 1IRFA 4D7MA 1LPQA 4DQ2A 2ADUA 1BN5A 4ZYDA 4B1RA 3H35A 2DO7A 1PUFA 3HOTA 2LY2A 2DT7B 3B02A 1XDUA 2ZMEC 4BQAA 2R5YB 4XONA 3I53A 2K4JA 2QZ8A 5D5WB 4KMFA 3R0AA 2P8TA 3RQ4A 3GYHX 3BT9A 3VYTB 4A3KJ 1OCCH 4XM3A 1S7EA 2FMLA 3S2HJ 1MMGA 3ZQFA 4BY1J 5E3MA 5FLXK 1JKOC 2HI3A 4U0WA 2W7NA 1ODDA 1R4MB 5J3LA 1T0FA 4PFPA 4QPQA 4AIKA 1JJ8C 2ZKZA 1V5FA 3AFHA 2PMUA 4RB0A 1W36D 2X6YA 3H92A 1R36A 3HM5A 4QLCU 2IGOA 3BZCA 4NUBA 6PAXA 1FTTA 1JUPA 3GTOJ 2L4AA 5F0HA 5DUIA 1Z1DA 2HTSA 3FMRA 4LFUA 5F0FA 2FNPA 3Q0VA 2E36A 2DMNA 2X48A 2HPMA 4MHGA 4RAGA 1O3RA 2IS4A 3G71I 3KPHA 3MZYA 4L9JA 3GLXA 5HDGA 2GZWA 4I98B 2OTJI 1FLIA 2V26A 5EEGA 1QVTA 4FQGA 5HLGA 2IA0A 1H89C 3GW2A 4RAYA 3OS1A 1VF9A 3VYUB 4W1UA 3ZMDA 2EB7A 3BWGA 3SHFA 1YJWI 2EFOA 1SFUA 3A4CA 2KP6A 3NWTA 3LFKA 2WB1N 2EZHA 4Y15A 1AKHB 4A3MJ 1WH5A 5L3DA 4KT6A 5GTIC 4NNJA 1QVUA 2KFDA 4HX7A 2BY3A 1WQ2A 3OYBA 4EV0A 3GTGJ 4KJZA 2X1EA 4XSZF 2XAGA 3DKYA 5K7FA 3JRIA 5ICEA 2R7WA 4RDUA 2JPCA 2EIKH 3HTUA 1DGWY 1SD7A 3SFIA 4IOAF 2WA0A 4ZYGA 1ZLKA 5FLMJ 3GBGA 2IVMA 3VPRA 1IRXA 3IUOA 3RPQA 3ZXSA 2HOAA 4M3DA 5EEAA 3WGHA 2VT2A 1FC3A 4BDZA 1PVEA 1J2XA 3HSRA 3QWLA 1ZHFA 2DAOA 4JBAA 2FBHA 3BR5A 4XKCA 4A6DA 4XSXF 4JX4A 2NRAC 3VYSB 1RC9A 2BVLA 2VXDA 2MFZA 2X1DA 3ECOA 4S0HB 2HOTA 2DJNA 4X1EA 2ELJA 4C3JJ 1Z91A 4YIRX 1OCRH 2PLYA 5ICCA 5JI6A 5FLXZ 4HX8A 3MKZA 1B72A 3HJEA 5K5QA 4BNCA 3T8TA 1OR7C 2R3SA 2VOOA 3RCOA 4RLFA 1HW1A 1K4SA 3TKYA 4M6XA 1SANA 5LHHA 4L5EA 2E1NA 3H0GJ 4AIJA 1ON1A 4LGWA 2A6EF 4IHXA 3WE2A 2X6OA 4RA2A 2I8DA 2LVSA 2A3SA 3EPZA 3GMEA 4RB2C 3E5XA 3ZN0A 5BPIA 1MDMA 1SMTA 4R1HA 3JR9A 2ZFUA 5CPRB 3WHBA 2WTEA 2ZC2A 1FJLA 5J8FA 3ZR8X 2PFBA 4ZZLA 1ZKGA 2QA4I 2BBYA 4G6DA 1OCZH 5EEHA 5KVRA 2ECBA 4HQMA 1XCVA 3GVAA 2V9KA 1TP4A 3DFGA 1YS6A 3HUGA 4X6AJ 5IOYA 5BQTA 4KITB 2H27A 1LNWA 2F5EA 2Q2EA 1R5HA 3E7LA 3IKVA 3VWBA 3JRBA 2VLAA 3VOEA 3BG9A 3PQJA 4Y33A 1HDDC 3WTVC 3EETA 4WXDA 1OJLA 1BC7C 2O8XA 3G4SI 4DW6A 1JHFA 2PMZA 2O5RA 1IXSB 5EZGA 2PX9A 2Q8KA 2VJIA 4I0AA 2WAQA 1DQUA 2P5VA 3WU1B 2YR2A 2M45A 2OAZA 3BG7A 1HBXG 3BQZA 3PFYA 3G73A 5DEQA 2AQEA 2CW8A 5J1YA 2K9NA 1EA3A 2CO5A 3MMYB 4I76A 4UUSA 1T2KA 5JVGF 3DLAA 3FXUA 1RI7A 4U0VA 1Q1VA 3HOWJ 2YU3A 2DYSH 3S14J 1WJDA 2COMA 2FEZA 2DQLA 3OL3A 2XPWA 4M71A 1G4DA 5FKOA 2R5ZB 3HPGA 2FE3A 3HXLA 1IRZA 1IN6A 1MIJA 2DJIA 3K69A 3HGGA 1TZLA 2XHKA 1BR2A 1K6OA 2W4SA 3FKJA 5LBQA 3F21A 2GBYA 3D5SC 3FXKA 3WU0A 5C4XJ 1OCPA 4M9SA 4C3HJ 1GXPA 3U2RA 2CG4A 5IT3A 4UY8I 2IT0A 3OIPA 2KHMA 4KT5C 3K7AJ 2YX7A 4CHUA 2BY2A 5FKLA 4OIRF 2BV6A 3PO3J 1YX5A 4MEYF 2M4GA 2JA2A 3BR1A 4JYKA 4A3CJ 4LIUA 1T95A 4HX4A 5GAGJ 1WFXA 1CF7A 5FROA 1N77A 2MGQA 3G2BA 4LMYA 4BUPA 3F23A 2JJ7A 2FQ4A 2MLKA 2Y75A 5HOOA 4Z6YA 3K70D 5LRRA 1ZG1A 3KYCB 1JGGA 3KP6A 5LHGA 1FNNA 2VKDA 4FASD 4A3EJ 2FA5A 2MW8A 1JJ6C 3SFZA 1P9QC 1Z67A 2F4IA 3A0BC 1MZBA 1DU0A 1ULYA 2H8WA 4XQFA 4IQ4A 2XAUA 2F6CA 1FX7A 3I59B 2CYYA 1VNDA 3K2ZA 4XBFA 2GOMA 4C2MJ 3KP3A 3IP4B 1A04A 2L7KA 1ZQ3P 1G3SA 3DBRB 1FY7A 4CCNA 4HAMA 4UVAA 2K9LA 3OYNA 3HDDA 4D0PA 2NYXA 3FF5A 4YFNF 2K86A 1LDJA 1R5GA 2QF7A 3HC7A 4M6YA 4RGUA 1LFUP 1IG7A 2BVMA 3U9GA 3UKGA 1R5ID 4RGSA 1Z6TA 2F5FA 4HF2A 4KIGA 3M8JA 1JE8A 1N75A 2F2EA 3S16J 4F92B 1S72I 2QQBA 3OYDA 1LDKB 3CCUI 4GGGA 1UG0A 1QRYA 3ZQHA 2VE8A 4YELA 2ZJQF 1X4OA 2V6CA 2W00A 4CUGA 3M4OJ 1SVMA 1TWHJ 2EV6A 3G3ZA 5A2QK 2W24A 1A6IA 3CCLI 2QCOA 2RREA 3BG5A 2DU9A 3QYEA 4A69C 4Q47A 2XF5A 1R71A 1TQIA 2KIMA 1ON2A 4XLHA 3TMOA 2LBFA 2V9VA 2Z2SB 1MJBA 3E6MA 5D5XB 1HW2A 3FIWA 1O3QA 2YU9J 2KT0A 2KDOA 3CZ6A 1Y1WJ 1IN4A 5TRDA 2PEXA 5DM6F 2X9DA 2QUFA 4CYCA 1ZELA 2FSWA 4NBQA 3E5UA 3F6OA 3S93A 2L9VA 4LB5A 4L5JA 1VQMI 2IPQX 2B0LA 4XKVA 3EUAA 1A36A 4CGZA 2OZ6A 3C3WA 4B3XA 1Z05A 1KU7A 2IEKA 4U88A 4N4OB 1VQ6I 1WZ2A 4F91B 4HSTA 1WI9A 1YE9A 1MNDA 5J1UA 5EZHA 1IGNA 3H0DA 2GA2A 1YITI 3F8MA 4Y52J 1DP3A 3GTLJ 2Z9OA 3QPSA 3B6CA 3PFIA 5ICFA 2CV1A 3ZMTA 3HOSA 2V7FA 3ECHA 1RETA 1QZZA 3J7AO 2LKSA 1LUJB 3B73A 2DMQA 3SDGA 1APLC 4XKBA 2M7AA 2QENA 1DP7P 3QAHA 2FXAA 2A07F 2KRHA 2CS3A 2NVXJ 1G3YA 4HQEA 2JUCA 2MH2A 4BEHB 3HOYJ 4B09A 1WCMJ 2IJLA 2R7TA 5ILVA 2CFOA 3IAM2 1OR7A 5L3EA 4ITVA 1IXRC 1KQ0A 4Y17A 2FX0A 4OWRB 3L1PA 2GA1A 1U8RA 2IAIA 3H3UA 1R58A 5DD4A 1OYYA 1ZK8A 2JA6J 2HVQA 2KLOA 3A03A 2FMYA 4EJUA 3IV5A 2QBYA 1ZARA 2D45A 4ESBA 2R7UA 2B63J 4XL9A 2GWRA 4I0BA 3VSKA 2AXTC 4GRIA 3K4BA 1R22A 4MFEA 4G7HF 2QQAA 3ABUA 2ZNYA 3R4KA 3V7CA 3AL0B 3IAS2 2DA3A 4CDGA 2IXSA 5M3MJ 5A2QZ 1NHAA 1RKTA 2BYVE 1MBJA 3L9FA 2JN6A 3BJOA 3BJAA 3ASNH 3ERED 5FO5A 3ZQIA 1K78B 4K2EA 3DU5A 1B59A 3L7WA 2L7FP 1DPRA 5H6QA 1IF1A 2M9HA 4IVNA 4PGGA 1X1PA 2HKOA 3LSPA 4DJAA 3CO6C 2DMUA 3NARA 1OCTC 1MKMA 5E1ZB 2IBDA 1YX3A 3NWSA 1QQIA 2VQHA 5LGNA 3LA2A 3MKLA 3S3MA 3JTHA 4GYGA 2H1LA 3TEDA 1FYKA 1SVOA 1W5TA 1RUOA 2NXNB 3R6SA 1RIOH 3S17J 3K9TA 2RGVA 1H0MA 3VFZA 4RAZA 2KL4A 2RV8A 1GVDA 1N25A 1KA8A 3SDBA 5IY5H 4BKXA 4ESJA 1XTAA 2MD0A 2Y9YA 3N05A 5AIPA 3QOEA 4DOZA 3EDPA 4Z2YA 1U9OA 3ELKA 5GPCA 3FDYA 4EVIA 5CVRA 3MKWB 2MBFA 2MC3A 1I50J 3PIOF 1FOYA 2M1BA 2DW4A 4MO7A 1TT0A 4MTDA 3V42A 4OMZA 3HPHA 4C30A 1ETOA 3FXLA 1ZAOA 1X3UA 4HF0A 2E1CA 2DI3A 2DK5A 3WTWC 4RBOA 1XPXA 3I4NJ 3WTUC 2AQFA 1YRNA 1ZGWA 3KLOA 1U78A 4LITA 4BAYA 5F6FA 4BBSJ 2HYFA 4CZCA 1VQ5I 1D8JA 2DOEA 2WY8Q 3S3NA 2DPDA 4ENKA 2VASA 3KP4A 2X6XA 4AIHA 3NRVA 3W2WA 2JZYA 2NVYJ 3BCAA 3TQNA 3OS2A 4OMYA 3K0LA 2QQ8A 2V4JC 2DQRA 3GFJA 4XOTA 1JKPC 1GDTA 2EV5A 3CUQA 4BY7J 1IO2A 2Y30A 4JP0A 4ABZA 4BH9A 4LJZF 3QQAA 3I56I 2IA2A 1E2XA 3GTJJ 3FXOA 3QYBA 2O0YA 4HDVA 2CW0F 2D5VA 5CLSA 5TISC 4A12A 4CZZA 4DYQA 3GFLA 3ZMZA 1HF0A 5KCMA 1R00A 2HKXA 3CJRB 2HNHA 4GFBA 1SAUA 4O3MA 2VONA 4D1QA 1PDNC 1WJFA 2HXOA 4WXCA 1JKRC 2VPRA 3GX4X 1ETWA 3EUKL 4XORA 1XMKA 2EFQA 3EQLF 4G9YA 4PK4A 1LE8A 2OD5A 5IYCJ 3L2VA 3DTKA 1LVKA 1UAAA 3DPTA 5FFZA 1R7JA 1SFEA 3JRFA 4G12A 4PCQA 2K40A 2OCEA 3QU6A 5DCMA 4MLOA 2QEXI 3K4KA 3OIOA 4JOMA 2EJRA 2TDXA 2O6GE 1BBYA 4WK8F 1P4XA 1HC8A 2IGKA 2M8GX 3H36A 2OJED 2VB6A 3Q0WA 3M7GA 3HZJA 1RZ4A 2HDCA 2L7MP 3DF8A 2COBA 3G1LA 3QOPA 5D8KB 3FM3A 3E97A 1UMQA 1YQAA 3AL0C 3BZKA 2PQ8A 2VBXA 4E7SA 4YIIA 1T56A 2JA8J 2CQ7A 1WPKA 3RSNA 1X19A 1XN7A 1UB9A 1N78A 1ETQA 1JGSA 2O03A 5E3OA 1O4XA 2XKOA 4Q48A 3IH4A 1WI3A 2BXZA 1IN7A 3H5NA 3FMQA 3PUFA 3PQKA 3W6KB 2JVGA 3PIPF 2DODA 4L9TA 3LAJA 2EZIA 1I1SA 1R1TA 3J80Z 2E35A 1V3FA 1Y1VJ 2LY1A 1X2NA 2MG4A 2A6TA 1XGNA 2XVCA 4C2TA 1T08B 1U5TA 3FXJA 1ZR2A 3LAPA 1YI2I 4I02A 1G8XA 3IHUA 1XGOA 4JQFA 5D5UB 3UR3C 2EFNA 3WGIA 1YHQI 2HOSA 2YS9A 2GAUA 1LJ9A 2W57A 3ABMH 5LFAA 3GFIA 5E79C 2AHQA 5LD2C 1HA8A 1FP2A 2R7OA 3JRHA 3RI4A 3CC7I 3JRAA 2GOXB 2KZVA 4CICA 5L3CA 3NEUA 2X6WA 3P9CA 5LGTA 3D1NI 1D1AA 2PBIA 1H9GA 2LD5A 4RB3C 2XDVA 1JI8A 1W36C 3KZYA 1ETKA 3S1RJ 3ABTA 4P55A 5BS6A 1HOMA 3BR2A 3TO7A 4IHTA 1F36A 3OMYA 3PNVA 2PMZN 3G1OA 2OUMA 3AG3H 3P7NA 2WAQN 1XSVA 2XKPA 4A93J 2BOLA 3VDXA 1ZRCA 3M8FA 2BZTA 4R79A 2B9SA 4GXOA 1UELB 1JKQC 2QKMB 3KYDB 2VBYA 5CVUA 5DUKA 2RQQA 1WH7A 3KIOA 4XOPA 1G3WA 3MVPA 1REPC 3LA7A 5LRSA 1VQ7I 1JXSA 4IRIA 4C3IJ 2HQAA 2EWNA 2GLOA 4G7ZF 4M73A 2DA2A 3EYIA 4JK1X 5TJJA 3DBLB 2TRTA 5E18F 3LSTA 4RGRA 1R9TJ 2ZXIA 3DWLE 4M9XA 4PSWA 5BMZA 2DK8A 2OBPA 2H6CA 2HU9A 4NQWA 3E6CC 2NAZA 2IP2A 1ZH5A 1Z77A 4XKWA 4G6QA 2EFWA 1WKMA 1X4PA 4NC6A 5EYRA 2LK2A 3FISA 1EF4A 3HKZN 2AO9A 3BJ6A 3A01A 4A5NA 1MBEA 4B48A 3W6VA 4LG3A 5KNLA 3LNQA 2E1MB 2MD5A 4A3JJ 2L01A 3KZZA 4QTRA 4CCLA 1JTYA 2HVSA 2WV0A 3V4GA 3P9IA 4E70A 1USSA 5FD6A 3I0TA 1QHGA 2IGMA 1HW5A 3MFKA 2XGXA 5EGOA 1D0ZA 3RIRA 1A6QA 4Y7NJ 1QPIA 2YX4A 5D4SA 5IOZA 4ENJA 3ZQGA 5HS9A 2BXYA 2XASA 1W7PA 3ERMA 2WAEA 3IWZA 1EKEA 2J5OA 1Y6IA 4RMNA 4YIFA 3ZQCA 1X1BA 2BY0A 2ME6A 1O57A 1V4RA 2ZB9A 1W4MA 2PG4A 4V2FA 4BXXJ 4UVCA 1TWAJ 3B6AA 4IHWA 2DT5A 3FZVA 3GZ6A 5HNHA 1VZ0A 3OR1C 1RR7A 1AU7A 1S7OA 4BJ5C 4C2UA 2CMPA 3C2HA 3RKYA 4UNOA 3PUBA 2BW3B 1G6NA 3FXRA 4PJ0C 4DYCA 5FJ8J 3JRCA 1IJWC 1IAWA 5B66C 1FTZA 1GV2A 3ZMUA 2M2EA 1T6SA 2H6BA 1GLNA 3R0JA 5CVJA 1ORKA 1S9HA 2RN7A 2KJBA 2ELHA 3EUHC 3NQOA 5GP9A 5KHDA 1YW8A 4HLYA 4YEJA 1I6HJ 2G7HA 1V55H 1JHHA 2Z99A 4JX5A 4IJAA 1M1EB 2LP0A 4M6VA 4HZFA 5AIQA 4A6EA 1UCRA 4HNTA 4ZZDA 1SFXA 3C1DA 2CW7A 1POGA 3W2AA 2IGNA 4WCGA 3KEYA 3PM1A 3MZHA 2DN0A 1R4NB 2G9WA 2G0EA 2QWWA 2UZKA 2ZCWA 2DFEA 3OS0A 3O2PE 4LG0B 3A1YA 1L0OC 1LKXA 4UXNA 2O3FA 4LK1F 2E7WA 2V1NA 4AYBA 4U7DA 2JQ7A 3HSFA 2ELKA 2GQQA 1BI1A 2M4KA 2Z3YA 1FP1D 2XB0X 5LEKA 3FX3A 2KQRA 1TQMA 4CH7A 2GXGA 3HTSB 3F6VA 3FBIB 3BTCA 3T5XA 3HIFA 3TW7A 1Y0NA 5EG0B 1STZA 1SAXA 4PJLA 1XD7A 5CKTA 3AKZA 1Y8QB 3ABLH 2MH9A 4UUTA 5IYBJ 3K1MA 3HOUJ 1EH6A 2RNJA 1BIBA 4A5MA 4XLFA 3CC4I 3DXJF 1XG1A 1XX5A 4B4CA 2XAFA 1TQPA 3KZIC 3QODA 4P1WA 4E7KA 3CMYA 3OYGA 1Y8RB 2BEOA 3BROA 2CRGA 1E17A 2W85A 2DPUA 4Y3OA 3LSJA 2EH3A 1FBQA 2CQNA 2O9LA 2M5WA 1QZYA 1RPWA 3ZPLA 4ZYAA 4H0EA 4MQVA 4XLNF 5ICGA 3RKQA 1B8IB 4UB8C 4RM2A 1XS9A 1FPQA 4KIBA 2CUEA 5C4JJ 2GIZA 1I5ZA 3BPXA 3LSGA 2DBBA 3U21A 2FBKA 5M5WJ 2E1MC 3RZOJ 3GTPJ 3SZTA 2MYSA 3MN2A 5JHUA 4P5OA 5IPAA 1PUFB 3BG6A 3KCCA 3M8EA 1PP8F 3BP8A 3CLOA 4XICA 1YW7A 1Z3XA 2M3AA 3MKYB 3OSFA 2E5NA 4V2GA 1WSUA 3HKZA 4IXAA 5E17F 4FT8A 1CGPA 2A5YB 1X2MA 3C18A 4MGRA 2F5DA 5TGTA 5JVTA 1W5SA 1RUNA 3L2CA 1BOBA 5EJCA 4BU2A 2Y31A 3K70C 3FBNB 2ZNZA 3BTIA 4AVZA 2VN2A 4UB6C 2GIVA 2M0CA 1OLTA 1D8KA 3DQVC 3HGYA 3SYTA 3ESWB 4EQQA 1JUSA 1WHUA 2HZTA 3OYHA 3RQIA 1QHHD 5KAFC 3M1CA 3PNYA 5IYDJ 2EILH 1TW2A 4E7LA 4KISA 2ZMEA 1F9NA 2P6SA 2XAQA 3WTSC 4IZZA 4A0YA 3MEXA 2LLKA 2CWEA 3RYPA 3T8RA 4YRVA 3KEOA 4Q4ZF 2XV4S 1H9TA 1IUFA 1TNTA 2RVCA 4OAYA 4P9FA 2HQ5A 3HOVJ 3D5RC 3WG7H 1DPUA 4CCJA 2RKHA 4YFKF 2DMTA 4BXFA 1MJ9A 3OYEA 4FHTA 4EJVA 2VBWA 1YS7A 5E3LA 2WADA 3X2QH 4EEFG 2CU7A 4N4NB 5JHFA 4ZTJA 1YLFA 3CTAA 4M74A 2GM4A 5J8CA 1FT9A 2R93J 2E5ZA 1J59A 2MABA 2KKOA 5DM7F 1BJAA 2HS5A 1KQ8A 1TW3A 1MH4A 3QP5A 4PDKA 4IX7A 3I54A 2ESNA 1XMAA 1AA7A 1HKQA 1SC7A 2G7UA 2M87A 3WHCA 1U8BA 3AG4H 5B3SH 1YO5C 1W0UA 1L3LA 2ZO4A 4BL0B 5IT9K 1GXQA 3EYYA 4BXUA 2P5LC 3T1BA 1QGPA 1VQLI 1A31A 2C6YA 3H9GA 4CO8A 2FU4A 4B44A 1IN5A 2F4OB 3J7ZI 1NG7A 2QKLB 4HF1A 2V6EA 2KRCA 1BOAA 3OSGA 2YPRA 4PGHA 3QP6A 2DA6A 4KUMA 3CLQA 2XRLA 1ACIA 4M3FA 2JT1A 2QYOA 1SMYF 1X1CA 1MMAA 3L2UA 3FMSA 3BC8A 1ZTRA 4EATA 2K4BA 2QSHX 1KU9A 2LMDA 3C7JA 3V8JA 1KQ9A 2J5PA 2WWYA 3LOCA 2Z1DA 3JAMK 1S6LA 4UUVA 3WU2C 1G59A 1MBFA 4KA4A 1VQ9I 1D3YA 3DEWA 3CCEI 1GT0C 1B72B 1SFOJ 3R60A 3BG3A 2YUSA 4HV5A 3HRMA 5J4VA 2PJRA 3L2WA 1D0XA 1R6RA 1TWCJ 2WAFA 2XB5A 3OWTA 4EMSA 4HOBA 4AM3A 1GV5A 4IKFA 2VODA 1Z21A 1IZ1A 2LNBA 2FOKA 3W6JB 2ETHA 4XRFA 2V1UA 3FK7A 2O61A 2HQRA 4A0XA 5FD5A 2DCEA 5HS8A 3CD6I 1RNLA 4A3BJ 1MDMB 2E2HJ 3IWFA 2M34A 5J1RA 3ULQB 3ASOH 3OV8A 3D0SA 4I2OA 1TWGJ 4P9UA 2NOGA 1XC5A 3OOUA 1OFCX 3HUGB 1T0FC 4ON0A 4X0GA 1J5YA 2Q2EB 4P96A 1MBKA 2F5VA 1IDZA 2Y0SN 5DTDA 4G8XA 2Q1ZB 4PSXA 2MLGA 5FFXA 5FGMA 3OYMA 2R5YA 3FM5A 1LEAA 4PZJA 2R7SA 2KZGA 3QU3A 2Z5UA 4F7ZA 1ETYA 2K85A 5IT9Z 3ZP5A 1SD6A 2XROA 2X0LA 2BGCA 2A5WA 5BOXA 4DGWB 4GDFA 2ZXJA 4IRGA 3CCMI 3DV8A 3K2AA 4ZJZA 4UUSB 2UUZA 3F8BA 3RDIA 1UFMA 4G94A 2Y0MA 4TV7A 5AONA 3BCBA 4H4KC 3PL8A 3DKXA 5E8GA 1OCOH 4EM2A 2EINH 4IF4A 4XLPF 4ZH4F 3T0YA 2LKXA 4XMYA 5HLTA 1HKTA 2I5UA 2V1DA 1YIJI 1ZREA 2EIJH 3CC2I 2JA7J 2KRFA 4L0YB 1HQCA 1F1ZA 3F9KA 3LSKA 1WWXA 3CMAI 3RKXA 1VQPI 3DP7A 1JTXA 3FHZA 5F1JA 2EBIA 3CCRI 1MMSA 1J0RA 2HWVA 4CSWA 4BACA 1USTA 2OU2A 1FMWA 4IRHA 2CSOA 4GCVA 3TO9A 2KMUA 3KFWX 5CVVA 4MTEA 5E3NA 3RKWA 1IC8A 2CV2A 1WJ5A 3TP0A 4CCOA 2EQRA 2CQQA 1WJAA 4G6TB 5M5XJ 2E2JJ 2GXBA 4AD9A 1CF7B 2JPBA 3FXMA 4OIPF 4PJNA 1RR8C 3CCSI 3BQYA 1ZN2A 1ZGJA 4Y13A 2Y48A 3BR6A 2JK3A 2XAJA 1AKHA 2BE5F 1FYLA 4N9IA 1FWZA 2UXXA 3BLYA 3Q9VA 1EH7A 1W7PD 4BE0A 3K4LA 1BR1A 2EIMH 5M5YJ 1SFKA 1IUYA 3MWMA 1HXDA 3K6GA 4QIWN 1LFPA 2LFBA 1G2HA 1NTCA 4KDPA 3W3CA 3H5AA 3TL4X 2CH0A 3CMMA 5JFRA 4HRIA 4DZPA 3REOA 3PSIA 3JSOA 1BI0A 3TGNA 2NVUB 1TL8A 4DBQA 1TLHB 2VOPA 2DA7A 3MCZA 5HODA 3K4MA 2ZJ2A 5KK1A 5GADJ 1T98A 3OL4A 5HDNA 2AS5F 4FTHA 1PJRA 1Y39A 2W25A 2E60A 2VKVA 1K7AA 3E6DA 4NDLA 3V7RA 4FX0A 2R7FA 5J47A 3RYRA 4LD5A 3BTLA 5JLXA 3I9V2 3S1NJ 2VBZA 4XIDA 2JVHA 2ZJPF 1MH3A 2BY1A 1AHDP 1QPMA 1P6RA 1YG2A 2DOAA 2NOJB 5HLHA 4IO9F 4M3GA 4HNVA 3OYJA 3CJNA 1QBJA 4XRSG 2NNYA 1PYVA 3I4PA 4WF2A 1ZGAA 5F1RA 1ZYRF 3DEEA 3JREA 2DXIA 2OZUA 3V8KA 3RTRA 1ZG5A 2XSJC 4LB6B 1ONVA 4PFOA 3SEQA 2R7ZJ 4HV6A 2Z16A 4HBLA 4BE1A 4EM1A 3LQQA 3S8PA 4CCMA 1AWCA 1ETVA 3BR0A 3CF5F 3E1SA 1O7FA 1TNSA 5LHIA 4ETSA 5L3FA 3KX2A 3LSRA 3HSEA 2OTLI 2ZSIB 2M7BA 2A6HF 4D9JA 1Y0UA 4E7JA 2CJJA 5B5EC 4PJJA 4A0ZA 1VQNI 2IS6A 2L2OA 1K61A 2LBFB 4Y4RA 3HYIA 2VE9A 2Y0SA 2DLLA 1VI0A 2ZFWA 3LWFA 4CYCB 3GUDA 3ZCOA 3K1PA 4CCKA 4MFDA 1BIAA 1GUUA 3I4MJ 5DS9A 2L0KA 3LMMA 4HW0A 1VQOI 3M9AA 1W0TA 1ZRFA 4JX6A 3QYFA 5D6EA 1B1BA 2K9MA 2QLZA 1HCRA 4NB5A 3LL7A 1ZR4A 1FSEA 1V5EA 1YTYA 5E20A 1VQ8I 2QQ9A 3SXYA 2H09A 2FD5A 3QPTA 1DDNA 4MEXF 2LRDA 3OY9A 3OOPA 4YFXF 3IL2A 3L2RA 3COAC 1SVLA 1KONA 1R1VA 4QWQA 5K7ZA 3BPVA 4ZC3A 1LB2A 4KYWA 3RPUA 4EJTA 1IXCA 3GXOA 2VJ4A 2DDBA 2V79A 3KYLA 1XSXA 3Q0UA 4E7ZA 3CMEI 2K9QA 5GPAA 1Z9CA 2HXIA 4BDYA 4HPQA 4XK4A 2O7OA 3BTJA 3GTKJ 2YSRA 3O6BB 1FEXA 1JT6A 1W1WE 1FYMA 3FHNA 3K1NA 2R5ZA 4RAFA 5HLIA 1R1UA 2A68F 5E1WA 4IHYA 2LY9A 2XAHA 4DIQA 5H6RA 2MA3A 1EV7A 1F43A 1VFCA 1B9MA 4AYBN 4EM0B 1WRJA 2R92J 2K3FA 1UHSA 3CP2A 4EGZA 1OYWA 4DNCA 1Z7LA 2HFHA 2OCCH 2QBYB 2LREA 4L18B 5EDNA 5FLVA 2KISA 4GYIA 4OIOF 2UWMA 3F8FA 2XC7A 4IHSA 3OYCA 1XCBA 3JSPA 2LH9A 1U6GA 5F27A 4ESFA 1O3TA 1K83J 5E1XA 1BM9A 4I7HA 2K3PA 2XPUA 1HSJA 4FX4A 3OYLA 2ZXWH 2DA1A 3ROUA 1DU6A 1P92A 1X3ZB 2EA2A 2VUMJ 3GWZA 4KNYA 4AU7A 1LDDA 4D5CA 3GLLA 3WODF 3S2DJ 1BJZA 2OA4A 1ERDA 3ZRGA 1HDPA 3CF2A 4GO1A 5J4YA 2M8EA 2L5QA 1XMXA 3M1EA 1KU2A 1B6AA 1S7AA 2W82A 2N8GA 3Q3SA 4LLGF 3WTTC 1AOYA 3KP5A 3O8HA 5EF6A 2HQNA 3D5LA 2CFXA 1HLVA 3ZMSA 2ECCA 4D7NA 3I59A 4M72A 3GO5A 4I99C 3CCJI 5F0CA 4AIDA 1E3OC 4A3LJ 2HYJA 3ZQ7A 4BYYA 4ZYEA 1YW9A 3ZN1A 2L9SA 2MC4A 2EV0A 4CYDA 2NVQJ 3J81K 3E5QA 1YFHA 2VPLA 5K5RA 3DTEA 1B4AA 3K10A 2R7RA 2VKHA 2VIXA 1MNMC 1MD0A 1EJ9A 2X85A 3BY6A 3HEFA 4OIQF 3IH2A 5IP9J 3S1MJ 3WTXC 1YRNB 2RQPA 3FXQA 1UHMA 3HB9A 3PJRA 3C2GA 1P7IA 4S04A 2HTJA 2KDZA 1MSFC 1K4TA 4ENNA 1QNTA 3MZ8A 4MNUA 2Z33A 4EJOA 1J09A 3GCMA 3HL2A 2CUFA 4A2UA 2DT6A 4F93B 1MMNA 1XB4A 2W1OA 4BHPA 3TW6A 3I5UA 4MIMA 1U2WA 3H3VK 3BZ6A 1S8NA 4FE7A 4EJWA 1D5YA 1IW7F 3F8NA 1S5LC 4KICA 3CUQB 2OQGA 3F72A 1FOXA 1HKSA 4HLXA 2LF8A 2FJ1A 2K27A 1RRJA 1QO0D 3ISPA 2O8KA 3CESA 1TWFJ 3ZOBA 3S15J 4MQ9F 2OC6A 1KGSA 2KIQA 2R7DA 3F3XA 4XLAA 4EGYA 2K5CA 1LQ1A 2VI6A 1P7JA 5E8IA 4YG2F 1Z6RA 2JRMA 4OU0A 1H88C 2PI0A 3ZMVA 4ZYHA 1RESA 2QSGX 2NVTJ 2XIGA 4IHVA 1T39A 2FQ3A 1NG6A 5K7HA 1LE8B 3GFMA 5D4RA 3U1DA 4BHCA 3RZDJ 5DCFA 3CJQB 1R49A 1QZEA 4I09A 4XNFA 5GAEJ 1WJEA 3E3VA 2RAEA 3VODA 3P5JA 2VL8A 5DCMB 3OIQA 3W2VA 2ID3A 5KAIC 1MGTA 2F4MB 1X58A 2MSYA 3S1QJ 1FOWA 1SD5A 2XGDA 4LLNA 1I39A 1BC8C 1GVJA 4O6JA 2STWA 3ML6A 1BW5A 2E71A 3ABKH 1Z7UA 2PJPA 3SJMA 4BEHA 2K02A 1ZG3A 1B9NA 2R4GA 1YOVB 2HZDA 2I10A 3CCYA 3FKIJ 1XDSA 2W84A 3J81Z 2L7ZA 3BDDA 5HNFA 3K4CA 5FKKA 5LGUA 3TO6A 1C0WA 2AXLA 2WV1A 1IDYA 2ACJA 3MAJA 1DUXC 1FIPA 4O5VA 4BE2A 2P6TA 1WJBA 4I6ZA 4UHTA 5F04A 1K79A 5CJ9A 5FKNA 4J19A 4OOIA 1BI3A 2NS0A 2DFIA 3ZQLA 4CA0A 5IP6A 4ANJA 2W48A 4WX9A 1QU3A 3HBLA 1LEBA 3LSIA 4G7OF 1ITYA 4BHBA 4Q5SF 3JRDA 5C44J 4IEJA 5K1YA 1U5TB 2CQXA 4PUSA 2EZLA 4FETA 3TP3A 2ISZA 1K78A 3VSLA 2DTZA 3K4JA 1W5CC 3VYRB 2CUZA 1S29A 2ZJRF 3NAUA 1YIOA 3QPHA 2VC1A 1BW6A 3LSMA 2RC4A 4IOCF 4A3DJ 1DGRM 3IH3A 2IS1A 3H9QA 4BJ6C 2R7QA 1MBGA 2P5KA 5CQEA 3J7YJ 4AUXA 2ESHA 2L4MA 4BJTA 3CCVI 3VB2A 1GHCA 5LLQA 3O8GA 2LYCA 2DFFA 4NC7A 5ILUA 2WB1A 2DMPA 1J75A 2HDDA 4DBRA 3CO7C 2A61A 3OYAA 2M30A 2EK5A 2JTVA 2H8RA 5FKMA 1Q1HA 3CDIA 4E4HA 3CUQC 3HOXJ 3F0CA 3TOAA 2FF4A 4FE4A 5GAHJ 4BQOA 4KFCA 4F55A 4KIFA 3V7SA 1X3WB 5C3EJ 3WTZA 4U87A 5DDGA 2LOOA 2F5CA 1EH8A 4XLEA 2QVOA 2LDUA 2EFPA 5IP7J 1U0JA 4A3IJ 4ASNA 1WVRA 2L54A 2GXAA 4KMUX 3CQZJ 3S32A 2JWTA 1OKRA 2H94A 2EPFA 3P9KA 5F64A 5CQGA 2P81A 3HOZJ 4NQWB 1R23A 1UHWA 1I6XA 4L9VA 5BNGA 2WC2A 2ICWG 4IQJA 1MJAA 1QA6A 1TT5B 5DV5A 3M3YJ 2CV0A 3OR2C 3KETA 2E34A 4B47A 1ETXA 2JRTA 2VXZA 3R61A 3A01B 3SZGA 3AAFA 4HNUA 3QRFF 2HDWA 3CUOA 3Q5FA 3Q9SA 2RNGA 1D0YA 4U0YA 2HPIA 2LG4A 2L9NA 1U3EM 2JMWA 5HVQC 1VQ4I 3DCFA 3IRRA 5EGOB 3PO2J 2KPMA 4A3GJ 2ISYA 3OYFA 2UV1A 2XGEA 3ZGKA 1W7PB 1BA5A 5HS7A 2VT3A 3QPLA 3CP8A 4II3A 2L3DA 4B43A 3G6EI 2XGCA 4D5FA 3I64A 3DKWA 1A35A 3JCUC 2VJ5A 3K4NA 2F48A 3ONQA 4LK0F 2R7XA 1XGSA 2DOFA 1F5TA 4I01A 3F22A 5ED4A 2VC0A 2XSDC 1V5GA 2VQCA 4F52A 2K7LA 2OF7A 2IRFG 2M0MA 4WXHA 5FRMA 4F3QA 1MSEC 1P4AA 1E3PA 2D1VA 4L9NA 2CQKA 2KIFA 5HDKA 2A69F 1U5TC 3VEPA 1X1DA 3AG1H 2H1KA 2BHZA 2DA4A 3H9JA 3MD2A 1TBXA 4XLCA 3L2QA 3RJPA 1G3TA 3A0HC 2IA1A 1HSTA 4BS9A 1ZLJA 1O3SA 1NK2P 4UV9A 3RPUD 1E0EA 2LC2A 3WGGA 3GF2A 5DYMA 3WE3A 2PMHA 1MNEA 2EZKA 1SD4A 1NH3A 3TDZC 1D1CA 2QGUA 2P7VB 2FUG2 2E1OA 4BGDA 4XRSA 1A5JA 5B1BH 1P2FA 1OYIA 3ZQQA 4FISA 4XN3A 4BQQA 2JUGA 1NK3P 2STTA 3SEZA 2NS8A 1T38A 1K6YA 4LLLA 3FWEA 3EUHA 1I27A 1KYWA 4HG2A 1JT0A 2D1HA 2L02A 5D8LB 3KEQA 3G1MA 1KU3A 2HYGD 5JLWA 4RB1A 1J9IA 3I71A 1X1AA 2XPVA 1WJCA 2JA5J 1YJ9I 3WG9A 3DBHB 5H2FC 1RKWA 3LFUA 4M9ZA 2HEOA 3I55I 1FIAA 5M3FJ 4B8XA 2KJCA 2Y9ZA 1KZHA 4L0ZB 1OMIA 3S3OA 2QSFX 5LEJA 3IKTA 3DU6A 2K9SA 2L9RA 3M07A 4PJMA 1JUMA 4WWCA 4ZDLA 2DYRH 1VQKI 2CUJA 3DTIA 2KIUA 2E2IJ 3SQNA 3N97A 1Y56A 4E7IA 4UV8A 5J6XA 3H3ZA 1VTNC 1FOKA 1YJNI 4II2A 2V1XA 2X51A 4HYEA 2Y69H 2XF7A 3BOQA 3CDLA 1I1GA 2WBMA 4QSHA 1O7LA 3A2KA 3TBIA 3H5RA 1UJ8A 3JAMZ 5GTHC 2ID6A 1IRGA 2EA4A 4HEA2 2VKEA 3HHHA 2IS2A 4OAZA 3U1KA 3LA3A 1T8IA 1FMVA 2FBIA 5L3BA 1OPCA 3TDUC 5JR3A 1I3AA 5ILSA 2HVRA 3O3KA 3GTQJ 4RS8A 2LSOA 4XN0A 2HGCA 2HOEA 4ZDOA 1IN8A 3L00A 4LOCA 3KP2A 2VQLA 4XRMA 4E7HA 3KLNA 3WTYC 2BHYA 1F4KA 5J40A 2NS7A 1P4WA 3GZNB 1MMDA 2A05A 4FCYA 4DZJA 3CCQI 4IL6C 2DFHA 4V19K 2FNAA 5B1AH 2ZMEB 3GTMJ 2OPTA 2RDPA 4J01A 2UXNA 3LQRA 2FOWA 4HSRA 1TTYA 2OQRA 3C2BA 3DPLC 1FZPB 5FRNA 1BI2A 2X1CA 1LFBA 4AVPA 4R8HA 3HRSA 4UVBA 2P7CB 3OYIA 3J80K 1D5VA 3JTGA 1V54H 2OV7A 1LVAA 2WY7Q 5ERIA 3H1CA 1PUEE 3KE2A 4U7BA 3PNTA 4BBRJ 2JSPA 5D5VB 1OQYA 1MBHA 2LKPA 3GEZA 3IRQA 4ZTFA 5CYVA 2V9PA 4N0BA 4LIVA 2BW3A 2X4HA 4RM3A 3I58A 1FSHA 5D6FA 2JSCA 3IC7A 2PN6A 3L09A 3J7AY 4M3BA 4BQNA 5L3GA 4AC0A 2VQGA 4CXFA 1BR4A 4DYRA 2P0WA 2LF7A 2NNNA 3N4MA 2DTRA 2LR8A 1XGMA 5CVIA 1I3QJ 3A02A 2CGPA 2ZBKA 3E6BA 3HRTA 3SZPA 3S2WA 1XSDA 3V8LA 4A3FJ 1S3JA 3DPUA 1MW7A 2ME0A 1E3HA 2E7XA 5K5OA 5F08A 3JRGA 1SEUA 2R7VA 2R0QC 5BPDA 4RLQA 3UNGC 2Q0OA 1WGXA 4LG0A 2D2WA 1U9NA 3HRUA 1BL0A 3DEUA 2LTPA 1TC3C 2B7EA 1CQTA 4B3AA 2HR3A 1J7KA 4E6KG 5EG0A 1IV6A 3JW4A 3HG9A 4NC8A 1KYZA 1UG2A 1PP7U 4XR6A 3F8CA 3MQ0A 2XF6A 1OISA 3GZ5A 1IV8A 2PJRB 1H8AC 3FK6A 2ZSHB 1D1BA 1ENHA 3KP7A 4KN7X 3AG2H 2VJJA 3LSHA 3HHGA 1FBUA 2DDAA 1YYVA 4RGXA 3CDHA 2DA5A 4N9HA 3TOBA 9ANTA 1T33A 4OINF 1UZCA 2E19A 2P4WA 1Z0XA 3I3LA 2FRHA 4AWXB 4KN4X
chains in the Genus database with same CATH topology
2IBDA 1RESA 2NVTJ 3MKLA 1B8IA 4IHVA 3TEDA 1MH4A 4W97A 5K7HA 1LE8B 3BR3A 3WHCA 3RZDJ 4M3EA 2Y2ZA 1U8BA 1W0UA 5C4XJ 1GVDA 2RAEA 2TCTA 4D7MA 4BKXA 2ID3A 2Y9YA 4B1RA 1PUFA 1U9OA 1X58A 2MSYA 5GPCA 3S1QJ 2XGDA 1I50J 4MO7A 2R5YB 1ETOA 1BW5A 3SJMA 4RBOA 3BT9A 3OSGA 3I4NJ 4A3KJ 1YRNA 1S7EA 1ZGWA 2DA6A 1U78A 3S2HJ 3ZQFA 4BBSJ 4BY1J 2XRLA 5E3MA 2I10A 3CCYA 4M3FA 3FKIJ 1JKOC 2L7ZA 2HI3A 5FKKA 5J3LA 1ZTRA 1JJ8C 2WV1A 1IDYA 1FIPA 2NVYJ 3LOCA 3HM5A 4I6ZA 1FTTA 5F04A 1JUPA 3GTOJ 5F0HA 1JKPC 1GDTA 5FKNA 4J19A 4BY7J 2Y30A 4JP0A 1MBFA 4ABZA 3ZQLA 5F0FA 3DEWA 5IP6A 2W48A 3QQAA 1GT0C 1B72B 3Q0VA 3HBLA 3GTJJ 1SFOJ 2DMNA 2X48A 3BG3A 1ITYA 2YUSA 3JRDA 5C44J 1TWCJ 2XB5A 4IEJA 2CQXA 2D5VA 2EZLA 1GV5A 4DYQA 3TP3A 1HF0A 2DTZA 4GFBA 3NAUA 3FK7A 1QVTA 1JKRC 2HXOA 4A3BJ 2VPRA 1BW6A 1H89C 1ETWA 1EF4A 1VF9A 2E2HJ 4W1UA 4A3DJ 2M34A 3IH3A 5J1RA 1LE8A 5IYCJ 1MBGA 1TWGJ 2WB1N 2EZHA 2NOGA 1AKHB 1XC5A 3OOUA 3JRFA 1WH5A 4A3MJ 1OFCX 4G12A 2K40A 4AUXA 1QVUA 4MLOA 3O8GA 1MBKA 3OIOA 3GTGJ 1IDZA 2DMPA 2Y0SN 5DTDA 2HDDA 3JRIA 2M8GX 5K7FA 4RDUA 3Q0WA 2R5YA 2H8RA 5FKMA 3SFIA 3HOXJ 2L7MP 3F0CA 2COBA 3G1LA 1UMQA 1ETYA 4FE4A 5FLMJ 3GBGA 3VPRA 1T56A 2JA8J 2HOAA 4M3DA 5EEAA 1WPKA 5C3EJ 3K2AA 4UUSB 1ETQA 1O4XA 5E3OA 5IP7J 4A3IJ 3BR5A 3IH4A 1WI3A 3CQZJ 4JX4A 2JWTA 4S0HB 2HOTA 2DJNA 4X1EA 2P81A 4C3JJ 2LKXA 2EZIA 3HOZJ 5BNGA 1B72A 2JA7J 3M3YJ 1Y1VJ 1X2NA 2MG4A 1ETXA 3A01B 1ZR2A 1JTXA 5F1JA 2EBIA 1SANA 4L5EA 3H0GJ 2HOSA 4IHXA 2X6OA 2YS9A 5E3NA 2LVSA 2JMWA 1IC8A 3DCFA 2AHQA 3TP0A 5EGOB 3PO2J 2EQRA 4A3GJ 3JRHA 3JR9A 2CQQA 5M5XJ 2E2JJ 3JRAA 3WHBA 2XGEA 1FJLA 1ZKGA 1BA5A 3D1NI 3BQYA 3QPLA 2LD5A 2ECBA 3BR6A 2JK3A 2XGCA 4D5FA 1AKHA 1ETKA 3S1RJ 4X6AJ 5IOYA 1HOMA 3BR2A 5M5YJ 1F36A 3E7LA 2PMZN 4QIWN 3G1OA 2LFBA 3JRBA 3BG9A 1G2HA 1NTCA 2XSDC 2WAQN 1HDDC 4A93J 1OJLA 2OF7A 4DZPA 4DW6A 1MSEC 1JKQC 5EZGA 1WH7A 3MVPA 3BQZA 2DA7A 5HODA 4FTHA 4C3IJ 5J1YA 2VKVA 2K9NA 4UUSA 4I76A 2DA4A 2GLOA 2H1KA 4NDLA 2DA2A 3BTLA 5JLXA 3S1NJ 1Q1VA 3HOWJ 4XIDA 2TRTA 1MH3A 3S14J 1R9TJ 1AHDP 1NK2P 2XPWA 4M3GA 4HNVA 5FKOA 2R5ZB 4XRSG 2EZKA 1IRZA 3JREA 3HGGA 1Z77A 2R7ZJ 2E1OA 4XRSA 5EYRA 1A5JA 2LK2A 2GBYA 3FISA 4FISA 1ETVA 3HKZN 2AO9A 3BR0A 3A01A 3W6VA 1MBEA 1OCPA 4C3HJ 1NK3P 3LNQA 2NS8A 4A3JJ 4QTRA 1JTYA 1JT0A 3LSRA 3K7AJ 3G1MA 5FKLA 5JLWA 2CJJA 3PO3J 3BR1A 2XPVA 5EGOA 4Y7NJ 4JYKA 1QPIA 1K61A 2JA5J 4A3CJ 5IOZA 1RKWA 3ZQGA 2MGQA 2JJ7A 2FQ4A 1FIAA 5M3FJ 1VI0A 4CYCB 3ZQCA 2Y9ZA 2ME6A 4MFDA 2ZB9A 1GUUA 3I4MJ 1JGGA 4V2FA 5DS9A 2L0KA 4BXXJ 4A3EJ 2K9SA 2L9RA 2MW8A 1TWAJ 1JUMA 3B6AA 1JJ6C 1W0TA 4IHWA 4JX6A 2E2IJ 1AU7A 1RR7A 1HCRA 1DU0A 1ZR4A 1IJWC 3JRCA 4DYCA 5FJ8J 3CDLA 1FTZA 1GV2A 1VNDA 2M2EA 4QSHA 2FD5A 4C2MJ 1ZQ3P 3HDDA 1ORKA 3S17J 5K7ZA 2ID6A 5GP9A 2QF7A 2VKEA 1I6HJ 1LFUP 1IG7A 3Q0UA 2K9QA 5GPAA 2HXIA 4JX5A 3UKGA 3GTKJ 4XK4A 2LP0A 2O7OA 3BTJA 4M6VA 1FEXA 1JT6A 3GTQJ 3S16J 2R5ZA 1POGA 4IHYA 2LY9A 1F43A 3PM1A 1VFCA 4LOCA 1QRYA 2DN0A 3ZQHA 4AYBN 2G0EA 4XRMA 2R92J 1UHSA 3M4OJ 1TWHJ 2NS7A 4FCYA 2ELKA 1A6IA 5FLVA 5EDNA 2QCOA 3BG5A 4DZJA 4A69C 2XB0X 3GTMJ 3BTCA 2OPTA 5F27A 1K83J 3TW7A 5EG0B 3FIWA 4UUTA 3C2BA 5IYBJ 2YU9J 2KT0A 3HOUJ 2XPUA 1Y1WJ 1LFBA 2DA1A 2X9DA 4CYCA 2VUMJ 1XG1A 4B4CA 4D5CA 3CMYA 2CRGA 3S2DJ 3LSJA 1BJZA 2EH3A 4BBRJ 1HDPA 2IEKA 2O9LA 1RPWA 3Q3SA 2N8GA 1MBHA 3RKQA 1B8IB 3O8HA 5EF6A 1XS9A 5J1UA 1HLVA 5EZHA 2CUEA 2ECCA 5C4JJ 4D7NA 1IGNA 4Y52J 5F0CA 1E3OC 3GTLJ 4A3LJ 2HYJA 4M3BA 3LSGA 3QPSA 3B6CA 4AC0A 5M5WJ 3RZOJ 3GTPJ 3MN2A 1RETA 4DYRA 5IPAA 2DMQA 1PUFB 3SDGA 2NVQJ 2LR8A 4XICA 1APLC 3OSFA 1I3QJ 4V2GA 3A02A 1X2MA 1MNMC 4A3FJ 2NVXJ 2Y31A 3HEFA 3HOYJ 1WCMJ 3IH2A 5IP9J 3BTIA 3S1MJ 2ME0A 3HB9A 1YRNB 1P7IA 2M0CA 5F08A 3JRGA 2KDZA 3HGYA 3L1PA 1MSFC 1DU6A 2R0QC 2FX0A 1JUSA 2IAIA 1WGXA 2CUFA 1ZK8A 2JA6J 1U9NA 3RQIA 1BL0A 3A03A 3IV5A 2LTPA 1TC3C 3TW6A 2B63J 4MIMA 5IYDJ 3H3VK 1CQTA 4FE7A 4B3AA 1D5YA 4MFEA 5EG0A 2LLKA 1IV6A 1UG2A 2DA3A 2FJ1A 1IUFA 5M3MJ 2HQ5A 2O8KA 1RKTA 3FK6A 1TWFJ 1MBJA 1H8AC 3HOVJ 3ZOBA 2JN6A 3S15J 2DMTA 3ZQIA 1ENHA 5E3LA 4EEFG 2CU7A 2L7FP 2DA5A 9ANTA 1T33A 2M9HA 2GM4A 2VI6A 1P7JA 3LSPA 2E19A 1Z0XA 2DMUA 2R93J 3NARA 1OCTC 1H88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBD A;  1RES A;  2NVT J;  3MKL A;  1B8I A;  4IHV A;  3TED A;  1MH4 A;  4W97 A;  5K7H A;  1LE8 B;  3BR3 A;  3WHC A;  3RZD J;  4M3E A;  2Y2Z A;  1U8B A;  1W0U A;  5C4X J;  1GVD A;  2RAE A;  2TCT A;  4D7M A;  4BKX A;  2ID3 A;  2Y9Y A;  4B1R A;  1PUF A;  1U9O A;  1X58 A;  2MSY A;  5GPC A;  3S1Q J;  2XGD A;  1I50 J;  4MO7 A;  2R5Y B;  1ETO A;  1BW5 A;  3SJM A;  4RBO A;  3BT9 A;  3OSG A;  3I4N J;  4A3K J;  1YRN A;  1S7E A;  1ZGW A;  2DA6 A;  1U78 A;  3S2H J;  3ZQF A;  4BBS J;  4BY1 J;  2XRL A;  5E3M A;  2I10 A;  3CCY A;  4M3F A;  3FKI J;  1JKO C;  2L7Z A;  2HI3 A;  5FKK A;  5J3L A;  1ZTR A;  1JJ8 C;  2WV1 A;  1IDY A;  1FIP A;  2NVY J;  3LOC A;  3HM5 A;  4I6Z A;  1FTT A;  5F04 A;  1JUP A;  3GTO J;  5F0H A;  1JKP C;  1GDT A;  5FKN A;  4J19 A;  4BY7 J;  2Y30 A;  4JP0 A;  1MBF A;  4ABZ A;  3ZQL A;  5F0F A;  3DEW A;  5IP6 A;  2W48 A;  3QQA A;  1GT0 C;  1B72 B;  3Q0V A;  3HBL A;  3GTJ J;  1SFO J;  2DMN A;  2X48 A;  3BG3 A;  1ITY A;  2YUS A;  3JRD A;  5C44 J;  1TWC J;  2XB5 A;  4IEJ A;  2CQX A;  2D5V A;  2EZL A;  1GV5 A;  4DYQ A;  3TP3 A;  1HF0 A;  2DTZ A;  4GFB A;  3NAU A;  3FK7 A;  1QVT A;  1JKR C;  2HXO A;  4A3B J;  2VPR A;  1BW6 A;  1H89 C;  1ETW A;  1EF4 A;  1VF9 A;  2E2H J;  4W1U A;  4A3D J;  2M34 A;  3IH3 A;  5J1R A;  1LE8 A;  5IYC J;  1MBG A;  1TWG J;  2WB1 N;  2EZH A;  2NOG A;  1AKH B;  1XC5 A;  3OOU A;  3JRF A;  1WH5 A;  4A3M J;  1OFC X;  4G12 A;  2K40 A;  4AUX A;  1QVU A;  4MLO A;  3O8G A;  1MBK A;  3OIO A;  3GTG J;  1IDZ A;  2DMP A;  2Y0S N;  5DTD A;  2HDD A;  3JRI A;  2M8G X;  5K7F A;  4RDU A;  3Q0W A;  2R5Y A;  2H8R A;  5FKM A;  3SFI A;  3HOX J;  2L7M P;  3F0C A;  2COB A;  3G1L A;  1UMQ A;  1ETY A;  4FE4 A;  5FLM J;  3GBG A;  3VPR A;  1T56 A;  2JA8 J;  2HOA A;  4M3D A;  5EEA A;  1WPK A;  5C3E J;  3K2A A;  4UUS B;  1ETQ A;  1O4X A;  5E3O A;  5IP7 J;  4A3I J;  3BR5 A;  3IH4 A;  1WI3 A;  3CQZ J;  4JX4 A;  2JWT A;  4S0H B;  2HOT A;  2DJN A;  4X1E A;  2P81 A;  4C3J J;  2LKX A;  2EZI A;  3HOZ J;  5BNG A;  1B72 A;  2JA7 J;  3M3Y J;  1Y1V J;  1X2N A;  2MG4 A;  1ETX A;  3A01 B;  1ZR2 A;  1JTX A;  5F1J A;  2EBI A;  1SAN A;  4L5E A;  3H0G J;  2HOS A;  4IHX A;  2X6O A;  2YS9 A;  5E3N A;  2LVS A;  2JMW A;  1IC8 A;  3DCF A;  2AHQ A;  3TP0 A;  5EGO B;  3PO2 J;  2EQR A;  4A3G J;  3JRH A;  3JR9 A;  2CQQ A;  5M5X J;  2E2J J;  3JRA A;  3WHB A;  2XGE A;  1FJL A;  1ZKG A;  1BA5 A;  3D1N I;  3BQY A;  3QPL A;  2LD5 A;  2ECB A;  3BR6 A;  2JK3 A;  2XGC A;  4D5F A;  1AKH A;  1ETK A;  3S1R J;  4X6A J;  5IOY A;  1HOM A;  3BR2 A;  5M5Y J;  1F36 A;  3E7L A;  2PMZ N;  4QIW N;  3G1O A;  2LFB A;  3JRB A;  3BG9 A;  1G2H A;  1NTC A;  2XSD C;  2WAQ N;  1HDD C;  4A93 J;  1OJL A;  2OF7 A;  4DZP A;  4DW6 A;  1MSE C;  1JKQ C;  5EZG A;  1WH7 A;  3MVP A;  3BQZ A;  2DA7 A;  5HOD A;  4FTH A;  4C3I J;  5J1Y A;  2VKV A;  2K9N A;  4UUS A;  4I76 A;  2DA4 A;  2GLO A;  2H1K A;  4NDL A;  2DA2 A;  3BTL A;  5JLX A;  3S1N J;  1Q1V A;  3HOW J;  4XID A;  2TRT A;  1MH3 A;  3S14 J;  1R9T J;  1AHD P;  1NK2 P;  2XPW A;  4M3G A;  4HNV A;  5FKO A;  2R5Z B;  4XRS G;  2EZK A;  1IRZ A;  3JRE A;  3HGG A;  1Z77 A;  2R7Z J;  2E1O A;  4XRS A;  5EYR A;  1A5J A;  2LK2 A;  2GBY A;  3FIS A;  4FIS A;  1ETV A;  3HKZ N;  2AO9 A;  3BR0 A;  3A01 A;  3W6V A;  1MBE A;  1OCP A;  4C3H J;  1NK3 P;  3LNQ A;  2NS8 A;  4A3J J;  4QTR A;  1JTY A;  1JT0 A;  3LSR A;  3K7A J;  3G1M A;  5FKL A;  5JLW A;  2CJJ A;  3PO3 J;  3BR1 A;  2XPV A;  5EGO A;  4Y7N J;  4JYK A;  1QPI A;  1K61 A;  2JA5 J;  4A3C J;  5IOZ A;  1RKW A;  3ZQG A;  2MGQ A;  2JJ7 A;  2FQ4 A;  1FIA A;  5M3F J;  1VI0 A;  4CYC B;  3ZQC A;  2Y9Z A;  2ME6 A;  4MFD A;  2ZB9 A;  1GUU A;  3I4M J;  1JGG A;  4V2F A;  5DS9 A;  2L0K A;  4BXX J;  4A3E J;  2K9S A;  2L9R A;  2MW8 A;  1TWA J;  1JUM A;  3B6A A;  1JJ6 C;  1W0T A;  4IHW A;  4JX6 A;  2E2I J;  1AU7 A;  1RR7 A;  1HCR A;  1DU0 A;  1ZR4 A;  1IJW C;  3JRC A;  4DYC A;  5FJ8 J;  3CDL A;  1FTZ A;  1GV2 A;  1VND A;  2M2E A;  4QSH A;  2FD5 A;  4C2M J;  1ZQ3 P;  3HDD A;  1ORK A;  3S17 J;  5K7Z A;  2ID6 A;  5GP9 A;  2QF7 A;  2VKE A;  1I6H J;  1LFU P;  1IG7 A;  3Q0U A;  2K9Q A;  5GPA A;  2HXI A;  4JX5 A;  3UKG A;  3GTK J;  4XK4 A;  2LP0 A;  2O7O A;  3BTJ A;  4M6V A;  1FEX A;  1JT6 A;  3GTQ J;  3S16 J;  2R5Z A;  1POG A;  4IHY A;  2LY9 A;  1F43 A;  3PM1 A;  1VFC A;  4LOC A;  1QRY A;  2DN0 A;  3ZQH A;  4AYB N;  2G0E A;  4XRM A;  2R92 J;  1UHS A;  3M4O J;  1TWH J;  2NS7 A;  4FCY A;  2ELK A;  1A6I A;  5FLV A;  5EDN A;  2QCO A;  3BG5 A;  4DZJ A;  4A69 C;  2XB0 X;  3GTM J;  3BTC A;  2OPT A;  5F27 A;  1K83 J;  3TW7 A;  5EG0 B;  3FIW A;  4UUT A;  3C2B A;  5IYB J;  2YU9 J;  2KT0 A;  3HOU J;  2XPU A;  1Y1W J;  1LFB A;  2DA1 A;  2X9D A;  4CYC A;  2VUM J;  1XG1 A;  4B4C A;  4D5C A;  3CMY A;  2CRG A;  3S2D J;  3LSJ A;  1BJZ A;  2EH3 A;  4BBR J;  1HDP A;  2IEK A;  2O9L A;  1RPW A;  3Q3S A;  2N8G A;  1MBH A;  3RKQ A;  1B8I B;  3O8H A;  5EF6 A;  1XS9 A;  5J1U A;  1HLV A;  5EZH A;  2CUE A;  2ECC A;  5C4J J;  4D7N A;  1IGN A;  4Y52 J;  5F0C A;  1E3O C;  3GTL J;  4A3L J;  2HYJ A;  4M3B A;  3LSG A;  3QPS A;  3B6C A;  4AC0 A;  5M5W J;  3RZO J;  3GTP J;  3MN2 A;  1RET A;  4DYR A;  5IPA A;  2DMQ A;  1PUF B;  3SDG A;  2NVQ J;  2LR8 A;  4XIC A;  1APL C;  3OSF A;  1I3Q J;  4V2G A;  3A02 A;  1X2M A;  1MNM C;  4A3F J;  2NVX J;  2Y31 A;  3HEF A;  3HOY J;  1WCM J;  3IH2 A;  5IP9 J;  3BTI A;  3S1M J;  2ME0 A;  3HB9 A;  1YRN B;  1P7I A;  2M0C A;  5F08 A;  3JRG A;  2KDZ A;  3HGY A;  3L1P A;  1MSF C;  1DU6 A;  2R0Q C;  2FX0 A;  1JUS A;  2IAI A;  1WGX A;  2CUF A;  1ZK8 A;  2JA6 J;  1U9N A;  3RQI A;  1BL0 A;  3A03 A;  3IV5 A;  2LTP A;  1TC3 C;  3TW6 A;  2B63 J;  4MIM A;  5IYD J;  3H3V K;  1CQT A;  4FE7 A;  4B3A A;  1D5Y A;  4MFE A;  5EG0 A;  2LLK A;  1IV6 A;  1UG2 A;  2DA3 A;  2FJ1 A;  1IUF A;  5M3M J;  2HQ5 A;  2O8K A;  1RKT A;  3FK6 A;  1TWF J;  1MBJ A;  1H8A C;  3HOV J;  3ZOB A;  2JN6 A;  3S15 J;  2DMT A;  3ZQI A;  1ENH A;  5E3L A;  4EEF G;  2CU7 A;  2L7F P;  2DA5 A;  9ANT A;  1T33 A;  2M9H A;  2GM4 A;  2VI6 A;  1P7J A;  3LSP A;  2E19 A;  1Z0X A;  2DMU A;  2R93 J;  3NAR A;  1OCT C;  1H88 C; 
#chains in the Genus database with same CATH topology
 4HDU A;  3OYK A;  4C9Y A;  4L5I A;  5DD8 A;  1B8I A;  2XRN A;  2ZXH A;  4ZDP A;  3E0J B;  4HA8 A;  4W97 A;  1Z3Y A;  4QPO A;  4J00 A;  4S05 A;  5H20 A;  3BR3 A;  5FB2 A;  4NHJ A;  2IW5 A;  2XUB A;  1FBS A;  2Y2Z A;  4M3E A;  3CJT B;  3DLL F;  3PSF A;  2QM3 A;  4ENM A;  1ZRD A;  2TCT A;  4IPA A;  1IRF A;  4D7M A;  1LPQ A;  4DQ2 A;  2ADU A;  1BN5 A;  4ZYD A;  4B1R A;  3H35 A;  2DO7 A;  1PUF A;  3HOT A;  2LY2 A;  2DT7 B;  3B02 A;  1XDU A;  2ZME C;  4BQA A;  2R5Y B;  4XON A;  3I53 A;  2K4J A;  2QZ8 A;  5D5W B;  4KMF A;  3R0A A;  2P8T A;  3RQ4 A;  3GYH X;  3BT9 A;  3VYT B;  4A3K J;  1OCC H;  4XM3 A;  1S7E A;  2FML A;  3S2H J;  1MMG A;  3ZQF A;  4BY1 J;  5E3M A;  5FLX K;  1JKO C;  2HI3 A;  4U0W A;  2W7N A;  1ODD A;  1R4M B;  5J3L A;  1T0F A;  4PFP A;  4QPQ A;  4AIK A;  1JJ8 C;  2ZKZ A;  1V5F A;  3AFH A;  2PMU A;  4RB0 A;  1W36 D;  2X6Y A;  3H92 A;  1R36 A;  3HM5 A;  4QLC U;  2IGO A;  3BZC A;  4NUB A;  6PAX A;  1FTT A;  1JUP A;  3GTO J;  2L4A A;  5F0H A;  5DUI A;  1Z1D A;  2HTS A;  3FMR A;  4LFU A;  5F0F A;  2FNP A;  3Q0V A;  2E36 A;  2DMN A;  2X48 A;  2HPM A;  4MHG A;  4RAG A;  1O3R A;  2IS4 A;  3G71 I;  3KPH A;  3MZY A;  4L9J A;  3GLX A;  5HDG A;  2GZW A;  4I98 B;  2OTJ I;  1FLI A;  2V26 A;  5EEG A;  1QVT A;  4FQG A;  5HLG A;  2IA0 A;  1H89 C;  3GW2 A;  4RAY A;  3OS1 A;  1VF9 A;  3VYU B;  4W1U A;  3ZMD A;  2EB7 A;  3BWG A;  3SHF A;  1YJW I;  2EFO A;  1SFU A;  3A4C A;  2KP6 A;  3NWT A;  3LFK A;  2WB1 N;  2EZH A;  4Y15 A;  1AKH B;  4A3M J;  1WH5 A;  5L3D A;  4KT6 A;  5GTI C;  4NNJ A;  1QVU A;  2KFD A;  4HX7 A;  2BY3 A;  1WQ2 A;  3OYB A;  4EV0 A;  3GTG J;  4KJZ A;  2X1E A;  4XSZ F;  2XAG A;  3DKY A;  5K7F A;  3JRI A;  5ICE A;  2R7W A;  4RDU A;  2JPC A;  2EIK H;  3HTU A;  1DGW Y;  1SD7 A;  3SFI A;  4IOA F;  2WA0 A;  4ZYG A;  1ZLK A;  5FLM J;  3GBG A;  2IVM A;  3VPR A;  1IRX A;  3IUO A;  3RPQ A;  3ZXS A;  2HOA A;  4M3D A;  5EEA A;  3WGH A;  2VT2 A;  1FC3 A;  4BDZ A;  1PVE A;  1J2X A;  3HSR A;  3QWL A;  1ZHF A;  2DAO A;  4JBA A;  2FBH A;  3BR5 A;  4XKC A;  4A6D A;  4XSX F;  4JX4 A;  2NRA C;  3VYS B;  1RC9 A;  2BVL A;  2VXD A;  2MFZ A;  2X1D A;  3ECO A;  4S0H B;  2HOT A;  2DJN A;  4X1E A;  2ELJ A;  4C3J J;  1Z91 A;  4YIR X;  1OCR H;  2PLY A;  5ICC A;  5JI6 A;  5FLX Z;  4HX8 A;  3MKZ A;  1B72 A;  3HJE A;  5K5Q A;  4BNC A;  3T8T A;  1OR7 C;  2R3S A;  2VOO A;  3RCO A;  4RLF A;  1HW1 A;  1K4S A;  3TKY A;  4M6X A;  1SAN A;  5LHH A;  4L5E A;  2E1N A;  3H0G J;  4AIJ A;  1ON1 A;  4LGW A;  2A6E F;  4IHX A;  3WE2 A;  2X6O A;  4RA2 A;  2I8D A;  2LVS A;  2A3S A;  3EPZ A;  3GME A;  4RB2 C;  3E5X A;  3ZN0 A;  5BPI A;  1MDM A;  1SMT A;  4R1H A;  3JR9 A;  2ZFU A;  5CPR B;  3WHB A;  2WTE A;  2ZC2 A;  1FJL A;  5J8F A;  3ZR8 X;  2PFB A;  4ZZL A;  1ZKG A;  2QA4 I;  2BBY A;  4G6D A;  1OCZ H;  5EEH A;  5KVR A;  2ECB A;  4HQM A;  1XCV A;  3GVA A;  2V9K A;  1TP4 A;  3DFG A;  1YS6 A;  3HUG A;  4X6A J;  5IOY A;  5BQT A;  4KIT B;  2H27 A;  1LNW A;  2F5E A;  2Q2E A;  1R5H A;  3E7L A;  3IKV A;  3VWB A;  3JRB A;  2VLA A;  3VOE A;  3BG9 A;  3PQJ A;  4Y33 A;  1HDD C;  3WTV C;  3EET A;  4WXD A;  1OJL A;  1BC7 C;  2O8X A;  3G4S I;  4DW6 A;  1JHF A;  2PMZ A;  2O5R A;  1IXS B;  5EZG A;  2PX9 A;  2Q8K A;  2VJI A;  4I0A A;  2WAQ A;  1DQU A;  2P5V A;  3WU1 B;  2YR2 A;  2M45 A;  2OAZ A;  3BG7 A;  1HBX G;  3BQZ A;  3PFY A;  3G73 A;  5DEQ A;  2AQE A;  2CW8 A;  5J1Y A;  2K9N A;  1EA3 A;  2CO5 A;  3MMY B;  4I76 A;  4UUS A;  1T2K A;  5JVG F;  3DLA A;  3FXU A;  1RI7 A;  4U0V A;  1Q1V A;  3HOW J;  2YU3 A;  2DYS H;  3S14 J;  1WJD A;  2COM A;  2FEZ A;  2DQL A;  3OL3 A;  2XPW A;  4M71 A;  1G4D A;  5FKO A;  2R5Z B;  3HPG A;  2FE3 A;  3HXL A;  1IRZ A;  1IN6 A;  1MIJ A;  2DJI A;  3K69 A;  3HGG A;  1TZL A;  2XHK A;  1BR2 A;  1K6O A;  2W4S A;  3FKJ A;  5LBQ A;  3F21 A;  2GBY A;  3D5S C;  3FXK A;  3WU0 A;  5C4X J;  1OCP A;  4M9S A;  4C3H J;  1GXP A;  3U2R A;  2CG4 A;  5IT3 A;  4UY8 I;  2IT0 A;  3OIP A;  2KHM A;  4KT5 C;  3K7A J;  2YX7 A;  4CHU A;  2BY2 A;  5FKL A;  4OIR F;  2BV6 A;  3PO3 J;  1YX5 A;  4MEY F;  2M4G A;  2JA2 A;  3BR1 A;  4JYK A;  4A3C J;  4LIU A;  1T95 A;  4HX4 A;  5GAG J;  1WFX A;  1CF7 A;  5FRO A;  1N77 A;  2MGQ A;  3G2B A;  4LMY A;  4BUP A;  3F23 A;  2JJ7 A;  2FQ4 A;  2MLK A;  2Y75 A;  5HOO A;  4Z6Y A;  3K70 D;  5LRR A;  1ZG1 A;  3KYC B;  1JGG A;  3KP6 A;  5LHG A;  1FNN A;  2VKD A;  4FAS D;  4A3E J;  2FA5 A;  2MW8 A;  1JJ6 C;  3SFZ A;  1P9Q C;  1Z67 A;  2F4I A;  3A0B C;  1MZB A;  1DU0 A;  1ULY A;  2H8W A;  4XQF A;  4IQ4 A;  2XAU A;  2F6C A;  1FX7 A;  3I59 B;  2CYY A;  1VND A;  3K2Z A;  4XBF A;  2GOM A;  4C2M J;  3KP3 A;  3IP4 B;  1A04 A;  2L7K A;  1ZQ3 P;  1G3S A;  3DBR B;  1FY7 A;  4CCN A;  4HAM A;  4UVA A;  2K9L A;  3OYN A;  3HDD A;  4D0P A;  2NYX A;  3FF5 A;  4YFN F;  2K86 A;  1LDJ A;  1R5G A;  2QF7 A;  3HC7 A;  4M6Y A;  4RGU A;  1LFU P;  1IG7 A;  2BVM A;  3U9G A;  3UKG A;  1R5I D;  4RGS A;  1Z6T A;  2F5F A;  4HF2 A;  4KIG A;  3M8J A;  1JE8 A;  1N75 A;  2F2E A;  3S16 J;  4F92 B;  1S72 I;  2QQB A;  3OYD A;  1LDK B;  3CCU I;  4GGG A;  1UG0 A;  1QRY A;  3ZQH A;  2VE8 A;  4YEL A;  2ZJQ F;  1X4O A;  2V6C A;  2W00 A;  4CUG A;  3M4O J;  1SVM A;  1TWH J;  2EV6 A;  3G3Z A;  5A2Q K;  2W24 A;  1A6I A;  3CCL I;  2QCO A;  2RRE A;  3BG5 A;  2DU9 A;  3QYE A;  4A69 C;  4Q47 A;  2XF5 A;  1R71 A;  1TQI A;  2KIM A;  1ON2 A;  4XLH A;  3TMO A;  2LBF A;  2V9V A;  2Z2S B;  1MJB A;  3E6M A;  5D5X B;  1HW2 A;  3FIW A;  1O3Q A;  2YU9 J;  2KT0 A;  2KDO A;  3CZ6 A;  1Y1W J;  1IN4 A;  5TRD A;  2PEX A;  5DM6 F;  2X9D A;  2QUF A;  4CYC A;  1ZEL A;  2FSW A;  4NBQ A;  3E5U A;  3F6O A;  3S93 A;  2L9V A;  4LB5 A;  4L5J A;  1VQM I;  2IPQ X;  2B0L A;  4XKV A;  3EUA A;  1A36 A;  4CGZ A;  2OZ6 A;  3C3W A;  4B3X A;  1Z05 A;  1KU7 A;  2IEK A;  4U88 A;  4N4O B;  1VQ6 I;  1WZ2 A;  4F91 B;  4HST A;  1WI9 A;  1YE9 A;  1MND A;  5J1U A;  5EZH A;  1IGN A;  3H0D A;  2GA2 A;  1YIT I;  3F8M A;  4Y52 J;  1DP3 A;  3GTL J;  2Z9O A;  3QPS A;  3B6C A;  3PFI A;  5ICF A;  2CV1 A;  3ZMT A;  3HOS A;  2V7F A;  3ECH A;  1RET A;  1QZZ A;  3J7A O;  2LKS A;  1LUJ B;  3B73 A;  2DMQ A;  3SDG A;  1APL C;  4XKB A;  2M7A A;  2QEN A;  1DP7 P;  3QAH A;  2FXA A;  2A07 F;  2KRH A;  2CS3 A;  2NVX J;  1G3Y A;  4HQE A;  2JUC A;  2MH2 A;  4BEH B;  3HOY J;  4B09 A;  1WCM J;  2IJL A;  2R7T A;  5ILV A;  2CFO A;  3IAM 2;  1OR7 A;  5L3E A;  4ITV A;  1IXR C;  1KQ0 A;  4Y17 A;  2FX0 A;  4OWR B;  3L1P A;  2GA1 A;  1U8R A;  2IAI A;  3H3U A;  1R58 A;  5DD4 A;  1OYY A;  1ZK8 A;  2JA6 J;  2HVQ A;  2KLO A;  3A03 A;  2FMY A;  4EJU A;  3IV5 A;  2QBY A;  1ZAR A;  2D45 A;  4ESB A;  2R7U A;  2B63 J;  4XL9 A;  2GWR A;  4I0B A;  3VSK A;  2AXT C;  4GRI A;  3K4B A;  1R22 A;  4MFE A;  4G7H F;  2QQA A;  3ABU A;  2ZNY A;  3R4K A;  3V7C A;  3AL0 B;  3IAS 2;  2DA3 A;  4CDG A;  2IXS A;  5M3M J;  5A2Q Z;  1NHA A;  1RKT A;  2BYV E;  1MBJ A;  3L9F A;  2JN6 A;  3BJO A;  3BJA A;  3ASN H;  3ERE D;  5FO5 A;  3ZQI A;  1K78 B;  4K2E A;  3DU5 A;  1B59 A;  3L7W A;  2L7F P;  1DPR A;  5H6Q A;  1IF1 A;  2M9H A;  4IVN A;  4PGG A;  1X1P A;  2HKO A;  3LSP A;  4DJA A;  3CO6 C;  2DMU A;  3NAR A;  1OCT C;  1MKM A;  5E1Z B;  2IBD A;  1YX3 A;  3NWS A;  1QQI A;  2VQH A;  5LGN A;  3LA2 A;  3MKL A;  3S3M A;  3JTH A;  4GYG A;  2H1L A;  3TED A;  1FYK A;  1SVO A;  1W5T A;  1RUO A;  2NXN B;  3R6S A;  1RIO H;  3S17 J;  3K9T A;  2RGV A;  1H0M A;  3VFZ A;  4RAZ A;  2KL4 A;  2RV8 A;  1GVD A;  1N25 A;  1KA8 A;  3SDB A;  5IY5 H;  4BKX A;  4ESJ A;  1XTA A;  2MD0 A;  2Y9Y A;  3N05 A;  5AIP A;  3QOE A;  4DOZ A;  3EDP A;  4Z2Y A;  1U9O A;  3ELK A;  5GPC A;  3FDY A;  4EVI A;  5CVR A;  3MKW B;  2MBF A;  2MC3 A;  1I50 J;  3PIO F;  1FOY A;  2M1B A;  2DW4 A;  4MO7 A;  1TT0 A;  4MTD A;  3V42 A;  4OMZ A;  3HPH A;  4C30 A;  1ETO A;  3FXL A;  1ZAO A;  1X3U A;  4HF0 A;  2E1C A;  2DI3 A;  2DK5 A;  3WTW C;  4RBO A;  1XPX A;  3I4N J;  3WTU C;  2AQF A;  1YRN A;  1ZGW A;  3KLO A;  1U78 A;  4LIT A;  4BAY A;  5F6F A;  4BBS J;  2HYF A;  4CZC A;  1VQ5 I;  1D8J A;  2DOE A;  2WY8 Q;  3S3N A;  2DPD A;  4ENK A;  2VAS A;  3KP4 A;  2X6X A;  4AIH A;  3NRV A;  3W2W A;  2JZY A;  2NVY J;  3BCA A;  3TQN A;  3OS2 A;  4OMY A;  3K0L A;  2QQ8 A;  2V4J C;  2DQR A;  3GFJ A;  4XOT A;  1JKP C;  1GDT A;  2EV5 A;  3CUQ A;  4BY7 J;  1IO2 A;  2Y30 A;  4JP0 A;  4ABZ A;  4BH9 A;  4LJZ F;  3QQA A;  3I56 I;  2IA2 A;  1E2X A;  3GTJ J;  3FXO A;  3QYB A;  2O0Y A;  4HDV A;  2CW0 F;  2D5V A;  5CLS A;  5TIS C;  4A12 A;  4CZZ A;  4DYQ A;  3GFL A;  3ZMZ A;  1HF0 A;  5KCM A;  1R00 A;  2HKX A;  3CJR B;  2HNH A;  4GFB A;  1SAU A;  4O3M A;  2VON A;  4D1Q A;  1PDN C;  1WJF A;  2HXO A;  4WXC A;  1JKR C;  2VPR A;  3GX4 X;  1ETW A;  3EUK L;  4XOR A;  1XMK A;  2EFQ A;  3EQL F;  4G9Y A;  4PK4 A;  1LE8 A;  2OD5 A;  5IYC J;  3L2V A;  3DTK A;  1LVK A;  1UAA A;  3DPT A;  5FFZ A;  1R7J A;  1SFE A;  3JRF A;  4G12 A;  4PCQ A;  2K40 A;  2OCE A;  3QU6 A;  5DCM A;  4MLO A;  2QEX I;  3K4K A;  3OIO A;  4JOM A;  2EJR A;  2TDX A;  2O6G E;  1BBY A;  4WK8 F;  1P4X A;  1HC8 A;  2IGK A;  2M8G X;  3H36 A;  2OJE D;  2VB6 A;  3Q0W A;  3M7G A;  3HZJ A;  1RZ4 A;  2HDC A;  2L7M P;  3DF8 A;  2COB A;  3G1L A;  3QOP A;  5D8K B;  3FM3 A;  3E97 A;  1UMQ A;  1YQA A;  3AL0 C;  3BZK A;  2PQ8 A;  2VBX A;  4E7S A;  4YII A;  1T56 A;  2JA8 J;  2CQ7 A;  1WPK A;  3RSN A;  1X19 A;  1XN7 A;  1UB9 A;  1N78 A;  1ETQ A;  1JGS A;  2O03 A;  5E3O A;  1O4X A;  2XKO A;  4Q48 A;  3IH4 A;  1WI3 A;  2BXZ A;  1IN7 A;  3H5N A;  3FMQ A;  3PUF A;  3PQK A;  3W6K B;  2JVG A;  3PIP F;  2DOD A;  4L9T A;  3LAJ A;  2EZI A;  1I1S A;  1R1T A;  3J80 Z;  2E35 A;  1V3F A;  1Y1V J;  2LY1 A;  1X2N A;  2MG4 A;  2A6T A;  1XGN A;  2XVC A;  4C2T A;  1T08 B;  1U5T A;  3FXJ A;  1ZR2 A;  3LAP A;  1YI2 I;  4I02 A;  1G8X A;  3IHU A;  1XGO A;  4JQF A;  5D5U B;  3UR3 C;  2EFN A;  3WGI A;  1YHQ I;  2HOS A;  2YS9 A;  2GAU A;  1LJ9 A;  2W57 A;  3ABM H;  5LFA A;  3GFI A;  5E79 C;  2AHQ A;  5LD2 C;  1HA8 A;  1FP2 A;  2R7O A;  3JRH A;  3RI4 A;  3CC7 I;  3JRA A;  2GOX B;  2KZV A;  4CIC A;  5L3C A;  3NEU A;  2X6W A;  3P9C A;  5LGT A;  3D1N I;  1D1A A;  2PBI A;  1H9G A;  2LD5 A;  4RB3 C;  2XDV A;  1JI8 A;  1W36 C;  3KZY A;  1ETK A;  3S1R J;  3ABT A;  4P55 A;  5BS6 A;  1HOM A;  3BR2 A;  3TO7 A;  4IHT A;  1F36 A;  3OMY A;  3PNV A;  2PMZ N;  3G1O A;  2OUM A;  3AG3 H;  3P7N A;  2WAQ N;  1XSV A;  2XKP A;  4A93 J;  2BOL A;  3VDX A;  1ZRC A;  3M8F A;  2BZT A;  4R79 A;  2B9S A;  4GXO A;  1UEL B;  1JKQ C;  2QKM B;  3KYD B;  2VBY A;  5CVU A;  5DUK A;  2RQQ A;  1WH7 A;  3KIO A;  4XOP A;  1G3W A;  3MVP A;  1REP C;  3LA7 A;  5LRS A;  1VQ7 I;  1JXS A;  4IRI A;  4C3I J;  2HQA A;  2EWN A;  2GLO A;  4G7Z F;  4M73 A;  2DA2 A;  3EYI A;  4JK1 X;  5TJJ A;  3DBL B;  2TRT A;  5E18 F;  3LST A;  4RGR A;  1R9T J;  2ZXI A;  3DWL E;  4M9X A;  4PSW A;  5BMZ A;  2DK8 A;  2OBP A;  2H6C A;  2HU9 A;  4NQW A;  3E6C C;  2NAZ A;  2IP2 A;  1ZH5 A;  1Z77 A;  4XKW A;  4G6Q A;  2EFW A;  1WKM A;  1X4P A;  4NC6 A;  5EYR A;  2LK2 A;  3FIS A;  1EF4 A;  3HKZ N;  2AO9 A;  3BJ6 A;  3A01 A;  4A5N A;  1MBE A;  4B48 A;  3W6V A;  4LG3 A;  5KNL A;  3LNQ A;  2E1M B;  2MD5 A;  4A3J J;  2L01 A;  3KZZ A;  4QTR A;  4CCL A;  1JTY A;  2HVS A;  2WV0 A;  3V4G A;  3P9I A;  4E70 A;  1USS A;  5FD6 A;  3I0T A;  1QHG A;  2IGM A;  1HW5 A;  3MFK A;  2XGX A;  5EGO A;  1D0Z A;  3RIR A;  1A6Q A;  4Y7N J;  1QPI A;  2YX4 A;  5D4S A;  5IOZ A;  4ENJ A;  3ZQG A;  5HS9 A;  2BXY A;  2XAS A;  1W7P A;  3ERM A;  2WAE A;  3IWZ A;  1EKE A;  2J5O A;  1Y6I A;  4RMN A;  4YIF A;  3ZQC A;  1X1B A;  2BY0 A;  2ME6 A;  1O57 A;  1V4R A;  2ZB9 A;  1W4M A;  2PG4 A;  4V2F A;  4BXX J;  4UVC A;  1TWA J;  3B6A A;  4IHW A;  2DT5 A;  3FZV A;  3GZ6 A;  5HNH A;  1VZ0 A;  3OR1 C;  1RR7 A;  1AU7 A;  1S7O A;  4BJ5 C;  4C2U A;  2CMP A;  3C2H A;  3RKY A;  4UNO A;  3PUB A;  2BW3 B;  1G6N A;  3FXR A;  4PJ0 C;  4DYC A;  5FJ8 J;  3JRC A;  1IJW C;  1IAW A;  5B66 C;  1FTZ A;  1GV2 A;  3ZMU A;  2M2E A;  1T6S A;  2H6B A;  1GLN A;  3R0J A;  5CVJ A;  1ORK A;  1S9H A;  2RN7 A;  2KJB A;  2ELH A;  3EUH C;  3NQO A;  5GP9 A;  5KHD A;  1YW8 A;  4HLY A;  4YEJ A;  1I6H J;  2G7H A;  1V55 H;  1JHH A;  2Z99 A;  4JX5 A;  4IJA A;  1M1E B;  2LP0 A;  4M6V A;  4HZF A;  5AIQ A;  4A6E A;  1UCR A;  4HNT A;  4ZZD A;  1SFX A;  3C1D A;  2CW7 A;  1POG A;  3W2A A;  2IGN A;  4WCG A;  3KEY A;  3PM1 A;  3MZH A;  2DN0 A;  1R4N B;  2G9W A;  2G0E A;  2QWW A;  2UZK A;  2ZCW A;  2DFE A;  3OS0 A;  3O2P E;  4LG0 B;  3A1Y A;  1L0O C;  1LKX A;  4UXN A;  2O3F A;  4LK1 F;  2E7W A;  2V1N A;  4AYB A;  4U7D A;  2JQ7 A;  3HSF A;  2ELK A;  2GQQ A;  1BI1 A;  2M4K A;  2Z3Y A;  1FP1 D;  2XB0 X;  5LEK A;  3FX3 A;  2KQR A;  1TQM A;  4CH7 A;  2GXG A;  3HTS B;  3F6V A;  3FBI B;  3BTC A;  3T5X A;  3HIF A;  3TW7 A;  1Y0N A;  5EG0 B;  1STZ A;  1SAX A;  4PJL A;  1XD7 A;  5CKT A;  3AKZ A;  1Y8Q B;  3ABL H;  2MH9 A;  4UUT A;  5IYB J;  3K1M A;  3HOU J;  1EH6 A;  2RNJ A;  1BIB A;  4A5M A;  4XLF A;  3CC4 I;  3DXJ F;  1XG1 A;  1XX5 A;  4B4C A;  2XAF A;  1TQP A;  3KZI C;  3QOD A;  4P1W A;  4E7K A;  3CMY A;  3OYG A;  1Y8R B;  2BEO A;  3BRO A;  2CRG A;  1E17 A;  2W85 A;  2DPU A;  4Y3O A;  3LSJ A;  2EH3 A;  1FBQ A;  2CQN A;  2O9L A;  2M5W A;  1QZY A;  1RPW A;  3ZPL A;  4ZYA A;  4H0E A;  4MQV A;  4XLN F;  5ICG A;  3RKQ A;  1B8I B;  4UB8 C;  4RM2 A;  1XS9 A;  1FPQ A;  4KIB A;  2CUE A;  5C4J J;  2GIZ A;  1I5Z A;  3BPX A;  3LSG A;  2DBB A;  3U21 A;  2FBK A;  5M5W J;  2E1M C;  3RZO J;  3GTP J;  3SZT A;  2MYS A;  3MN2 A;  5JHU A;  4P5O A;  5IPA A;  1PUF B;  3BG6 A;  3KCC A;  3M8E A;  1PP8 F;  3BP8 A;  3CLO A;  4XIC A;  1YW7 A;  1Z3X A;  2M3A A;  3MKY B;  3OSF A;  2E5N A;  4V2G A;  1WSU A;  3HKZ A;  4IXA A;  5E17 F;  4FT8 A;  1CGP A;  2A5Y B;  1X2M A;  3C18 A;  4MGR A;  2F5D A;  5TGT A;  5JVT A;  1W5S A;  1RUN A;  3L2C A;  1BOB A;  5EJC A;  4BU2 A;  2Y31 A;  3K70 C;  3FBN B;  2ZNZ A;  3BTI A;  4AVZ A;  2VN2 A;  4UB6 C;  2GIV A;  2M0C A;  1OLT A;  1D8K A;  3DQV C;  3HGY A;  3SYT A;  3ESW B;  4EQQ A;  1JUS A;  1WHU A;  2HZT A;  3OYH A;  3RQI A;  1QHH D;  5KAF C;  3M1C A;  3PNY A;  5IYD J;  2EIL H;  1TW2 A;  4E7L A;  4KIS A;  2ZME A;  1F9N A;  2P6S A;  2XAQ A;  3WTS C;  4IZZ A;  4A0Y A;  3MEX A;  2LLK A;  2CWE A;  3RYP A;  3T8R A;  4YRV A;  3KEO A;  4Q4Z F;  2XV4 S;  1H9T A;  1IUF A;  1TNT A;  2RVC A;  4OAY A;  4P9F A;  2HQ5 A;  3HOV J;  3D5R C;  3WG7 H;  1DPU A;  4CCJ A;  2RKH A;  4YFK F;  2DMT A;  4BXF A;  1MJ9 A;  3OYE A;  4FHT A;  4EJV A;  2VBW A;  1YS7 A;  5E3L A;  2WAD A;  3X2Q H;  4EEF G;  2CU7 A;  4N4N B;  5JHF A;  4ZTJ A;  1YLF A;  3CTA A;  4M74 A;  2GM4 A;  5J8C A;  1FT9 A;  2R93 J;  2E5Z A;  1J59 A;  2MAB A;  2KKO A;  5DM7 F;  1BJA A;  2HS5 A;  1KQ8 A;  1TW3 A;  1MH4 A;  3QP5 A;  4PDK A;  4IX7 A;  3I54 A;  2ESN A;  1XMA A;  1AA7 A;  1HKQ A;  1SC7 A;  2G7U A;  2M87 A;  3WHC A;  1U8B A;  3AG4 H;  5B3S H;  1YO5 C;  1W0U A;  1L3L A;  2ZO4 A;  4BL0 B;  5IT9 K;  1GXQ A;  3EYY A;  4BXU A;  2P5L C;  3T1B A;  1QGP A;  1VQL I;  1A31 A;  2C6Y A;  3H9G A;  4CO8 A;  2FU4 A;  4B44 A;  1IN5 A;  2F4O B;  3J7Z I;  1NG7 A;  2QKL B;  4HF1 A;  2V6E A;  2KRC A;  1BOA A;  3OSG A;  2YPR A;  4PGH A;  3QP6 A;  2DA6 A;  4KUM A;  3CLQ A;  2XRL A;  1ACI A;  4M3F A;  2JT1 A;  2QYO A;  1SMY F;  1X1C A;  1MMA A;  3L2U A;  3FMS A;  3BC8 A;  1ZTR A;  4EAT A;  2K4B A;  2QSH X;  1KU9 A;  2LMD A;  3C7J A;  3V8J A;  1KQ9 A;  2J5P A;  2WWY A;  3LOC A;  2Z1D A;  3JAM K;  1S6L A;  4UUV A;  3WU2 C;  1G59 A;  1MBF A;  4KA4 A;  1VQ9 I;  1D3Y A;  3DEW A;  3CCE I;  1GT0 C;  1B72 B;  1SFO J;  3R60 A;  3BG3 A;  2YUS A;  4HV5 A;  3HRM A;  5J4V A;  2PJR A;  3L2W A;  1D0X A;  1R6R A;  1TWC J;  2WAF A;  2XB5 A;  3OWT A;  4EMS A;  4HOB A;  4AM3 A;  1GV5 A;  4IKF A;  2VOD A;  1Z21 A;  1IZ1 A;  2LNB A;  2FOK A;  3W6J B;  2ETH A;  4XRF A;  2V1U A;  3FK7 A;  2O61 A;  2HQR A;  4A0X A;  5FD5 A;  2DCE A;  5HS8 A;  3CD6 I;  1RNL A;  4A3B J;  1MDM B;  2E2H J;  3IWF A;  2M34 A;  5J1R A;  3ULQ B;  3ASO H;  3OV8 A;  3D0S A;  4I2O A;  1TWG J;  4P9U A;  2NOG A;  1XC5 A;  3OOU A;  1OFC X;  3HUG B;  1T0F C;  4ON0 A;  4X0G A;  1J5Y A;  2Q2E B;  4P96 A;  1MBK A;  2F5V A;  1IDZ A;  2Y0S N;  5DTD A;  4G8X A;  2Q1Z B;  4PSX A;  2MLG A;  5FFX A;  5FGM A;  3OYM A;  2R5Y A;  3FM5 A;  1LEA A;  4PZJ A;  2R7S A;  2KZG A;  3QU3 A;  2Z5U A;  4F7Z A;  1ETY A;  2K85 A;  5IT9 Z;  3ZP5 A;  1SD6 A;  2XRO A;  2X0L A;  2BGC A;  2A5W A;  5BOX A;  4DGW B;  4GDF A;  2ZXJ A;  4IRG A;  3CCM I;  3DV8 A;  3K2A A;  4ZJZ A;  4UUS B;  2UUZ A;  3F8B A;  3RDI A;  1UFM A;  4G94 A;  2Y0M A;  4TV7 A;  5AON A;  3BCB A;  4H4K C;  3PL8 A;  3DKX A;  5E8G A;  1OCO H;  4EM2 A;  2EIN H;  4IF4 A;  4XLP F;  4ZH4 F;  3T0Y A;  2LKX A;  4XMY A;  5HLT A;  1HKT A;  2I5U A;  2V1D A;  1YIJ I;  1ZRE A;  2EIJ H;  3CC2 I;  2JA7 J;  2KRF A;  4L0Y B;  1HQC A;  1F1Z A;  3F9K A;  3LSK A;  1WWX A;  3CMA I;  3RKX A;  1VQP I;  3DP7 A;  1JTX A;  3FHZ A;  5F1J A;  2EBI A;  3CCR I;  1MMS A;  1J0R A;  2HWV A;  4CSW A;  4BAC A;  1UST A;  2OU2 A;  1FMW A;  4IRH A;  2CSO A;  4GCV A;  3TO9 A;  2KMU A;  3KFW X;  5CVV A;  4MTE A;  5E3N A;  3RKW A;  1IC8 A;  2CV2 A;  1WJ5 A;  3TP0 A;  4CCO A;  2EQR A;  2CQQ A;  1WJA A;  4G6T B;  5M5X J;  2E2J J;  2GXB A;  4AD9 A;  1CF7 B;  2JPB A;  3FXM A;  4OIP F;  4PJN A;  1RR8 C;  3CCS I;  3BQY A;  1ZN2 A;  1ZGJ A;  4Y13 A;  2Y48 A;  3BR6 A;  2JK3 A;  2XAJ A;  1AKH A;  2BE5 F;  1FYL A;  4N9I A;  1FWZ A;  2UXX A;  3BLY A;  3Q9V A;  1EH7 A;  1W7P D;  4BE0 A;  3K4L A;  1BR1 A;  2EIM H;  5M5Y J;  1SFK A;  1IUY A;  3MWM A;  1HXD A;  3K6G A;  4QIW N;  1LFP A;  2LFB A;  1G2H A;  1NTC A;  4KDP A;  3W3C A;  3H5A A;  3TL4 X;  2CH0 A;  3CMM A;  5JFR A;  4HRI A;  4DZP A;  3REO A;  3PSI A;  3JSO A;  1BI0 A;  3TGN A;  2NVU B;  1TL8 A;  4DBQ A;  1TLH B;  2VOP A;  2DA7 A;  3MCZ A;  5HOD A;  3K4M A;  2ZJ2 A;  5KK1 A;  5GAD J;  1T98 A;  3OL4 A;  5HDN A;  2AS5 F;  4FTH A;  1PJR A;  1Y39 A;  2W25 A;  2E60 A;  2VKV A;  1K7A A;  3E6D A;  4NDL A;  3V7R A;  4FX0 A;  2R7F A;  5J47 A;  3RYR A;  4LD5 A;  3BTL A;  5JLX A;  3I9V 2;  3S1N J;  2VBZ A;  4XID A;  2JVH A;  2ZJP F;  1MH3 A;  2BY1 A;  1AHD P;  1QPM A;  1P6R A;  1YG2 A;  2DOA A;  2NOJ B;  5HLH A;  4IO9 F;  4M3G A;  4HNV A;  3OYJ A;  3CJN A;  1QBJ A;  4XRS G;  2NNY A;  1PYV A;  3I4P A;  4WF2 A;  1ZGA A;  5F1R A;  1ZYR F;  3DEE A;  3JRE A;  2DXI A;  2OZU A;  3V8K A;  3RTR A;  1ZG5 A;  2XSJ C;  4LB6 B;  1ONV A;  4PFO A;  3SEQ A;  2R7Z J;  4HV6 A;  2Z16 A;  4HBL A;  4BE1 A;  4EM1 A;  3LQQ A;  3S8P A;  4CCM A;  1AWC A;  1ETV A;  3BR0 A;  3CF5 F;  3E1S A;  1O7F A;  1TNS A;  5LHI A;  4ETS A;  5L3F A;  3KX2 A;  3LSR A;  3HSE A;  2OTL I;  2ZSI B;  2M7B A;  2A6H F;  4D9J A;  1Y0U A;  4E7J A;  2CJJ A;  5B5E C;  4PJJ A;  4A0Z A;  1VQN I;  2IS6 A;  2L2O A;  1K61 A;  2LBF B;  4Y4R A;  3HYI A;  2VE9 A;  2Y0S A;  2DLL A;  1VI0 A;  2ZFW A;  3LWF A;  4CYC B;  3GUD A;  3ZCO A;  3K1P A;  4CCK A;  4MFD A;  1BIA A;  1GUU A;  3I4M J;  5DS9 A;  2L0K A;  3LMM A;  4HW0 A;  1VQO I;  3M9A A;  1W0T A;  1ZRF A;  4JX6 A;  3QYF A;  5D6E A;  1B1B A;  2K9M A;  2QLZ A;  1HCR A;  4NB5 A;  3LL7 A;  1ZR4 A;  1FSE A;  1V5E A;  1YTY A;  5E20 A;  1VQ8 I;  2QQ9 A;  3SXY A;  2H09 A;  2FD5 A;  3QPT A;  1DDN A;  4MEX F;  2LRD A;  3OY9 A;  3OOP A;  4YFX F;  3IL2 A;  3L2R A;  3COA C;  1SVL A;  1KON A;  1R1V A;  4QWQ A;  5K7Z A;  3BPV A;  4ZC3 A;  1LB2 A;  4KYW A;  3RPU A;  4EJT A;  1IXC A;  3GXO A;  2VJ4 A;  2DDB A;  2V79 A;  3KYL A;  1XSX A;  3Q0U A;  4E7Z A;  3CME I;  2K9Q A;  5GPA A;  1Z9C A;  2HXI A;  4BDY A;  4HPQ A;  4XK4 A;  2O7O A;  3BTJ A;  3GTK J;  2YSR A;  3O6B B;  1FEX A;  1JT6 A;  1W1W E;  1FYM A;  3FHN A;  3K1N A;  2R5Z A;  4RAF A;  5HLI A;  1R1U A;  2A68 F;  5E1W A;  4IHY A;  2LY9 A;  2XAH A;  4DIQ A;  5H6R A;  2MA3 A;  1EV7 A;  1F43 A;  1VFC A;  1B9M A;  4AYB N;  4EM0 B;  1WRJ A;  2R92 J;  2K3F A;  1UHS A;  3CP2 A;  4EGZ A;  1OYW A;  4DNC A;  1Z7L A;  2HFH A;  2OCC H;  2QBY B;  2LRE A;  4L18 B;  5EDN A;  5FLV A;  2KIS A;  4GYI A;  4OIO F;  2UWM A;  3F8F A;  2XC7 A;  4IHS A;  3OYC A;  1XCB A;  3JSP A;  2LH9 A;  1U6G A;  5F27 A;  4ESF A;  1O3T A;  1K83 J;  5E1X A;  1BM9 A;  4I7H A;  2K3P A;  2XPU A;  1HSJ A;  4FX4 A;  3OYL A;  2ZXW H;  2DA1 A;  3ROU A;  1DU6 A;  1P92 A;  1X3Z B;  2EA2 A;  2VUM J;  3GWZ A;  4KNY A;  4AU7 A;  1LDD A;  4D5C A;  3GLL A;  3WOD F;  3S2D J;  1BJZ A;  2OA4 A;  1ERD A;  3ZRG A;  1HDP A;  3CF2 A;  4GO1 A;  5J4Y A;  2M8E A;  2L5Q A;  1XMX A;  3M1E A;  1KU2 A;  1B6A A;  1S7A A;  2W82 A;  2N8G A;  3Q3S A;  4LLG F;  3WTT C;  1AOY A;  3KP5 A;  3O8H A;  5EF6 A;  2HQN A;  3D5L A;  2CFX A;  1HLV A;  3ZMS A;  2ECC A;  4D7N A;  3I59 A;  4M72 A;  3GO5 A;  4I99 C;  3CCJ I;  5F0C A;  4AID A;  1E3O C;  4A3L J;  2HYJ A;  3ZQ7 A;  4BYY A;  4ZYE A;  1YW9 A;  3ZN1 A;  2L9S A;  2MC4 A;  2EV0 A;  4CYD A;  2NVQ J;  3J81 K;  3E5Q A;  1YFH A;  2VPL A;  5K5R A;  3DTE A;  1B4A A;  3K10 A;  2R7R A;  2VKH A;  2VIX A;  1MNM C;  1MD0 A;  1EJ9 A;  2X85 A;  3BY6 A;  3HEF A;  4OIQ F;  3IH2 A;  5IP9 J;  3S1M J;  3WTX C;  1YRN B;  2RQP A;  3FXQ A;  1UHM A;  3HB9 A;  3PJR A;  3C2G A;  1P7I A;  4S04 A;  2HTJ A;  2KDZ A;  1MSF C;  1K4T A;  4ENN A;  1QNT A;  3MZ8 A;  4MNU A;  2Z33 A;  4EJO A;  1J09 A;  3GCM A;  3HL2 A;  2CUF A;  4A2U A;  2DT6 A;  4F93 B;  1MMN A;  1XB4 A;  2W1O A;  4BHP A;  3TW6 A;  3I5U A;  4MIM A;  1U2W A;  3H3V K;  3BZ6 A;  1S8N A;  4FE7 A;  4EJW A;  1D5Y A;  1IW7 F;  3F8N A;  1S5L C;  4KIC A;  3CUQ B;  2OQG A;  3F72 A;  1FOX A;  1HKS A;  4HLX A;  2LF8 A;  2FJ1 A;  2K27 A;  1RRJ A;  1QO0 D;  3ISP A;  2O8K A;  3CES A;  1TWF J;  3ZOB A;  3S15 J;  4MQ9 F;  2OC6 A;  1KGS A;  2KIQ A;  2R7D A;  3F3X A;  4XLA A;  4EGY A;  2K5C A;  1LQ1 A;  2VI6 A;  1P7J A;  5E8I A;  4YG2 F;  1Z6R A;  2JRM A;  4OU0 A;  1H88 C;  2PI0 A;  3ZMV A;  4ZYH A;  1RES A;  2QSG X;  2NVT J;  2XIG A;  4IHV A;  1T39 A;  2FQ3 A;  1NG6 A;  5K7H A;  1LE8 B;  3GFM A;  5D4R A;  3U1D A;  4BHC A;  3RZD J;  5DCF A;  3CJQ B;  1R49 A;  1QZE A;  4I09 A;  4XNF A;  5GAE J;  1WJE A;  3E3V A;  2RAE A;  3VOD A;  3P5J A;  2VL8 A;  5DCM B;  3OIQ A;  3W2V A;  2ID3 A;  5KAI C;  1MGT A;  2F4M B;  1X58 A;  2MSY A;  3S1Q J;  1FOW A;  1SD5 A;  2XGD A;  4LLN A;  1I39 A;  1BC8 C;  1GVJ A;  4O6J A;  2STW A;  3ML6 A;  1BW5 A;  2E71 A;  3ABK H;  1Z7U A;  2PJP A;  3SJM A;  4BEH A;  2K02 A;  1ZG3 A;  1B9N A;  2R4G A;  1YOV B;  2HZD A;  2I10 A;  3CCY A;  3FKI J;  1XDS A;  2W84 A;  3J81 Z;  2L7Z A;  3BDD A;  5HNF A;  3K4C A;  5FKK A;  5LGU A;  3TO6 A;  1C0W A;  2AXL A;  2WV1 A;  1IDY A;  2ACJ A;  3MAJ A;  1DUX C;  1FIP A;  4O5V A;  4BE2 A;  2P6T A;  1WJB A;  4I6Z A;  4UHT A;  5F04 A;  1K79 A;  5CJ9 A;  5FKN A;  4J19 A;  4OOI A;  1BI3 A;  2NS0 A;  2DFI A;  3ZQL A;  4CA0 A;  5IP6 A;  4ANJ A;  2W48 A;  4WX9 A;  1QU3 A;  3HBL A;  1LEB A;  3LSI A;  4G7O F;  1ITY A;  4BHB A;  4Q5S F;  3JRD A;  5C44 J;  4IEJ A;  5K1Y A;  1U5T B;  2CQX A;  4PUS A;  2EZL A;  4FET A;  3TP3 A;  2ISZ A;  1K78 A;  3VSL A;  2DTZ A;  3K4J A;  1W5C C;  3VYR B;  2CUZ A;  1S29 A;  2ZJR F;  3NAU A;  1YIO A;  3QPH A;  2VC1 A;  1BW6 A;  3LSM A;  2RC4 A;  4IOC F;  4A3D J;  1DGR M;  3IH3 A;  2IS1 A;  3H9Q A;  4BJ6 C;  2R7Q A;  1MBG A;  2P5K A;  5CQE A;  3J7Y J;  4AUX A;  2ESH A;  2L4M A;  4BJT A;  3CCV I;  3VB2 A;  1GHC A;  5LLQ A;  3O8G A;  2LYC A;  2DFF A;  4NC7 A;  5ILU A;  2WB1 A;  2DMP A;  1J75 A;  2HDD A;  4DBR A;  3CO7 C;  2A61 A;  3OYA A;  2M30 A;  2EK5 A;  2JTV A;  2H8R A;  5FKM A;  1Q1H A;  3CDI A;  4E4H A;  3CUQ C;  3HOX J;  3F0C A;  3TOA A;  2FF4 A;  4FE4 A;  5GAH J;  4BQO A;  4KFC A;  4F55 A;  4KIF A;  3V7S A;  1X3W B;  5C3E J;  3WTZ A;  4U87 A;  5DDG A;  2LOO A;  2F5C A;  1EH8 A;  4XLE A;  2QVO A;  2LDU A;  2EFP A;  5IP7 J;  1U0J A;  4A3I J;  4ASN A;  1WVR A;  2L54 A;  2GXA A;  4KMU X;  3CQZ J;  3S32 A;  2JWT A;  1OKR A;  2H94 A;  2EPF A;  3P9K A;  5F64 A;  5CQG A;  2P81 A;  3HOZ J;  4NQW B;  1R23 A;  1UHW A;  1I6X A;  4L9V A;  5BNG A;  2WC2 A;  2ICW G;  4IQJ A;  1MJA A;  1QA6 A;  1TT5 B;  5DV5 A;  3M3Y J;  2CV0 A;  3OR2 C;  3KET A;  2E34 A;  4B47 A;  1ETX A;  2JRT A;  2VXZ A;  3R61 A;  3A01 B;  3SZG A;  3AAF A;  4HNU A;  3QRF F;  2HDW A;  3CUO A;  3Q5F A;  3Q9S A;  2RNG A;  1D0Y A;  4U0Y A;  2HPI A;  2LG4 A;  2L9N A;  1U3E M;  2JMW A;  5HVQ C;  1VQ4 I;  3DCF A;  3IRR A;  5EGO B;  3PO2 J;  2KPM A;  4A3G J;  2ISY A;  3OYF A;  2UV1 A;  2XGE A;  3ZGK A;  1W7P B;  1BA5 A;  5HS7 A;  2VT3 A;  3QPL A;  3CP8 A;  4II3 A;  2L3D A;  4B43 A;  3G6E I;  2XGC A;  4D5F A;  3I64 A;  3DKW A;  1A35 A;  3JCU C;  2VJ5 A;  3K4N A;  2F48 A;  3ONQ A;  4LK0 F;  2R7X A;  1XGS A;  2DOF A;  1F5T A;  4I01 A;  3F22 A;  5ED4 A;  2VC0 A;  2XSD C;  1V5G A;  2VQC A;  4F52 A;  2K7L A;  2OF7 A;  2IRF G;  2M0M A;  4WXH A;  5FRM A;  4F3Q A;  1MSE C;  1P4A A;  1E3P A;  2D1V A;  4L9N A;  2CQK A;  2KIF A;  5HDK A;  2A69 F;  1U5T C;  3VEP A;  1X1D A;  3AG1 H;  2H1K A;  2BHZ A;  2DA4 A;  3H9J A;  3MD2 A;  1TBX A;  4XLC A;  3L2Q A;  3RJP A;  1G3T A;  3A0H C;  2IA1 A;  1HST A;  4BS9 A;  1ZLJ A;  1O3S A;  1NK2 P;  4UV9 A;  3RPU D;  1E0E A;  2LC2 A;  3WGG A;  3GF2 A;  5DYM A;  3WE3 A;  2PMH A;  1MNE A;  2EZK A;  1SD4 A;  1NH3 A;  3TDZ C;  1D1C A;  2QGU A;  2P7V B;  2FUG 2;  2E1O A;  4BGD A;  4XRS A;  1A5J A;  5B1B H;  1P2F A;  1OYI A;  3ZQQ A;  4FIS A;  4XN3 A;  4BQQ A;  2JUG A;  1NK3 P;  2STT A;  3SEZ A;  2NS8 A;  1T38 A;  1K6Y A;  4LLL A;  3FWE A;  3EUH A;  1I27 A;  1KYW A;  4HG2 A;  1JT0 A;  2D1H A;  2L02 A;  5D8L B;  3KEQ A;  3G1M A;  1KU3 A;  2HYG D;  5JLW A;  4RB1 A;  1J9I A;  3I71 A;  1X1A A;  2XPV A;  1WJC A;  2JA5 J;  1YJ9 I;  3WG9 A;  3DBH B;  5H2F C;  1RKW A;  3LFU A;  4M9Z A;  2HEO A;  3I55 I;  1FIA A;  5M3F J;  4B8X A;  2KJC A;  2Y9Z A;  1KZH A;  4L0Z B;  1OMI A;  3S3O A;  2QSF X;  5LEJ A;  3IKT A;  3DU6 A;  2K9S A;  2L9R A;  3M07 A;  4PJM A;  1JUM A;  4WWC A;  4ZDL A;  2DYR H;  1VQK I;  2CUJ A;  3DTI A;  2KIU A;  2E2I J;  3SQN A;  3N97 A;  1Y56 A;  4E7I A;  4UV8 A;  5J6X A;  3H3Z A;  1VTN C;  1FOK A;  1YJN I;  4II2 A;  2V1X A;  2X51 A;  4HYE A;  2Y69 H;  2XF7 A;  3BOQ A;  3CDL A;  1I1G A;  2WBM A;  4QSH A;  1O7L A;  3A2K A;  3TBI A;  3H5R A;  1UJ8 A;  3JAM Z;  5GTH C;  2ID6 A;  1IRG A;  2EA4 A;  4HEA 2;  2VKE A;  3HHH A;  2IS2 A;  4OAZ A;  3U1K A;  3LA3 A;  1T8I A;  1FMV A;  2FBI A;  5L3B A;  1OPC A;  3TDU C;  5JR3 A;  1I3A A;  5ILS A;  2HVR A;  3O3K A;  3GTQ J;  4RS8 A;  2LSO A;  4XN0 A;  2HGC A;  2HOE A;  4ZDO A;  1IN8 A;  3L00 A;  4LOC A;  3KP2 A;  2VQL A;  4XRM A;  4E7H A;  3KLN A;  3WTY C;  2BHY A;  1F4K A;  5J40 A;  2NS7 A;  1P4W A;  3GZN B;  1MMD A;  2A05 A;  4FCY A;  4DZJ A;  3CCQ I;  4IL6 C;  2DFH A;  4V19 K;  2FNA A;  5B1A H;  2ZME B;  3GTM J;  2OPT A;  2RDP A;  4J01 A;  2UXN A;  3LQR A;  2FOW A;  4HSR A;  1TTY A;  2OQR A;  3C2B A;  3DPL C;  1FZP B;  5FRN A;  1BI2 A;  2X1C A;  1LFB A;  4AVP A;  4R8H A;  3HRS A;  4UVB A;  2P7C B;  3OYI A;  3J80 K;  1D5V A;  3JTG A;  1V54 H;  2OV7 A;  1LVA A;  2WY7 Q;  5ERI A;  3H1C A;  1PUE E;  3KE2 A;  4U7B A;  3PNT A;  4BBR J;  2JSP A;  5D5V B;  1OQY A;  1MBH A;  2LKP A;  3GEZ A;  3IRQ A;  4ZTF A;  5CYV A;  2V9P A;  4N0B A;  4LIV A;  2BW3 A;  2X4H A;  4RM3 A;  3I58 A;  1FSH A;  5D6F A;  2JSC A;  3IC7 A;  2PN6 A;  3L09 A;  3J7A Y;  4M3B A;  4BQN A;  5L3G A;  4AC0 A;  2VQG A;  4CXF A;  1BR4 A;  4DYR A;  2P0W A;  2LF7 A;  2NNN A;  3N4M A;  2DTR A;  2LR8 A;  1XGM A;  5CVI A;  1I3Q J;  3A02 A;  2CGP A;  2ZBK A;  3E6B A;  3HRT A;  3SZP A;  3S2W A;  1XSD A;  3V8L A;  4A3F J;  1S3J A;  3DPU A;  1MW7 A;  2ME0 A;  1E3H A;  2E7X A;  5K5O A;  5F08 A;  3JRG A;  1SEU A;  2R7V A;  2R0Q C;  5BPD A;  4RLQ A;  3UNG C;  2Q0O A;  1WGX A;  4LG0 A;  2D2W A;  1U9N A;  3HRU A;  1BL0 A;  3DEU A;  2LTP A;  1TC3 C;  2B7E A;  1CQT A;  4B3A A;  2HR3 A;  1J7K A;  4E6K G;  5EG0 A;  1IV6 A;  3JW4 A;  3HG9 A;  4NC8 A;  1KYZ A;  1UG2 A;  1PP7 U;  4XR6 A;  3F8C A;  3MQ0 A;  2XF6 A;  1OIS A;  3GZ5 A;  1IV8 A;  2PJR B;  1H8A C;  3FK6 A;  2ZSH B;  1D1B A;  1ENH A;  3KP7 A;  4KN7 X;  3AG2 H;  2VJJ A;  3LSH A;  3HHG A;  1FBU A;  2DDA A;  1YYV A;  4RGX A;  3CDH A;  2DA5 A;  4N9H A;  3TOB A;  9ANT A;  1T33 A;  4OIN F;  1UZC A;  2E19 A;  2P4W A;  1Z0X A;  3I3L A;  2FRH A;  4AWX B;  4KN4 X; 
#chains in the Genus database with same CATH homology
 2IBD A;  1RES A;  2NVT J;  3MKL A;  1B8I A;  4IHV A;  3TED A;  1MH4 A;  4W97 A;  5K7H A;  1LE8 B;  3BR3 A;  3WHC A;  3RZD J;  4M3E A;  2Y2Z A;  1U8B A;  1W0U A;  5C4X J;  1GVD A;  2RAE A;  2TCT A;  4D7M A;  4BKX A;  2ID3 A;  2Y9Y A;  4B1R A;  1PUF A;  1U9O A;  1X58 A;  2MSY A;  5GPC A;  3S1Q J;  2XGD A;  1I50 J;  4MO7 A;  2R5Y B;  1ETO A;  1BW5 A;  3SJM A;  4RBO A;  3BT9 A;  3OSG A;  3I4N J;  4A3K J;  1YRN A;  1S7E A;  1ZGW A;  2DA6 A;  1U78 A;  3S2H J;  3ZQF A;  4BBS J;  4BY1 J;  2XRL A;  5E3M A;  2I10 A;  3CCY A;  4M3F A;  3FKI J;  1JKO C;  2L7Z A;  2HI3 A;  5FKK A;  5J3L A;  1ZTR A;  1JJ8 C;  2WV1 A;  1IDY A;  1FIP A;  2NVY J;  3LOC A;  3HM5 A;  4I6Z A;  1FTT A;  5F04 A;  1JUP A;  3GTO J;  5F0H A;  1JKP C;  1GDT A;  5FKN A;  4J19 A;  4BY7 J;  2Y30 A;  4JP0 A;  1MBF A;  4ABZ A;  3ZQL A;  5F0F A;  3DEW A;  5IP6 A;  2W48 A;  3QQA A;  1GT0 C;  1B72 B;  3Q0V A;  3HBL A;  3GTJ J;  1SFO J;  2DMN A;  2X48 A;  3BG3 A;  1ITY A;  2YUS A;  3JRD A;  5C44 J;  1TWC J;  2XB5 A;  4IEJ A;  2CQX A;  2D5V A;  2EZL A;  1GV5 A;  4DYQ A;  3TP3 A;  1HF0 A;  2DTZ A;  4GFB A;  3NAU A;  3FK7 A;  1QVT A;  1JKR C;  2HXO A;  4A3B J;  2VPR A;  1BW6 A;  1H89 C;  1ETW A;  1EF4 A;  1VF9 A;  2E2H J;  4W1U A;  4A3D J;  2M34 A;  3IH3 A;  5J1R A;  1LE8 A;  5IYC J;  1MBG A;  1TWG J;  2WB1 N;  2EZH A;  2NOG A;  1AKH B;  1XC5 A;  3OOU A;  3JRF A;  1WH5 A;  4A3M J;  1OFC X;  4G12 A;  2K40 A;  4AUX A;  1QVU A;  4MLO A;  3O8G A;  1MBK A;  3OIO A;  3GTG J;  1IDZ A;  2DMP A;  2Y0S N;  5DTD A;  2HDD A;  3JRI A;  2M8G X;  5K7F A;  4RDU A;  3Q0W A;  2R5Y A;  2H8R A;  5FKM A;  3SFI A;  3HOX J;  2L7M P;  3F0C A;  2COB A;  3G1L A;  1UMQ A;  1ETY A;  4FE4 A;  5FLM J;  3GBG A;  3VPR A;  1T56 A;  2JA8 J;  2HOA A;  4M3D A;  5EEA A;  1WPK A;  5C3E J;  3K2A A;  4UUS B;  1ETQ A;  1O4X A;  5E3O A;  5IP7 J;  4A3I J;  3BR5 A;  3IH4 A;  1WI3 A;  3CQZ J;  4JX4 A;  2JWT A;  4S0H B;  2HOT A;  2DJN A;  4X1E A;  2P81 A;  4C3J J;  2LKX A;  2EZI A;  3HOZ J;  5BNG A;  1B72 A;  2JA7 J;  3M3Y J;  1Y1V J;  1X2N A;  2MG4 A;  1ETX A;  3A01 B;  1ZR2 A;  1JTX A;  5F1J A;  2EBI A;  1SAN A;  4L5E A;  3H0G J;  2HOS A;  4IHX A;  2X6O A;  2YS9 A;  5E3N A;  2LVS A;  2JMW A;  1IC8 A;  3DCF A;  2AHQ A;  3TP0 A;  5EGO B;  3PO2 J;  2EQR A;  4A3G J;  3JRH A;  3JR9 A;  2CQQ A;  5M5X J;  2E2J J;  3JRA A;  3WHB A;  2XGE A;  1FJL A;  1ZKG A;  1BA5 A;  3D1N I;  3BQY A;  3QPL A;  2LD5 A;  2ECB A;  3BR6 A;  2JK3 A;  2XGC A;  4D5F A;  1AKH A;  1ETK A;  3S1R J;  4X6A J;  5IOY A;  1HOM A;  3BR2 A;  5M5Y J;  1F36 A;  3E7L A;  2PMZ N;  4QIW N;  3G1O A;  2LFB A;  3JRB A;  3BG9 A;  1G2H A;  1NTC A;  2XSD C;  2WAQ N;  1HDD C;  4A93 J;  1OJL A;  2OF7 A;  4DZP A;  4DW6 A;  1MSE C;  1JKQ C;  5EZG A;  1WH7 A;  3MVP A;  3BQZ A;  2DA7 A;  5HOD A;  4FTH A;  4C3I J;  5J1Y A;  2VKV A;  2K9N A;  4UUS A;  4I76 A;  2DA4 A;  2GLO A;  2H1K A;  4NDL A;  2DA2 A;  3BTL A;  5JLX A;  3S1N J;  1Q1V A;  3HOW J;  4XID A;  2TRT A;  1MH3 A;  3S14 J;  1R9T J;  1AHD P;  1NK2 P;  2XPW A;  4M3G A;  4HNV A;  5FKO A;  2R5Z B;  4XRS G;  2EZK A;  1IRZ A;  3JRE A;  3HGG A;  1Z77 A;  2R7Z J;  2E1O A;  4XRS A;  5EYR A;  1A5J A;  2LK2 A;  2GBY A;  3FIS A;  4FIS A;  1ETV A;  3HKZ N;  2AO9 A;  3BR0 A;  3A01 A;  3W6V A;  1MBE A;  1OCP A;  4C3H J;  1NK3 P;  3LNQ A;  2NS8 A;  4A3J J;  4QTR A;  1JTY A;  1JT0 A;  3LSR A;  3K7A J;  3G1M A;  5FKL A;  5JLW A;  2CJJ A;  3PO3 J;  3BR1 A;  2XPV A;  5EGO A;  4Y7N J;  4JYK A;  1QPI A;  1K61 A;  2JA5 J;  4A3C J;  5IOZ A;  1RKW A;  3ZQG A;  2MGQ A;  2JJ7 A;  2FQ4 A;  1FIA A;  5M3F J;  1VI0 A;  4CYC B;  3ZQC A;  2Y9Z A;  2ME6 A;  4MFD A;  2ZB9 A;  1GUU A;  3I4M J;  1JGG A;  4V2F A;  5DS9 A;  2L0K A;  4BXX J;  4A3E J;  2K9S A;  2L9R A;  2MW8 A;  1TWA J;  1JUM A;  3B6A A;  1JJ6 C;  1W0T A;  4IHW A;  4JX6 A;  2E2I J;  1AU7 A;  1RR7 A;  1HCR A;  1DU0 A;  1ZR4 A;  1IJW C;  3JRC A;  4DYC A;  5FJ8 J;  3CDL A;  1FTZ A;  1GV2 A;  1VND A;  2M2E A;  4QSH A;  2FD5 A;  4C2M J;  1ZQ3 P;  3HDD A;  1ORK A;  3S17 J;  5K7Z A;  2ID6 A;  5GP9 A;  2QF7 A;  2VKE A;  1I6H J;  1LFU P;  1IG7 A;  3Q0U A;  2K9Q A;  5GPA A;  2HXI A;  4JX5 A;  3UKG A;  3GTK J;  4XK4 A;  2LP0 A;  2O7O A;  3BTJ A;  4M6V A;  1FEX A;  1JT6 A;  3GTQ J;  3S16 J;  2R5Z A;  1POG A;  4IHY A;  2LY9 A;  1F43 A;  3PM1 A;  1VFC A;  4LOC A;  1QRY A;  2DN0 A;  3ZQH A;  4AYB N;  2G0E A;  4XRM A;  2R92 J;  1UHS A;  3M4O J;  1TWH J;  2NS7 A;  4FCY A;  2ELK A;  1A6I A;  5FLV A;  5EDN A;  2QCO A;  3BG5 A;  4DZJ A;  4A69 C;  2XB0 X;  3GTM J;  3BTC A;  2OPT A;  5F27 A;  1K83 J;  3TW7 A;  5EG0 B;  3FIW A;  4UUT A;  3C2B A;  5IYB J;  2YU9 J;  2KT0 A;  3HOU J;  2XPU A;  1Y1W J;  1LFB A;  2DA1 A;  2X9D A;  4CYC A;  2VUM J;  1XG1 A;  4B4C A;  4D5C A;  3CMY A;  2CRG A;  3S2D J;  3LSJ A;  1BJZ A;  2EH3 A;  4BBR J;  1HDP A;  2IEK A;  2O9L A;  1RPW A;  3Q3S A;  2N8G A;  1MBH A;  3RKQ A;  1B8I B;  3O8H A;  5EF6 A;  1XS9 A;  5J1U A;  1HLV A;  5EZH A;  2CUE A;  2ECC A;  5C4J J;  4D7N A;  1IGN A;  4Y52 J;  5F0C A;  1E3O C;  3GTL J;  4A3L J;  2HYJ A;  4M3B A;  3LSG A;  3QPS A;  3B6C A;  4AC0 A;  5M5W J;  3RZO J;  3GTP J;  3MN2 A;  1RET A;  4DYR A;  5IPA A;  2DMQ A;  1PUF B;  3SDG A;  2NVQ J;  2LR8 A;  4XIC A;  1APL C;  3OSF A;  1I3Q J;  4V2G A;  3A02 A;  1X2M A;  1MNM C;  4A3F J;  2NVX J;  2Y31 A;  3HEF A;  3HOY J;  1WCM J;  3IH2 A;  5IP9 J;  3BTI A;  3S1M J;  2ME0 A;  3HB9 A;  1YRN B;  1P7I A;  2M0C A;  5F08 A;  3JRG A;  2KDZ A;  3HGY A;  3L1P A;  1MSF C;  1DU6 A;  2R0Q C;  2FX0 A;  1JUS A;  2IAI A;  1WGX A;  2CUF A;  1ZK8 A;  2JA6 J;  1U9N A;  3RQI A;  1BL0 A;  3A03 A;  3IV5 A;  2LTP A;  1TC3 C;  3TW6 A;  2B63 J;  4MIM A;  5IYD J;  3H3V K;  1CQT A;  4FE7 A;  4B3A A;  1D5Y A;  4MFE A;  5EG0 A;  2LLK A;  1IV6 A;  1UG2 A;  2DA3 A;  2FJ1 A;  1IUF A;  5M3M J;  2HQ5 A;  2O8K A;  1RKT A;  3FK6 A;  1TWF J;  1MBJ A;  1H8A C;  3HOV J;  3ZOB A;  2JN6 A;  3S15 J;  2DMT A;  3ZQI A;  1ENH A;  5E3L A;  4EEF G;  2CU7 A;  2L7F P;  2DA5 A;  9ANT A;  1T33 A;  2M9H A;  2GM4 A;  2VI6 A;  1P7J A;  3LSP A;  2E19 A;  1Z0X A;  2DMU A;  2R93 J;  3NAR A;  1OCT C;  1H88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...