2LFBA

Homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
b'MARIDPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LFB1/HNF1 TRANSCRIPTION FACTOR
publication title The NMR solution structure of the non-classical homeodomain from the rat liver LFB1/HNF1 transcription factor.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Dna-binding
total genus 34
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lfbA00
4MIMA 3WHCA 2R5ZB 1PUFB 5C4JJ 4M3BA 1IDYA 4C3JJ 2RAEA 4XK4A 3BR0A 2COBA 2E2JJ 3RKQA 1XC5A 5F1JA 2XSDC 4FISA 3MVPA 2AO9A 2Y9YA 4V2GA 1H8AC 2VPRA 3A03A 1A5JA 5IOYA 2FJ1A 4M6VA 1JKQC 1IV6A 4M3DA 4DYCA 3SFIA 1NTCA 2LY9A 1D5YA 5K7FA 5M5YJ 3Q0WA 1RETA 5J1YA 3SDGA 3RQIA 5FJ8J 3ZQLA 2X48A 5E3OA 3PM1A 2Y31A 2CUFA 2ELKA 4XICA 4RBOA 2JA7J 1GUUA 3JRHA 4A3BJ 1VFCA 1ETVA 3HOVJ 2HXIA 1GV2A 2JMWA 2LK2A 1T56A 4JYKA 2LD5A 1JGGA 3K2AA 1MH4A 5IYDJ 1AKHB 3B6CA 1B72B 1BL0A 2DMPA 5EYRA 4JX6A 1EF4A 3LSGA 1IUFA 3S17J 2GBYA 3Q3SA 2R7ZJ 2JA8J 1ETOA 1OFCX 5FKOA 4M3FA 2DMNA 2GM4A 2XPVA 4DYRA 1R9TJ 4AC0A 1YRNB 1WGXA 1IGNA 1QVTA 3TEDA 5E3LA 4M3GA 1DU0A 4FCYA 1NK2P 2ECBA 1QVUA 3TW7A 2X6OA 5FLVA 2MGQA 2IEKA 4MFDA 2FD5A 3S14J 4A3MJ 1RESA 2CQQA 1UMQA 3BR1A 4D7MA 2H8RA 2ME6A 1APLC 1GVDA 1Z77A 3M4OJ 4B3AA 2P81A 1ETYA 3HKZN 3OSGA 2VKVA 2L7ZA 3W6VA 2EH3A 2LP0A 1MBHA 1RKTA 4BY1J 1Y1WJ 4UUTA 2XB0X 3VPRA 2WV1A 2XGEA 2YUSA 5M3MJ 4D5FA 3JRBA 3HOWJ 1Z0XA 1JJ6C 2LLKA 3WHBA 5DS9A 1JUMA 3LSRA 2Y0SN 1TWAJ 2K9SA 2DA3A 2EBIA 2MSYA 2M0CA 3FKIJ 3OSFA 4AYBN 1LFBA 1X58A 5C3EJ 4JX4A 5IP9J 2XGDA 3HOZJ 3OIOA 3RZOJ 5K7ZA 2B63J 3HGGA 1UG2A 3CMYA 2DA2A 1YRNA 4S0HB 4JP0A 4MLOA 1U9OA 1WI3A 4V2FA 5M5XJ 2KT0A 1GDTA 3RZDJ 3S1NJ 3B6AA 1U78A 2NS8A 3GBGA 3PO3J 2DA7A 2NVTJ 1ETXA 3PO2J 1ZTRA 3HM5A 3UKGA 4A3FJ 2NVQJ 5IP6A 1VF9A 4J19A 2NS7A 4A93J 5GPCA 3GTQJ 1MSFC 5J3LA 4QSHA 3GTLJ 2W48A 3Q0VA 4HNVA 2R5YB 2LTPA 3TP0A 5E3MA 2DJNA 3JREA 3QQAA 1RR7A 2MG4A 3G1LA 5EG0B 3O8GA 2K9QA 1JUSA 3S16J 1IC8A 1U9NA 1JTXA 4FE4A 2OF7A 4MO7A 2MW8A 2LKXA 1I6HJ 3GTMJ 1BA5A 4FE7A 5F0HA 2TRTA 2WB1N 3BTIA 3HBLA 4QIWN 1I3QJ 5EGOB 1H88C 3I4NJ 2HDDA 2E2HJ 4X6AJ 3G1OA 2M8GX 1CQTA 1MBJA 1MNMC 4A3LJ 1TWCJ 1JKPC 1GV5A 5DTDA 3JRFA 3BR5A 2EZLA 4NDLA 1TC3C 2M2EA 2DMTA 5IP7J 5C4XJ 1P7IA 1UHSA 1GT0C 2R0QC 4IHYA 4UUSA 2ME0A 1FTTA 3S2DJ 4IHVA 3H3VK 2I10A 1ETQA 3K7AJ 3MKLA 1W0UA 4BKXA 2XPWA 5JLWA 2M9HA 2R5ZA 1PUFA 2AHQA 1E3OC 4Y52J 3DCFA 3SJMA 1A6IA 3IH2A 2QF7A 4A69C 3TW6A 2FX0A 2O8KA 3IH3A 2CRGA 2R92J 3Q0UA 4XRMA 2EZIA 3JRDA 4GFBA 3BTCA 1ZR2A 4A3EJ 5GP9A 2DA4A 4D5CA 1G2HA 2HI3A 4BBSJ 2Y2ZA 1XS9A 5K7HA 3FISA 4CYCB 4A3CJ 2K9NA 4DZJA 2X9DA 2XB5A 1ZK8A 3E7LA 3LOCA 1AHDP 1HCRA 4X1EA 4DYQA 1ETWA 5F04A 1LFUP 4EEFG 4ABZA 3GTJJ 4A3KJ 5F27A 4FTHA 1IRZA 3FK6A 1F43A 5GPAA 3HOXJ 1JTYA 1POGA 3BG9A 1S7EA 3MN2A 1AKHA 3JR9A 3NAUA 2K40A 1B72A 4I76A 1HLVA 1JKRC 2HYJA 3BR2A 5J1UA 4QTRA 2EZHA 2HXOA 3S1MJ 1ENHA 1JUPA 1SANA 2OPTA 5FKKA 2O9LA 3BG5A 4AUXA 3LSPA 3JRIA 4G12A 5IOZA 5F08A 5FLMJ 1BJZA 2DTZA 1OCTC 2JJ7A 2O7OA 4XRSG 1K61A 2YS9A 4BBRJ 1ETKA 2L7FP 1ZQ3P 1MSEC 3HEFA 1TWGJ 5IYBJ 1W0TA 3QPSA 3ZOBA 1HDPA 3CDLA 1RPWA 2XGCA 1FEXA 5IYCJ 1IJWC 1SFOJ 3M3YJ 4IHWA 3HB9A 3GTKJ 5BNGA 2JWTA 3I4MJ 2EQRA 3NARA 1H89C 3CQZJ 2GLOA 2H1KA 1OJLA 5IPAA 1HF0A 1VI0A 5JLXA 1TWFJ 1MBKA 5EZHA 4XRSA 5EF6A 3HOUJ 4IHXA 1FIPA 4IEJA 2R93J 1TWHJ 2Y30A 3TP3A 2VUMJ 1P7JA 1ORKA 5M3FJ 3ZQGA 1BW5A 1AU7A 1OCPA 1HDDC 1JT6A 3A01B 3HDDA 5M5WJ 2L7MP 2D5VA 2L9RA 2E2IJ 1HOMA 4C2MJ 2LR8A 1I50J 1WH7A 2YU9J 4RDUA 4BXXJ 1FIAA 1U8BA 2DA5A 3DEWA 2IBDA 2TCTA 3IV5A 1X2NA 3JRAA 1MH3A 2ECCA 2FQ4A 2DA6A 4B1RA 5J1RA 2HOTA 1LE8B 2HOAA 1FTZA 4C3HJ 1VNDA 4LOCA 1XG1A 1ITYA 1DU6A 2LFBA 1ZR4A 3BG3A 5FKLA 2E1OA 1Y1VJ 3D1NI 2XRLA 1B8IB 3BTLA 5FKMA 3IH4A 3ZQHA 2DMUA 3C2BA 2HOSA 2QCOA 3CCYA 1JJ8C 3BQYA 3ZQIA 1NK3P 5FKNA 2R5YA 1IDZA 1Q1VA 3JRGA 1MBFA 3LNQA 2CJJA 5EG0A 3GTOJ 4W97A 5E3NA 3BQZA 2N8GA 4W1UA 3ZQFA 4JX5A 1O4XA 4DZPA 2DMQA 1ZKGA 4B4CA 5EZGA 2NVYJ 5EEAA 3BR6A 4Y7NJ 2CUEA 5EGOA 1QRYA 3F0CA 5F0FA 4DW6A 2JA6J 1K83J 2ID6A 1FJLA 4M3EA 2KDZA 3A01A 3S1RJ 1MBGA 1T33A 2NVXJ 5F0CA 3ZQCA 2ID3A 3BTJA 3JRCA 4A3GJ 3BT9A 3LSJA 1F36A 2HQ5A 3H0GJ 4L5EA 9ANTA 2IAIA 3GTPJ 4C3IJ 1WPKA 1MBEA 2E19A 2JN6A 2LVSA 4D7NA 2DN0A 2CQXA 1LE8A 4A3DJ 3A02A 2VI6A 4XIDA 2PMZN 3OOUA 3HOYJ 3FIWA 3QPLA 2JA5J 3O8HA 2Y9ZA 1ZGWA 2WAQN 3S15J 4A3IJ 3G1MA 1B8IA 1QPIA 1BW6A 2VKEA 2CU7A 4MFEA 3S1QJ 5HODA 2M34A 4BY7J 3S2HJ 1WCMJ 1JKOC 2NOGA 4I6ZA 1RKWA 2G0EA 1JT0A 2EZKA 3HGYA 5EDNA 1WH5A 1X2MA 4UUSB 3BR3A 3GTGJ 3L1PA 2JK3A 2L0KA 3FK7A 4CYCA 2XPUA 4A3JJ 2ZB9A 2DA1A 5C44J 1IG7A
chains in the Genus database with same CATH superfamily
4XL9A 1K4TA 1SMTA 2EA2A 3MZ8A 4AIKA 4M74A 4M3BA 1IDYA 1O7LA 5LD2C 4C3JJ 2COBA 4FX0A 4HV5A 2XSDC 3SYTA 1O3RA 3BP8A 4BHCA 2AO9A 2E71A 3WTWC 3MKYB 5E18F 4Y33A 1IXRC 4J01A 2VPRA 3HL2A 3A03A 4BJ6C 2B7EA 2L01A 1OPCA 2EV6A 2FJ1A 1PVEA 4M6VA 1IV6A 1HKQA 4M3DA 2DO7A 3OYKA 2A61A 3ISPA 1NTCA 3SFIA 3WTXC 4B09A 4BL0B 2FQ3A 3EDPA 4ZDOA 5L3CA 5M5YJ 3FXLA 3FDYA 4H0EA 3OL3A 3RQIA 1KONA 4U7BA 3H0DA 3RTRA 5HS8A 3L2WA 2ZXJA 1W1WE 3REOA 2CUFA 2IP2A 4RBOA 1LEBA 2ZJRF 2ZMEC 2DFEA 2EILH 4KIGA 1ETVA 2HXIA 2JMWA 2LK2A 4JBAA 3OYMA 1BOBA 3DKWA 4R79A 4U87A 1AKHB 4UHTA 3V8KA 5EEGA 2DMPA 2WAQA 5JFRA 2M8EA 5B66C 4JX6A 2E7XA 1IUFA 4MEXF 3RPQA 4V19K 5CLSA 2F5CA 1ZYRF 3GXOA 3N05A 1CF7B 1R9TJ 5FB2A 4IQJA 4QLCU 1WGXA 1FMVA 2DOFA 2VJ5A 3DTKA 4LMYA 4G9YA 3CCQI 4UB6C 4PJ0C 2R7VA 3IKTA 1MW7A 1NG6A 3TEDA 3IUOA 1HQCA 3I53A 1SAUA 2K3PA 2NVUB 2PJRA 1QVUA 2X6OA 3K4KA 2MGQA 1EJ9A 3S14J 1WWXA 4GO1A 3WTSC 3A1YA 3HHGA 2CG4A 2IXSA 1UMQA 3DV8A 1J75A 2ME6A 4A0XA 4E70A 3EUHA 4WK8F 2ZBKA 2H09A 5JVGF 4XLPF 1G8XA 3CCVI 3TDZC 2HYFA 2MC4A 1BM9A 1ETYA 2XIGA 3HKZN 2VKVA 2IGKA 1X1DA 2EH3A 3KE2A 1MJBA 1ZG5A 4B44A 1R5GA 4UUTA 2DT7B 1LDDA 2MABA 3LSHA 4NBQA 3VPRA 5IT9K 5DEQA 4LK1F 3R0AA 3TO9A 3I71A 4Z6YA 3RKWA 5DS9A 3VODA 3QU6A 3L2CA 1JUMA 2DT5A 3LSRA 2EK5A 4BE0A 2BVMA 2ZFWA 1PJRA 3P9IA 3DU5A 2DA3A 2EBIA 1IAWA 2M0CA 2QKMB 5FFZA 2VB6A 3GVAA 5L3BA 4OIQF 4RB0A 2V6CA 3RJPA 2R7SA 1EH6A 2CFXA 3I0TA 5DM6F 5C3EJ 4JX4A 5IP9J 3V7SA 4Y15A 3ABLH 4BQQA 1UCRA 1D5VA 5JHFA 3RZOJ 4HG2A 4FETA 2DA2A 2XRNA 3IWFA 2HOEA 1N75A 2M4GA 2QENA 4S0HB 2ZFUA 4MLOA 2IS1A 2LKSA 5CVUA 1WKMA 3S1NJ 2LNBA 1QHGA 4CXFA 5FO5A 2XHKA 2OD5A 1WJAA 3ML6A 1ZG1A 4HDUA 2DAOA 3ASOH 4QPQA 4BUPA 1ZTRA 4XM3A 5K5QA 1MZBA 4E6KG 4BDZA 2XGXA 1Z1DA 1XX5A 2NS7A 3F21A 2KP6A 2LSOA 3FHNA 2DOEA 4HX8A 1G6NA 4NQWB 1DPRA 5J3LA 1GXQA 4GGGA 1XMXA 2CW7A 1J09A 3IAS2 1UAAA 4DNCA 3G3ZA 3F6OA 2XUBA 4L9NA 4RAGA 2RQPA 3JREA 2EFOA 2KQRA 4A6EA 1BI3A 1V3FA 4A0ZA 1T8IA 1IW7F 1X3ZB 4OIRF 3NEUA 4B43A 1T98A 4IRHA 1IC8A 3KP4A 3ECHA 1R7JA 2ZO4A 2G7HA 4EM2A 2RREA 2YX7A 2Z9OA 4QIWN 1KGSA 1I3QJ 1H88C 4LIVA 1IXSB 1XDUA 2I5UA 2HDDA 4BHBA 3WTZA 1TZLA 3L9FA 2BV6A 1MBJA 4A3LJ 5EEHA 5DTDA 3S3MA 4RB1A 4C2TA 3COAC 3WU1B 3ULQB 4DQ2A 2OCEA 1VTNC 1UZCA 2BEOA 1OCCH 2NAZA 2LRDA 3O3KA 3J7AO 3IAM2 1E3HA 2FOKA 3PL8A 4IHYA 2KRCA 3QWLA 1HBXG 1Z21A 4YG2F 2I10A 1R4NB 2QUFA 3ZMDA 4BKXA 5DCMB 3C7JA 4HBLA 5DV5A 1NHAA 2DJIA 1LDKB 3SJMA 4GRIA 1A6IA 1RZ4A 2QF7A 3IH2A 3TW6A 2O8KA 3IH3A 1RIOH 3HRSA 4RLQA 4BHPA 2XV4S 2EIKH 1R22A 3DBLB 2PFBA 1ZR2A 1VQ9I 1VQ7I 2RGVA 3GYHX 2XAJA 2V79A 2LF7A 2UXNA 2A5YB 4Z2YA 2HI3A 3OS2A 3ZMZA 1XS9A 4PSWA 2V9VA 3ZGKA 4CYCB 4L9TA 2FRHA 2JRTA 2L02A 5JI6A 2K27A 1JHHA 1FC3A 3OR2C 4LJZF 4G7HF 5F04A 2DQLA 3SEQA 3OYIA 2QKLB 3NWTA 2WA0A 5F27A 1RC9A 1ZARA 2HU9A 4IOAF 3DPLC 3MKZA 3HOXJ 1JTYA 1POGA 2BHZA 2ZSIB 2CV2A 2DW4A 3J81K 3CLOA 3FBIB 3JR9A 2K40A 4Q48A 2CS3A 2HTSA 3F6VA 3Q5FA 1HLVA 1B72A 2KKOA 4ZTJA 2EZHA 2P6SA 3PQKA 1SANA 4RM2A 3CC2I 4U0VA 1TQMA 2K85A 5FKKA 3GZ5A 2O9LA 3BG5A 4XR6A 5B3SH 4KT5C 1BJZA 2ZJ2A 2JJ7A 2KPMA 1R00A 2A68F 1P4XA 2JUCA 2E7WA 1Z05A 2W85A 2YS9A 4BBRJ 1ETKA 2VL8A 5J47A 1XD7A 5DUIA 1YJWI 4XONA 2FBIA 3KP6A 2IA2A 3CP8A 3CDLA 3QODA 3KP7A 3HZJA 3GLXA 2V9PA 2Y75A 4EJTA 1FOWA 2WAEA 3S2WA 2P5LC 3HB9A 3GTKJ 2EQRA 3NARA 1F5TA 3CQZJ 5CVIA 2O61A 3KP2A 1XMAA 4I0AA 4CCMA 4DBQA 5IPAA 3WG9A 4LD5A 3V4GA 1VI0A 3CDHA 2HPMA 3OYCA 2F4OB 1T6SA 4EVIA 5EZHA 4B48A 3BPXA 5EF6A 3A0HC 2K9LA 5FRNA 1FIPA 4KYWA 1TWHJ 1LQ1A 2CGPA 4JOMA 3TP3A 1VQ4I 1ORKA 5M3FJ 3ZQGA 5JR3A 1BW5A 2BY3A 1YX3A 2F48A 1H0MA 3L2QA 2P7CB 3LSKA 3A2KA 1LEAA 3HDDA 1S29A 4BACA 1XCVA 4HZFA 5D5XB 4EMSA 2EV5A 2L4AA 4OMZA 2K7LA 1I6XA 4HSRA 1I50J 1WH7A 5DYMA 4XN3A 2HS5A 4Q4ZF 2HTJA 1YOVB 3IV5A 1X2NA 1KQ0A 1SVOA 5J1RA 2HOTA 2QWWA 4ENJA 3I59B 2HOAA 2X85A 2KIMA 4HRIA 4LOCA 3OYLA 1UHWA 5LFAA 1VQPI 3BCBA 1S3JA 1W5CC 2FE3A 1KU7A 2P8TA 3BTLA 3WGHA 5HNHA 2QSGX 3OYEA 3I4PA 3HSRA 1QU3A 3F3XA 3F8BA 3CZ6A 2ZXIA 2L9NA 3LA7A 2QCOA 3CCYA 3GZNB 3BWGA 2LOOA 5H20A 4BYYA 4ENMA 4HOBA 4PCQA 2RDPA 3KLOA 1B9NA 3K4BA 3K69A 3GTOJ 5E3NA 4W1UA 3ZQFA 4L18B 1FX7A 4DZPA 2XDVA 5KAFC 4B4CA 3SEZA 4ZJZA 3G71I 2KRFA 3BR6A 3CESA 3J7YJ 4UVBA 4ZYHA 3T8RA 5EGOA 1QRYA 2LREA 3LMMA 2ID6A 3CMAI 3F9KA 1VQ8I 1FJLA 2FUG2 1MBGA 1S72I 1ZG3A 3ZQCA 2ESHA 2NVXJ 4NC7A 2B9SA 5A2QK 4A3GJ 2WAFA 3BT9A 3LSTA 1S7AA 1I1GA 3L7WA 2VOOA 3QAHA 3G73A 4C3IJ 3KZZA 1WPKA 4P5OA 3GZ6A 2JN6A 3LQRA 1Y39A 3EUAA 1LB2A 1K78A 1XSDA 1AA7A 1WVRA 3OOUA 5L3FA 4A12A 3ZMTA 3DP7A 4EM0B 4E7IA 3HOYJ 2XVCA 3GW2A 3QPLA 2E36A 2RKHA 2VT2A 2BE5F 2VC0A 2WAQN 4KICA 4ZYAA 5J40A 4UVAA 2DDAA 3IWZA 1BW6A 1WJCA 1U5TA 4NB5A 2M34A 4BY7J 5BQTA 1SEUA 2IPQX 2L4MA 3S2HJ 1JKOC 3TL4X 2WBMA 3W6KB 3FBNB 1O7FA 2W1OA 2PI0A 4RA2A 3HGYA 3LA3A 3BR3A 4GYIA 2Z33A 2XKPA 3FK7A 4I02A 4F3QA 5C44J 3C18A 4ZYDA 1FOXA 1S8NA 2R5ZB 2CH0A 1A31A 2RAEA 3BR0A 1DDNA 1WJEA 4NC8A 2R7DA 5ICCA 1Y0NA 2X51A 1N25A 2X4HA 2ICWG 1R23A 2F4IA 3LAPA 1JKQC 2D1VA 2F6CA 4XLCA 1FYLA 3BJOA 3FXMA 4DYCA 3PNVA 1D5YA 3CO7C 1LVKA 2TDXA 2OC6A 3M1EA 2V6EA 3PUBA 5J1YA 4FT8A 2QSHX 3ZQLA 1XB4A 3B02A 3PM1A 2XROA 2JZYA 5DCFA 3TDUC 3R0JA 3IHUA 5ICGA 5HS7A 4OIOF 2BXZA 2BOLA 5GTIC 2X1CA 2DPDA 1GV2A 3OYFA 4JYKA 3K6GA 2VXZA 1PYVA 4PJMA 2DK5A 1MH4A 3PIOF 3OYGA 3BG6A 5HVQC 4JK1X 3K4JA 2ZKZA 4CYDA 2E1CA 1BL0A 3SZPA 3K70D 3LSGA 1OLTA 3DBRB 2HDWA 3Q3SA 1W5SA 3H5NA 4MGRA 5CQGA 1U2WA 3SFZA 2CUJA 4UY8I 2K4BA 4M3FA 2GM4A 2QGUA 2GA2A 4DYRA 1YRNB 3B73A 1YI2I 1OQYA 1YX5A 2OTLI 1SD7A 3L00A 2W82A 3WTTC 2YU3A 4CCJA 2NXNB 2CQNA 4U7DA 3I55I 2HVQA 2K5CA 4R1HA 1HW2A 2QQ8A 1TW2A 1FZPB 5FLVA 1MIJA 2BVLA 2IEKA 3F8MA 4MFDA 1RESA 2KL4A 3QPTA 3GX4X 4D7MA 2H8RA 1VQMI 1APLC 3OIQA 3JAMK 1USTA 1Z77A 4I98B 1FPQA 3H3UA 4S05A 1UFMA 3W6VA 3IRRA 2LP0A 2CV1A 4BY1J 3DEUA 2XB0X 1Y8RB 2BYVE 2WV1A 4HQEA 5GAHJ 1R6RA 2YUSA 5HLTA 1P92A 3GLLA 1ONVA 4BXUA 2IT0A 4OWRB 3VB2A 2X0LA 3BCAA 5EJCA 1HSTA 1TWAJ 3WG7H 2W00A 3FXRA 2K9MA 3CCMI 2MSYA 3H5RA 3OSFA 2Y69H 1IN4A 2GOXB 4ZDPA 4B47A 2VPLA 3PNYA 4RB3C 1MDMB 1ZLKA 2PQ8A 3PNTA 1X58A 3AAFA 1J59A 1UHMA 4MQ9F 4M72A 3OIOA 4A5NA 5LLQA 4D1QA 1CGPA 1YRNA 4PUSA 4JP0A 3QYBA 5FFXA 1U9OA 2ZMEA 2BW3B 1WSUA 2KFDA 2QQAA 1IZ1A 1T39A 4CO8A 3DEEA 3QP5A 2JPBA 4LFUA 3D5RC 3B6AA 3LAJA 3I58A 3KLNA 4YFXF 2VJ4A 4UV9A 4GDFA 3GBGA 3KYLA 4RAFA 2ESNA 3UKGA 4A3FJ 3KIOA 2ZC2A 2GA1A 2L9VA 1VF9A 2JTVA 1E17A 4A93J 3QOPA 4UXNA 4B3XA 5E8IA 1KU9A 1Z3XA 4I0BA 4QSHA 2HVSA 2W48A 4HF2A 1ZRCA 2VBXA 2R5YB 2FOWA 1RR7A 3QQAA 2MG4A 2KIUA 5EG0B 1J0RA 3O8GA 4CZCA 1K79A 2K9QA 3TQNA 3S16J 3MCZA 1U9NA 2LKXA 4MO7A 2DFHA 2RQQA 3CMEI 1VZ0A 3GTMJ 4ASNA 3QOEA 3F8CA 4FE7A 2X6WA 3E6BA 2WB1N 5FLXK 4YEJA 2L2OA 3I4NJ 2JUGA 1FLIA 1ZLJA 2K02A 2OQGA 1DP7P 3C2GA 4Y4RA 5CVRA 2W7NA 2VLAA 4CSWA 3BR5A 1BIAA 3KZIC 4NDLA 1TC3C 2DMTA 1J9IA 5C4XJ 1P7IA 4HDVA 1V5EA 2E1MC 1QZYA 3PSFA 5LBQA 3OYDA 4G6DA 3QRFF 1FBUA 4UUSA 2ME0A 4RMNA 4RB2C 3MAJA 3S2DJ 1NH3A 4IHSA 3C3WA 4PK4A 4XLAA 5GAGJ 1J5YA 2FF4A 1X19A 3PUFA 1MNDA 5JLWA 2M9HA 1B59A 4II3A 4JQFA 4DGWB 3M8JA 4G8XA 2AHQA 1XGNA 3DCFA 3FWEA 1OYIA 3IP4B 3BOQA 4A69C 2R92J 1R5ID 4LIUA 4S04A 4XRMA 1K7AA 4HPQA 4WXCA 4N4NB 4UB8C 3T8TA 2OZ6A 4A3EJ 4BU2A 1A04A 5AIQA 1HXDA 2A69F 3E5UA 4D5CA 1YTYA 1X3WB 4RM3A 1G2HA 3E0JB 4BBSJ 1G3TA 1YS6A 3HXLA 4OU0A 4Q47A 2P7VB 4XKBA 5HS9A 2ZJQF 2ZXHA 3QPHA 3KP5A 5F64A 3WE2A 1ZK8A 1W7PB 5IY5H 3WGIA 1ACIA 4DYQA 2J5PA 4KISA 3GTJJ 2MD0A 3S32A 2JSPA 2O3FA 4XMYA 2DFFA 2AXLA 5BOXA 3CCLI 1L0OC 2F5VA 3CMMA 3S93A 5AIPA 4I2OA 5J4VA 3MN2A 2IS2A 3IKVA 1AKHA 1YYVA 3NAUA 3OR1C 1P2FA 4DBRA 1JKRC 1STZA 2HYJA 5J1UA 2ZJPF 1QPMA 2HXOA 4QTRA 1D8JA 3IC7A 4IZZA 3S1MJ 4DJAA 1JUPA 3CC4I 3A0BC 3ABMH 2OPTA 3SHFA 2H8WA 3JSOA 1CF7A 5TISC 2K86A 3OYJA 1XCBA 3JRIA 1YW9A 2BBYA 3E3VA 1TT0A 2W57A 2OU2A 4HF0A 3K4CA 1T0FC 1DGWY 3E97A 4KMFA 1K61A 3JCUC 1D1BA 5LGUA 1KQ9A 1ZQ3P 2OZUA 4G7OF 1X4PA 2CV0A 3HEFA 2XAFA 3U1KA 2Y0MA 3QPSA 1RPWA 1S5LC 1U3EM 3ZXSA 2O5RA 2ELHA 2F5FA 1SFOJ 1IJWC 3T5XA 3OY9A 4EM1A 1MJAA 3TO6A 4YELA 1XPXA 3P5JA 4NHJA 3I4MJ 1H89C 1R36A 2R3SA 2UXXA 1OJLA 2OCCH 4L9VA 3VYTB 3FF5A 1EH8A 5JLXA 5AONA 3KX2A 3NWSA 3VFZA 4X0GA 2VQGA 3ABUA 3H9JA 2WY8Q 3W2WA 5FD5A 3G4SI 3GFIA 4IHXA 1FP1D 1XGSA 3HYIA 1IRXA 2VUMJ 1P7JA 2HKOA 1AU7A 1M1EB 1OCPA 1TW3A 1IXCA 3E1SA 1A6QA 1G4DA 1HDDC 4MQVA 5H6QA 2E34A 2KJCA 1JT6A 3RDIA 5H6RA 3S3NA 4KITB 4D0PA 4PSXA 3MFKA 2D5VA 1HOMA 2XAGA 2DTRA 4MEYF 5TRDA 2HR3A 1WJFA 4WWCA 2LR8A 4YFNF 2FNPA 4RDUA 4BXXJ 2MYSA 2X1EA 1FIAA 2VJIA 3DEWA 5IT9Z 3GWZA 3KPHA 2IBDA 5ILSA 2M1BA 1J2XA 3JRAA 1YE9A 2F5DA 4G7ZF 1HC8A 4B1RA 4A2UA 3BLYA 2LBFB 1LE8B 2L3DA 4L5IA 3I5UA 5H2FC 3CCJI 3ZMUA 1BC8C 1XG1A 2FXAA 2OA4A 1ITYA 1IO2A 2LFBA 1DU6A 4XKCA 4LB6B 4PJJA 3CCSI 1ZR4A 3BG3A 3RYPA 4E4HA 1FYKA 2A07F 1XN7A 4LLLA 5CJ9A 5FKMA 3V8JA 4EJVA 5JVTA 5ED4A 1D0XA 4NQWA 1VQOI 3C2BA 2HOSA 1R49A 5KNLA 4ESJA 1JJ8C 3ZQIA 2WADA 1PP7U 1ZN2A 3JRGA 1N77A 2JSCA 2CW0F 1MBFA 4BGDA 1YG2A 2PEXA 3KCCA 1IN5A 4KDPA 5BS6A 1Q1HA 1MMSA 3P9CA 4IRIA 5D6FA 1OKRA 1V55H 3E5XA 4N0BA 1O4XA 2ELJA 1OCZH 5EZGA 4HF1A 3ONQA 2NS0A 3DPUA 4IOCF 5EEAA 4UNOA 1WHUA 5DDGA 3WTYC 2IS4A 1K6YA 2BGCA 3F0CA 5F0FA 4DW6A 1K83J 5CQEA 2PN6A 1GVJA 3CJNA 1DP3A 1W7PD 4M3EA 5E1WA 5ILUA 2DFIA 3K1PA 1D1CA 3WE3A 4PJNA 1H9TA 4QWQA 4IPAA 2WB1A 2ID3A 1IRGA 2P0WA 2OJED 4KIBA 4KFCA 1X3UA 4GXOA 3VWBA 3GEZA 1WRJA 1F36A 4BH9A 2HQ5A 3H0GJ 4I01A 1SVMA 2IAIA 9ANTA 3GTPJ 2KHMA 3DWLE 1U0JA 4ENNA 1MBEA 1Z3YA 1RUNA 1VQ6I 2F5EA 2LVSA 2HPIA 2CQXA 4AIJA 1LE8A 1ZELA 4BEHB 2VI6A 5DD4A 5DCMA 1MNEA 5HDNA 2H27A 1X1PA 2Z2SB 1ZGWA 3DTIA 4NC6A 3HPGA 4A3IJ 5HLHA 3KETA 3PSIA 5HOOA 1FWZA 4HX7A 3J80K 2VKEA 5FROA 4GCVA 4RGXA 1BR1A 4ESFA 1ZAOA 2CU7A 1TP4A 4KUMA 2A05A 3FMSA 4CA0A 4IO9F 4RS8A 2KMUA 2IA0A 3CCUI 1V4RA 3F22A 3D5SC 1SVLA 2MH9A 2G0EA 5BPDA 2H1LA 2EZKA 3LSMA 5LRRA 5D5WB 1FNNA 1WH5A 3GTGJ 3DF8A 3FM3A 3L1PA 4UVCA 3DQVC 4CYCA 2XPUA 4A3JJ 2ZB9A 2M5WA 4P1WA 5BPIA 5LEJA 1S7OA 1IN8A 4U0YA 1PUFB 3WHCA 1DQUA 1V5FA 4A5MA 5FD6A 1BC7C 3R61A 2JPCA 3ELKA 4XK4A 1DGRM 2ZSHB 3EETA 2E2JJ 1XC5A 5F1JA 2Y9YA 3M9AA 4V2GA 1OCOH 1H8AC 2PLYA 2EPFA 1SAXA 1A5JA 2ADUA 3Q9VA 2V7FA 5IOYA 2VE8A 2DXIA 1TT5B 1USSA 2L54A 4ZDLA 5K7FA 3JTHA 3Q0WA 1RETA 3ZN1A 2IGMA 5D6EA 4BS9A 4CUGA 2HZDA 3SDGA 2R7TA 1ZGJA 4O3MA 4O5VA 2DDBA 2KIQA 4KA4A 1F1ZA 5E8GA 2F2EA 4AVPA 4XICA 4IX7A 3SQNA 1GUUA 1WFXA 4A3BJ 2MLGA 1BN5A 3HOVJ 1MKMA 3KFWX 4F91B 1E3PA 4YIFA 2PMZA 3I54A 3K0LA 1JGGA 2NNNA 3K2AA 2MD5A 2IA1A 3J81Z 3CD6I 1ULYA 3B6CA 2A6EF 3ZN0A 1S9HA 5EYRA 3ZPLA 2JA8J 1ETOA 5FKOA 2XF5A 5TJJA 2DMNA 1UJ8A 1FP2A 1G3SA 3EQLF 1BR4A 3VEPA 2MFZA 1LNWA 1G59A 4CCLA 2EA4A 3ABTA 2O6GE 3FX3A 3H9GA 3V7CA 3ZP5A 2QQ9A 2V1NA 3CJQB 3KYCB 2DYRH 5E3LA 2EFWA 4FCYA 2ECBA 1B4AA 3CP2A 2FD5A 3J7AY 2O8XA 3VOEA 4A3MJ 2CQQA 5GADJ 2ACJA 2NRAC 3M8EA 4I7HA 3K4NA 3WU2C 4CZZA 3M4OJ 3OSGA 4WF2A 1ON1A 2M0MA 3CCRI 2HVRA 2EIMH 1MBHA 1RKTA 2MA3A 3R4KA 4GYGA 1Z91A 1Z67A 1Y1WJ 1LVAA 2EJRA 3ABKH 4BNCA 1FBQA 2XGEA 4D5FA 3OS0A 3JRBA 5J8FA 4BJTA 3R6SA 1JJ6C 1FSEA 5HDGA 3M7GA 3WHBA 4BAYA 4N9HA 3I59A 2CQ7A 2VQLA 2Y0SN 5KK1A 2K9SA 2OBPA 1R5HA 3FKIJ 3WODF 4AYBN 4O6JA 2GZWA 2ETHA 1AWCA 2QBYB 2ZCWA 2BXYA 2XGDA 3LFKA 2HNHA 3HOZJ 4XRFA 4LB5A 1OYWA 3OYHA 5K1YA 5L3DA 4XKWA 5K7ZA 5L3EA 3UNGC 3E6MA 1BI2A 1R1UA 2R7OA 4WXHA 3G2BA 1WI3A 4FQGA 1P9QC 1FY7A 1YQAA 3GF2A 4EJWA 2KZVA 4AWXB 3RPUA 2M45A 2DA7A 4PGGA 2NVTJ 3PO3J 3A4CA 2STTA 5CVVA 4IF4A 2FMYA 3PO2J 3E6CC 2HDCA 5HLGA 2CUZA 1FMWA 3OYNA 2NVQJ 4CGZA 1SFUA 2J5OA 4J19A 4IKFA 1IRFA 2PX9A 5GPCA 1BI1A 2AXTC 4ON0A 1O3SA 4Y13A 4BE2A 3OOPA 2H6BA 2E5ZA 4C2UA 1W36C 4A0YA 4EV0A 4MNUA 1ZRFA 4HYEA 1GHCA 3M07A 3H9QA 1KU2A 2VIXA 3CUQB 2R7RA 1JTXA 3AKZA 3QU3A 2GOMA 2K4JA 4ITVA 1I6HJ 2V9KA 1BA5A 1ODDA 2QZ8A 5F0HA 2TRTA 3BTIA 3HBLA 5GAEJ 1QO0D 3OMYA 2EV0A 2VKHA 1BIBA 2JVGA 2HWVA 4PZJA 2E2HJ 2QBYA 4X6AJ 3G1OA 2M8GX 2DU9A 3H92A 1Z7UA 2CSOA 1GXPA 2NOJB 4PDKA 1I5ZA 4E7HA 1E2XA 4ENKA 3OS1A 1XSVA 3K2ZA 2RN7A 2EZLA 5CYVA 5A2QZ 2M2EA 1TQIA 5IP7J 5DM7F 4BXFA 1Z9CA 5F1RA 1T38A 1UHSA 4KIFA 1GT0C 5ERIA 4OINF 2CMPA 2KZGA 4II2A 3DKYA 3RYRA 3TBIA 1YFHA 1A35A 2IRFG 2LH9A 5DD8A 4E7LA 2PBIA 1FTTA 3ZMSA 3X2QH 4XLFA 2PMUA 3K7AJ 2FU4A 3MKLA 1W0UA 4R8HA 2RVCA 2XPWA 3ZQ7A 2R5ZA 3HTSB 1IUYA 4MTDA 4YRVA 4Y52J 3VSKA 3FXQA 2KLOA 3MD2A 5D8LB 5FRMA 3L2VA 1QA6A 3BDDA 1LJ9A 4RLFA 3Q0UA 3U9GA 3U1DA 4L9JA 4GFBA 2WV0A 2OUMA 2E1MB 2UZKA 3K4LA 4C30A 4C9YA 3BY6A 1RNLA 3CDIA 3GCMA 5GP9A 3RPUD 1OR7C 2RNJA 3Q9SA 5KAIC 3H35A 4BDYA 2R7QA 2Y2ZA 1X1CA 4PJLA 5HLIA 5K7HA 2NYXA 3DU6A 4M9SA 4DZJA 3V42A 2ZNZA 4Y17A 2XB5A 1SD4A 1IF1A 1HCRA 1TLHB 4YIRX 4IJAA 2CW8A 4EEFG 2QLZA 2YR2A 1YO5C 1LFUP 4M9XA 4HSTA 4A3KJ 1IRZA 1BOAA 3FK6A 3WGGA 5B1AH 1F43A 2RNGA 1K4SA 1XGOA 1Y56A 3KYDB 1UB9A 3F23A 2HKXA 4NNJA 2FEZA 3LQQA 3FXKA 5KVRA 4I76A 1KYZA 4A6DA 3HC7A 2QYOA 1ENHA 4HAMA 2E60A 2WTEA 4J00A 3ASNH 4IQ4A 1I1SA 3WTVC 3DTEA 1YLFA 3VYUB 4G12A 3ZR8X 5F08A 5LHGA 3LFUA 4ZYGA 1IN6A 3FHZA 3O2PE 1G3WA 3FKJA 1Z6RA 2L7FP 1R1TA 2QVOA 3CUQC 1MSEC 4IHTA 1Y0UA 3HRMA 1JGSA 1TBXA 3DXJF 3CLQA 2XGCA 2PG4A 3UR3C 2QM3A 3M3YJ 2XF6A 4XKVA 1Y6IA 2H94A 3QYFA 3P9KA 1PP8F 5BNGA 3SZGA 1MMGA 5D5UB 2GLOA 2W25A 2WWYA 1J7KA 2EB7A 4AIDA 2DPUA 1MBKA 3MMYB 4B8XA 3K10A 3VYSB 1SD6A 2FA5A 4XRSA 3HOUJ 3H36A 2BHYA 2P4WA 2PJRB 2Y30A 3C2HA 3AL0B 3PIPF 4XOPA 2O0YA 5HNFA 3GFLA 2Q0OA 4F7ZA 1MDMA 3W2VA 3JAMZ 3FZVA 2VBZA 3TOAA 2FBHA 2Y0SA 1I27A 4XORA 2E5NA 2LYCA 1IV8A 4XLEA 2EIJH 2E2IJ 4WX9A 4E7KA 2YU9J 4AYBA 4MHGA 2OAZA 2G9WA 4UV8A 1O3TA 3DBHB 3T1BA 1Y8QB 2DA5A 2JA2A 1U8BA 2BW3A 3CTAA 1KA8A 4CH7A 5B5EC 2ECCA 3F8FA 3OYBA 1MMDA 3L09A 2GIZA 4ZTFA 3K1MA 1FTZA 3JW4A 3HRUA 1VNDA 4EGZA 1GLNA 1ZRDA 2DBBA 4F52A 2A5WA 5FKLA 3E6DA 2ZXWH 2M87A 1Y1VJ 1U6GA 1B8IB 3MZHA 1WJBA 1WJ5A 3BG7A 1K6OA 1VQKI 5LRSA 2MC3A 4LLGF 3BQYA 3HIFA 5FKNA 2R5YA 3AG1H 1IDZA 1KQ8A 2VKDA 3MQ0A 1VQNI 3FM5A 1T0FA 2A6TA 2CJJA 2V1DA 5EG0A 4DIQA 4YFKF 5CVJA 1V5GA 4W97A 1S6LA 1YHQI 2N8GA 2A3SA 4JX5A 1MGTA 1ZKGA 2R7UA 3BJAA 1ERDA 2NVYJ 4CCOA 1AOYA 4H4KC 1X1AA 4PGHA 2BY1A 3OWTA 4WXDA 2AQEA 2HEOA 5LHIA 3KZYA 1HKSA 4LG3A 2KDZA 3S1RJ 1FYMA 5F0CA 1HKTA 2E1NA 4CDGA 3JRCA 4KN7X 4XSZF 3LSJA 1BI0A 3KEOA 4L5EA 6PAXA 1ZGAA 1B6AA 1C0WA 3CCEI 4HEA2 1QGPA 2X6YA 1A36A 2C6YA 4XIDA 2PMZN 3RKXA 5L3GA 2JA5J 1X4OA 3O8HA 5FLXZ 2Y9ZA 2O03A 4I99C 3ERED 2HYGD 2G7UA 4FASD 3I9V2 1B8IA 1QPIA 3K9TA 4P55A 2VBWA 3S1QJ 4ZZDA 5HODA 1WQ2A 2LG4A 1WCMJ 3KEYA 4M6XA 3AL0C 5J4YA 3PJRA 1EA3A 4I6ZA 1RKWA 4I09A 5E1ZB 5EDNA 1X2MA 3EUHC 3J7ZI 3G6EI 5CPRB 3BJ6A 1NG7A 4EJUA 3RQ4A 1IG7A 1X1BA 1W7PA 2HQNA 1QQIA 4MIMA 2I8DA 5C4JJ 5D4RA 3P7NA 3AG4H 1IN7A 2MH2A 4ZZLA 4XN0A 1SC7A 1SFEA 3RKQA 3HJEA 2DOAA 1JE8A 3GMEA 1SMYF 3MVPA 4FISA 3DPTA 2IS6A 3R60A 1LFPA 3TO7A 1TTYA 1RR8C 2X1DA 1QNTA 2OQRA 2Z3YA 3ZRGA 2LC2A 3LA2A 2XKOA 4XNFA 1XGMA 2DLLA 2VN2A 3NQOA 2LY9A 5E20A 1BR2A 5K5OA 2IGOA 1HW1A 1EH7A 2KDOA 5FJ8J 3NRVA 2X48A 2XAQA 4HA8A 5E3OA 1P4WA 2Y31A 1PUEE 2ELKA 5CKTA 3OV8A 2JA7J 3JRHA 2R7XA 4KJZA 1VFCA 4PFOA 2V1XA 1T56A 3DFGA 3HHHA 3EYYA 2LD5A 3CJTB 5ILVA 5D5VB 5IYDJ 1B72B 4XSXF 4L0ZB 5HDKA 5ICFA 3WU0A 3KP3A 3S17J 1EF4A 1QHHD 2QSFX 2P5VA 2GBYA 2R7ZJ 2GWRA 3BPVA 1OFCX 2R4GA 1P4AA 2Z1DA 2M7AA 2Z16A 5E1XA 1LUJB 2XPVA 1LPQA 4AC0A 1EKEA 1B1BA 1OCRH 2XAHA 1IGNA 1QVTA 3ERMA 1D0YA 4OOIA 1D8KA 3FMQA 2YPRA 2KIFA 1T2KA 4M3GA 5TGTA 1DU0A 4AM3A 1ZH5A 1NK2P 3DKXA 3TW7A 2VJJA 3MEXA 1SFKA 1L3LA 4U88A 3L2RA 3S8PA 3U2RA 3BR1A 1E0EA 1KZHA 4KT6A 1TNTA 5B1BH 1GVDA 3F72A 3ZMVA 2IGNA 2A6HF 1T08B 3MZYA 2M7BA 2P81A 4B3AA 2GQQA 2L7ZA 3T0YA 3OYAA 1H9GA 3IL2A 1EV7A 1D3YA 5M3MJ 2W84A 3HOWJ 4HNTA 1Z0XA 3SZTA 2LLKA 2DQRA 2RV8A 3D5LA 2LBFA 4IL6C 4QPOA 2OTJI 2Q8KA 1G3YA 1JHFA 1QZEA 1I3AA 1F4KA 2XASA 3V8LA 1QBJA 2WC2A 1LFBA 4HQMA 3QYEA 2KISA 5LEKA 1TNSA 1KU3A 3HSFA 3TMOA 2UWMA 2B63J 3HGGA 1UG2A 3CMYA 4RAZA 2L7KA 1YW8A 1PDNC 2W24A 3BZCA 4V2FA 5M5XJ 2KT0A 1GDTA 1TQPA 4BJ5C 1V54H 2LF8A 5FGMA 3RZDJ 3TGNA 1U78A 2NS8A 2L9SA 1ETXA 3SXYA 5ICEA 3DLLF 2GXGA 3HM5A 4CHUA 1WI9A 1YW7A 2F4MB 3VYRB 3VSLA 2OV7A 5IP6A 1YS7A 3LSIA 1MD0A 4P9FA 2CYYA 3PQJA 4BE1A 3GTQJ 2HGCA 1MSFC 1VQLI 1LDJA 1BJAA 1R1VA 2VXDA 3M8FA 3GTLJ 2D1HA 4TV7A 3Q0VA 4HNVA 2LTPA 3TP0A 5E3MA 3M1CA 1QZZA 2DJNA 4ZYEA 5LGNA 2LDUA 1T95A 2EFPA 3H3ZA 3HUGB 3G1LA 2LY1A 4LK0F 1N78A 1DPUA 2AS5F 3VDXA 2FSWA 3HKZA 1JUSA 4FE4A 2OF7A 4BEHA 2MW8A 1DUXC 4E7JA 3RI4A 4RGUA 4N9IA 4AVZA 1XTAA 2Y48A 5EGOB 2XF7A 3AG2H 4AU7A 3ZCOA 1CQTA 1MNMC 1TWCJ 1JKPC 4OIPF 1REPC 1GV5A 4IXAA 1HA8A 3JRFA 4HNUA 2EINH 4U0WA 3HPHA 4N4OB 4F92B 1XMKA 2FBKA 4HLXA 2BY2A 3H5AA 4DOZA 2R0QC 5LHHA 2VBYA 2UV1A 3ECOA 3CC7I 4IHVA 4Q5SF 3FXJA 3H3VK 1ETQA 5DUKA 2KRHA 1RI7A 5KHDA 1K78B 2LY2A 1ZHFA 3K1NA 2HZTA 1PUFA 1WJDA 3MWMA 2DCEA 4NUBA 4RGRA 3EPZA 4ZC3A 3BZ6A 2V26A 3GFMA 1RRJA 2PJPA 4M71A 1E3OC 2VQHA 2ZNYA 4L0YB 4RAYA 3CUOA 4XOTA 2FX0A 2CRGA 4AD9A 3J80Z 1U5TB 2EZIA 3JRDA 2E35A 2DODA 4KN4X 3BTCA 2LKPA 4EGYA 4LG0B 4P96A 2DA4A 4D9JA 4BQNA 3HSEA 4ETSA 5IT3A 4XBFA 3HUGA 1UG0A 3FISA 4A3CJ 2K9NA 1D1AA 3EUKL 2B0LA 2DK8A 3C1DA 5K5RA 1YJ9I 2X9DA 3E7LA 4IVNA 3LOCA 1AHDP 5BMZA 4X1EA 5E17F 1ETWA 4ABZA 4K2EA 3RIRA 2QEXI 4FTHA 5D8KB 4M9ZA 2LMDA 1ZREA 3ZQQA 4M6YA 5GPAA 4HLYA 1Z6TA 2Z99A 3BG9A 1S7EA 2CFOA 2UUZA 3CF2A 2L5QA 4CCNA 3U21A 1UELB 3BR2A 3OIPA 3SDBA 3CJRB 3HOTA 1KYWA 2EWNA 1YITI 4MTEA 2ISZA 4AUXA 2M30A 3LSPA 3BROA 3KEQA 1HW5A 1LKXA 1FT9A 5IOZA 2Z5UA 3HRTA 5FLMJ 2DTZA 1FOKA 3I3LA 3LWFA 1OCTC 1FSHA 1W4MA 1ON2A 4ANJA 3JSPA 2O7OA 1R4MB 2WY7Q 2M4KA 4XRSG 1TL8A 2K3FA 2CO5A 2X6XA 3GFJA 4OMYA 2FMLA 1D0ZA 2JT1A 2V1UA 2Q1ZB 5GTHC 1TWGJ 5IYBJ 1I39A 1W0TA 2VE9A 3ZOBA 1HDPA 2BZTA 2MBFA 4LG0A 2P6TA 4OAZA 1YIOA 2AQFA 3ROUA 4F93B 1FEXA 5IYCJ 3LL7A 4F55A 1BBYA 2Q2EB 4IHWA 4EQQA 1MJ9A 1SD5A 2EFNA 2JWTA 2DI3A 2VQCA 2HQAA 3O6BB 4L5JA 1OMIA 4CCKA 4XQFA 1YJNI 1XSXA 2H1KA 2GXAA 3GO5A 2XAUA 1HF0A 3D0SA 1VQ5I 1TWFJ 2PMHA 2EFQA 3TKYA 4HV6A 3CF5F 3FXOA 1JXSA 3L2UA 1HSJA 4IRGA 2GIVA 4RGSA 1OISA 2M3AA 4IEJA 2R93J 5D4SA 1O3QA 1WZ2A 2MLKA 3OL4A 3K70C 1OR7A 3F8NA 3N97A 1O57A 3A01B 1MMAA 4LITA 4CICA 2IW5A 4BQOA 5M5WJ 2L7MP 2L9RA 2GXBA 3V7RA 1U8RA 1U5TC 4C2MJ 3K4MA 1W5TA 2VOPA 2JRMA 1B9MA 2DYSH 4PFPA 2STWA 2R7FA 2XC7A 3HOSA 3PFIA 3IRQA 2TCTA 3W2AA 4YIIA 1MH3A 3RSNA 1W36D 2FQ4A 2DA6A 4EJOA 3ESWB 5E79C 4C3HJ 2CQKA 4KNYA 3S3OA 5J8CA 4AIHA 2E1OA 3FMRA 3D1NI 2XRLA 3IH4A 2XSJC 5KCMA 2V4JC 3W3CA 2FNAA 3ZQHA 3JTGA 2DMUA 2Q2EA 3WTUC 3AFHA 2VC1A 2YX4A 1NK3P 1YIJI 2ISYA 4M73A 4E7ZA 3PFYA 1Q1VA 3W6JB 4G94A 4G6QA 3LNQA 2ZMEB 4LGWA 2IJLA 3N4MA 4UUVA 4XLHA 2VASA 3BQZA 1R58A 2KJBA 4HX4A 3CO6C 3GUDA 2R7WA 3CUQA 2DMQA 4ESBA 4ZH4F 2HQRA 4FX4A 4Y7NJ 2CUEA 2BY0A 1XDSA 4HW0A 2COMA 2JA6J 4LLNA 3TOBA 2QQBA 2CWEA 3E5QA 2H6CA 4WCGA 3A01A 1SFXA 4KMUX 2JVHA 1T33A 4XLNF 2VONA 2DT6A 2RC4A 3BTJA 2NNYA 2HFHA 2VODA 1FBSA 2D2WA 3DLAA 3BC8A 1FOYA 2W4SA 3AG3H 4G6TB 3RCOA 2E19A 5LGTA 4D7NA 2DN0A 4A3DJ 1MMNA 3A02A 3HG9A 3FIWA 2IVMA 5J6XA 3EYIA 2QA4I 2YSRA 3S15J 3G1MA 4EATA 4OAYA 3I64A 4FHTA 4BQAA 5F6FA 4MFEA 3BZKA 1JI8A 4E7SA 2D45A 2P5KA 1Z7LA 1RUOA 3H1CA 1P6RA 2JQ7A 2NOGA 3MKWB 3HTUA 4P9UA 1JT0A 3RKYA 3QP6A 1F9NA 4UUSB 2VT3A 1OYYA 1R71A 2JK3A 2L0KA 4Y3OA 3I56I 3FXUA 2DA1A 2GAUA 5JHUA
chains in the Genus database with same CATH topology
4MIMA 3WHCA 2R5ZB 1PUFB 5C4JJ 4M3BA 1IDYA 4C3JJ 2RAEA 4XK4A 3BR0A 2COBA 2E2JJ 3RKQA 1XC5A 5F1JA 2XSDC 4FISA 3MVPA 2AO9A 2Y9YA 4V2GA 1H8AC 2VPRA 3A03A 1A5JA 5IOYA 2FJ1A 4M6VA 1JKQC 1IV6A 4M3DA 4DYCA 3SFIA 1NTCA 2LY9A 1D5YA 5K7FA 5M5YJ 3Q0WA 1RETA 5J1YA 3SDGA 3RQIA 5FJ8J 3ZQLA 2X48A 5E3OA 3PM1A 2Y31A 2CUFA 2ELKA 4XICA 4RBOA 2JA7J 1GUUA 3JRHA 4A3BJ 1VFCA 1ETVA 3HOVJ 2HXIA 1GV2A 2JMWA 2LK2A 1T56A 4JYKA 2LD5A 1JGGA 3K2AA 1MH4A 5IYDJ 1AKHB 3B6CA 1B72B 1BL0A 2DMPA 5EYRA 4JX6A 1EF4A 3LSGA 1IUFA 3S17J 2GBYA 3Q3SA 2R7ZJ 2JA8J 1ETOA 1OFCX 5FKOA 4M3FA 2DMNA 2GM4A 2XPVA 4DYRA 1R9TJ 4AC0A 1YRNB 1WGXA 1IGNA 1QVTA 3TEDA 5E3LA 4M3GA 1DU0A 4FCYA 1NK2P 2ECBA 1QVUA 3TW7A 2X6OA 5FLVA 2MGQA 2IEKA 4MFDA 2FD5A 3S14J 4A3MJ 1RESA 2CQQA 1UMQA 3BR1A 4D7MA 2H8RA 2ME6A 1APLC 1GVDA 1Z77A 3M4OJ 4B3AA 2P81A 1ETYA 3HKZN 3OSGA 2VKVA 2L7ZA 3W6VA 2EH3A 2LP0A 1MBHA 1RKTA 4BY1J 1Y1WJ 4UUTA 2XB0X 3VPRA 2WV1A 2XGEA 2YUSA 5M3MJ 4D5FA 3JRBA 3HOWJ 1Z0XA 1JJ6C 2LLKA 3WHBA 5DS9A 1JUMA 3LSRA 2Y0SN 1TWAJ 2K9SA 2DA3A 2EBIA 2MSYA 2M0CA 3FKIJ 3OSFA 4AYBN 1LFBA 1X58A 5C3EJ 4JX4A 5IP9J 2XGDA 3HOZJ 3OIOA 3RZOJ 5K7ZA 2B63J 3HGGA 1UG2A 3CMYA 2DA2A 1YRNA 4S0HB 4JP0A 4MLOA 1U9OA 1WI3A 4V2FA 5M5XJ 2KT0A 1GDTA 3RZDJ 3S1NJ 3B6AA 1U78A 2NS8A 3GBGA 3PO3J 2DA7A 2NVTJ 1ETXA 3PO2J 1ZTRA 3HM5A 3UKGA 4A3FJ 2NVQJ 5IP6A 1VF9A 4J19A 2NS7A 4A93J 5GPCA 3GTQJ 1MSFC 5J3LA 4QSHA 3GTLJ 2W48A 3Q0VA 4HNVA 2R5YB 2LTPA 3TP0A 5E3MA 2DJNA 3JREA 3QQAA 1RR7A 2MG4A 3G1LA 5EG0B 3O8GA 2K9QA 1JUSA 3S16J 1IC8A 1U9NA 1JTXA 4FE4A 2OF7A 4MO7A 2MW8A 2LKXA 1I6HJ 3GTMJ 1BA5A 4FE7A 5F0HA 2TRTA 2WB1N 3BTIA 3HBLA 4QIWN 1I3QJ 5EGOB 1H88C 3I4NJ 2HDDA 2E2HJ 4X6AJ 3G1OA 2M8GX 1CQTA 1MBJA 1MNMC 4A3LJ 1TWCJ 1JKPC 1GV5A 5DTDA 3JRFA 3BR5A 2EZLA 4NDLA 1TC3C 2M2EA 2DMTA 5IP7J 5C4XJ 1P7IA 1UHSA 1GT0C 2R0QC 4IHYA 4UUSA 2ME0A 1FTTA 3S2DJ 4IHVA 3H3VK 2I10A 1ETQA 3K7AJ 3MKLA 1W0UA 4BKXA 2XPWA 5JLWA 2M9HA 2R5ZA 1PUFA 2AHQA 1E3OC 4Y52J 3DCFA 3SJMA 1A6IA 3IH2A 2QF7A 4A69C 3TW6A 2FX0A 2O8KA 3IH3A 2CRGA 2R92J 3Q0UA 4XRMA 2EZIA 3JRDA 4GFBA 3BTCA 1ZR2A 4A3EJ 5GP9A 2DA4A 4D5CA 1G2HA 2HI3A 4BBSJ 2Y2ZA 1XS9A 5K7HA 3FISA 4CYCB 4A3CJ 2K9NA 4DZJA 2X9DA 2XB5A 1ZK8A 3E7LA 3LOCA 1AHDP 1HCRA 4X1EA 4DYQA 1ETWA 5F04A 1LFUP 4EEFG 4ABZA 3GTJJ 4A3KJ 5F27A 4FTHA 1IRZA 3FK6A 1F43A 5GPAA 3HOXJ 1JTYA 1POGA 3BG9A 1S7EA 3MN2A 1AKHA 3JR9A 3NAUA 2K40A 1B72A 4I76A 1HLVA 1JKRC 2HYJA 3BR2A 5J1UA 4QTRA 2EZHA 2HXOA 3S1MJ 1ENHA 1JUPA 1SANA 2OPTA 5FKKA 2O9LA 3BG5A 4AUXA 3LSPA 3JRIA 4G12A 5IOZA 5F08A 5FLMJ 1BJZA 2DTZA 1OCTC 2JJ7A 2O7OA 4XRSG 1K61A 2YS9A 4BBRJ 1ETKA 2L7FP 1ZQ3P 1MSEC 3HEFA 1TWGJ 5IYBJ 1W0TA 3QPSA 3ZOBA 1HDPA 3CDLA 1RPWA 2XGCA 1FEXA 5IYCJ 1IJWC 1SFOJ 3M3YJ 4IHWA 3HB9A 3GTKJ 5BNGA 2JWTA 3I4MJ 2EQRA 3NARA 1H89C 3CQZJ 2GLOA 2H1KA 1OJLA 5IPAA 1HF0A 1VI0A 5JLXA 1TWFJ 1MBKA 5EZHA 4XRSA 5EF6A 3HOUJ 4IHXA 1FIPA 4IEJA 2R93J 1TWHJ 2Y30A 3TP3A 2VUMJ 1P7JA 1ORKA 5M3FJ 3ZQGA 1BW5A 1AU7A 1OCPA 1HDDC 1JT6A 3A01B 3HDDA 5M5WJ 2L7MP 2D5VA 2L9RA 2E2IJ 1HOMA 4C2MJ 2LR8A 1I50J 1WH7A 2YU9J 4RDUA 4BXXJ 1FIAA 1U8BA 2DA5A 3DEWA 2IBDA 2TCTA 3IV5A 1X2NA 3JRAA 1MH3A 2ECCA 2FQ4A 2DA6A 4B1RA 5J1RA 2HOTA 1LE8B 2HOAA 1FTZA 4C3HJ 1VNDA 4LOCA 1XG1A 1ITYA 1DU6A 2LFBA 1ZR4A 3BG3A 5FKLA 2E1OA 1Y1VJ 3D1NI 2XRLA 1B8IB 3BTLA 5FKMA 3IH4A 3ZQHA 2DMUA 3C2BA 2HOSA 2QCOA 3CCYA 1JJ8C 3BQYA 3ZQIA 1NK3P 5FKNA 2R5YA 1IDZA 1Q1VA 3JRGA 1MBFA 3LNQA 2CJJA 5EG0A 3GTOJ 4W97A 5E3NA 3BQZA 2N8GA 4W1UA 3ZQFA 4JX5A 1O4XA 4DZPA 2DMQA 1ZKGA 4B4CA 5EZGA 2NVYJ 5EEAA 3BR6A 4Y7NJ 2CUEA 5EGOA 1QRYA 3F0CA 5F0FA 4DW6A 2JA6J 1K83J 2ID6A 1FJLA 4M3EA 2KDZA 3A01A 3S1RJ 1MBGA 1T33A 2NVXJ 5F0CA 3ZQCA 2ID3A 3BTJA 3JRCA 4A3GJ 3BT9A 3LSJA 1F36A 2HQ5A 3H0GJ 4L5EA 9ANTA 2IAIA 3GTPJ 4C3IJ 1WPKA 1MBEA 2E19A 2JN6A 2LVSA 4D7NA 2DN0A 2CQXA 1LE8A 4A3DJ 3A02A 2VI6A 4XIDA 2PMZN 3OOUA 3HOYJ 3FIWA 3QPLA 2JA5J 3O8HA 2Y9ZA 1ZGWA 2WAQN 3S15J 4A3IJ 3G1MA 1B8IA 1QPIA 1BW6A 2VKEA 2CU7A 4MFEA 3S1QJ 5HODA 2M34A 4BY7J 3S2HJ 1WCMJ 1JKOC 2NOGA 4I6ZA 1RKWA 2G0EA 1JT0A 2EZKA 3HGYA 5EDNA 1WH5A 1X2MA 4UUSB 3BR3A 3GTGJ 3L1PA 2JK3A 2L0KA 3FK7A 4CYCA 2XPUA 4A3JJ 2ZB9A 2DA1A 5C44J 1IG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIM A;  3WHC A;  2R5Z B;  1PUF B;  5C4J J;  4M3B A;  1IDY A;  4C3J J;  2RAE A;  4XK4 A;  3BR0 A;  2COB A;  2E2J J;  3RKQ A;  1XC5 A;  5F1J A;  2XSD C;  4FIS A;  3MVP A;  2AO9 A;  2Y9Y A;  4V2G A;  1H8A C;  2VPR A;  3A03 A;  1A5J A;  5IOY A;  2FJ1 A;  4M6V A;  1JKQ C;  1IV6 A;  4M3D A;  4DYC A;  3SFI A;  1NTC A;  2LY9 A;  1D5Y A;  5K7F A;  5M5Y J;  3Q0W A;  1RET A;  5J1Y A;  3SDG A;  3RQI A;  5FJ8 J;  3ZQL A;  2X48 A;  5E3O A;  3PM1 A;  2Y31 A;  2CUF A;  2ELK A;  4XIC A;  4RBO A;  2JA7 J;  1GUU A;  3JRH A;  4A3B J;  1VFC A;  1ETV A;  3HOV J;  2HXI A;  1GV2 A;  2JMW A;  2LK2 A;  1T56 A;  4JYK A;  2LD5 A;  1JGG A;  3K2A A;  1MH4 A;  5IYD J;  1AKH B;  3B6C A;  1B72 B;  1BL0 A;  2DMP A;  5EYR A;  4JX6 A;  1EF4 A;  3LSG A;  1IUF A;  3S17 J;  2GBY A;  3Q3S A;  2R7Z J;  2JA8 J;  1ETO A;  1OFC X;  5FKO A;  4M3F A;  2DMN A;  2GM4 A;  2XPV A;  4DYR A;  1R9T J;  4AC0 A;  1YRN B;  1WGX A;  1IGN A;  1QVT A;  3TED A;  5E3L A;  4M3G A;  1DU0 A;  4FCY A;  1NK2 P;  2ECB A;  1QVU A;  3TW7 A;  2X6O A;  5FLV A;  2MGQ A;  2IEK A;  4MFD A;  2FD5 A;  3S14 J;  4A3M J;  1RES A;  2CQQ A;  1UMQ A;  3BR1 A;  4D7M A;  2H8R A;  2ME6 A;  1APL C;  1GVD A;  1Z77 A;  3M4O J;  4B3A A;  2P81 A;  1ETY A;  3HKZ N;  3OSG A;  2VKV A;  2L7Z A;  3W6V A;  2EH3 A;  2LP0 A;  1MBH A;  1RKT A;  4BY1 J;  1Y1W J;  4UUT A;  2XB0 X;  3VPR A;  2WV1 A;  2XGE A;  2YUS A;  5M3M J;  4D5F A;  3JRB A;  3HOW J;  1Z0X A;  1JJ6 C;  2LLK A;  3WHB A;  5DS9 A;  1JUM A;  3LSR A;  2Y0S N;  1TWA J;  2K9S A;  2DA3 A;  2EBI A;  2MSY A;  2M0C A;  3FKI J;  3OSF A;  4AYB N;  1LFB A;  1X58 A;  5C3E J;  4JX4 A;  5IP9 J;  2XGD A;  3HOZ J;  3OIO A;  3RZO J;  5K7Z A;  2B63 J;  3HGG A;  1UG2 A;  3CMY A;  2DA2 A;  1YRN A;  4S0H B;  4JP0 A;  4MLO A;  1U9O A;  1WI3 A;  4V2F A;  5M5X J;  2KT0 A;  1GDT A;  3RZD J;  3S1N J;  3B6A A;  1U78 A;  2NS8 A;  3GBG A;  3PO3 J;  2DA7 A;  2NVT J;  1ETX A;  3PO2 J;  1ZTR A;  3HM5 A;  3UKG A;  4A3F J;  2NVQ J;  5IP6 A;  1VF9 A;  4J19 A;  2NS7 A;  4A93 J;  5GPC A;  3GTQ J;  1MSF C;  5J3L A;  4QSH A;  3GTL J;  2W48 A;  3Q0V A;  4HNV A;  2R5Y B;  2LTP A;  3TP0 A;  5E3M A;  2DJN A;  3JRE A;  3QQA A;  1RR7 A;  2MG4 A;  3G1L A;  5EG0 B;  3O8G A;  2K9Q A;  1JUS A;  3S16 J;  1IC8 A;  1U9N A;  1JTX A;  4FE4 A;  2OF7 A;  4MO7 A;  2MW8 A;  2LKX A;  1I6H J;  3GTM J;  1BA5 A;  4FE7 A;  5F0H A;  2TRT A;  2WB1 N;  3BTI A;  3HBL A;  4QIW N;  1I3Q J;  5EGO B;  1H88 C;  3I4N J;  2HDD A;  2E2H J;  4X6A J;  3G1O A;  2M8G X;  1CQT A;  1MBJ A;  1MNM C;  4A3L J;  1TWC J;  1JKP C;  1GV5 A;  5DTD A;  3JRF A;  3BR5 A;  2EZL A;  4NDL A;  1TC3 C;  2M2E A;  2DMT A;  5IP7 J;  5C4X J;  1P7I A;  1UHS A;  1GT0 C;  2R0Q C;  4IHY A;  4UUS A;  2ME0 A;  1FTT A;  3S2D J;  4IHV A;  3H3V K;  2I10 A;  1ETQ A;  3K7A J;  3MKL A;  1W0U A;  4BKX A;  2XPW A;  5JLW A;  2M9H A;  2R5Z A;  1PUF A;  2AHQ A;  1E3O C;  4Y52 J;  3DCF A;  3SJM A;  1A6I A;  3IH2 A;  2QF7 A;  4A69 C;  3TW6 A;  2FX0 A;  2O8K A;  3IH3 A;  2CRG A;  2R92 J;  3Q0U A;  4XRM A;  2EZI A;  3JRD A;  4GFB A;  3BTC A;  1ZR2 A;  4A3E J;  5GP9 A;  2DA4 A;  4D5C A;  1G2H A;  2HI3 A;  4BBS J;  2Y2Z A;  1XS9 A;  5K7H A;  3FIS A;  4CYC B;  4A3C J;  2K9N A;  4DZJ A;  2X9D A;  2XB5 A;  1ZK8 A;  3E7L A;  3LOC A;  1AHD P;  1HCR A;  4X1E A;  4DYQ A;  1ETW A;  5F04 A;  1LFU P;  4EEF G;  4ABZ A;  3GTJ J;  4A3K J;  5F27 A;  4FTH A;  1IRZ A;  3FK6 A;  1F43 A;  5GPA A;  3HOX J;  1JTY A;  1POG A;  3BG9 A;  1S7E A;  3MN2 A;  1AKH A;  3JR9 A;  3NAU A;  2K40 A;  1B72 A;  4I76 A;  1HLV A;  1JKR C;  2HYJ A;  3BR2 A;  5J1U A;  4QTR A;  2EZH A;  2HXO A;  3S1M J;  1ENH A;  1JUP A;  1SAN A;  2OPT A;  5FKK A;  2O9L A;  3BG5 A;  4AUX A;  3LSP A;  3JRI A;  4G12 A;  5IOZ A;  5F08 A;  5FLM J;  1BJZ A;  2DTZ A;  1OCT C;  2JJ7 A;  2O7O A;  4XRS G;  1K61 A;  2YS9 A;  4BBR J;  1ETK A;  2L7F P;  1ZQ3 P;  1MSE C;  3HEF A;  1TWG J;  5IYB J;  1W0T A;  3QPS A;  3ZOB A;  1HDP A;  3CDL A;  1RPW A;  2XGC A;  1FEX A;  5IYC J;  1IJW C;  1SFO J;  3M3Y J;  4IHW A;  3HB9 A;  3GTK J;  5BNG A;  2JWT A;  3I4M J;  2EQR A;  3NAR A;  1H89 C;  3CQZ J;  2GLO A;  2H1K A;  1OJL A;  5IPA A;  1HF0 A;  1VI0 A;  5JLX A;  1TWF J;  1MBK A;  5EZH A;  4XRS A;  5EF6 A;  3HOU J;  4IHX A;  1FIP A;  4IEJ A;  2R93 J;  1TWH J;  2Y30 A;  3TP3 A;  2VUM J;  1P7J A;  1ORK A;  5M3F J;  3ZQG A;  1BW5 A;  1AU7 A;  1OCP A;  1HDD C;  1JT6 A;  3A01 B;  3HDD A;  5M5W J;  2L7M P;  2D5V A;  2L9R A;  2E2I J;  1HOM A;  4C2M J;  2LR8 A;  1I50 J;  1WH7 A;  2YU9 J;  4RDU A;  4BXX J;  1FIA A;  1U8B A;  2DA5 A;  3DEW A;  2IBD A;  2TCT A;  3IV5 A;  1X2N A;  3JRA A;  1MH3 A;  2ECC A;  2FQ4 A;  2DA6 A;  4B1R A;  5J1R A;  2HOT A;  1LE8 B;  2HOA A;  1FTZ A;  4C3H J;  1VND A;  4LOC A;  1XG1 A;  1ITY A;  1DU6 A;  2LFB A;  1ZR4 A;  3BG3 A;  5FKL A;  2E1O A;  1Y1V J;  3D1N I;  2XRL A;  1B8I B;  3BTL A;  5FKM A;  3IH4 A;  3ZQH A;  2DMU A;  3C2B A;  2HOS A;  2QCO A;  3CCY A;  1JJ8 C;  3BQY A;  3ZQI A;  1NK3 P;  5FKN A;  2R5Y A;  1IDZ A;  1Q1V A;  3JRG A;  1MBF A;  3LNQ A;  2CJJ A;  5EG0 A;  3GTO J;  4W97 A;  5E3N A;  3BQZ A;  2N8G A;  4W1U A;  3ZQF A;  4JX5 A;  1O4X A;  4DZP A;  2DMQ A;  1ZKG A;  4B4C A;  5EZG A;  2NVY J;  5EEA A;  3BR6 A;  4Y7N J;  2CUE A;  5EGO A;  1QRY A;  3F0C A;  5F0F A;  4DW6 A;  2JA6 J;  1K83 J;  2ID6 A;  1FJL A;  4M3E A;  2KDZ A;  3A01 A;  3S1R J;  1MBG A;  1T33 A;  2NVX J;  5F0C A;  3ZQC A;  2ID3 A;  3BTJ A;  3JRC A;  4A3G J;  3BT9 A;  3LSJ A;  1F36 A;  2HQ5 A;  3H0G J;  4L5E A;  9ANT A;  2IAI A;  3GTP J;  4C3I J;  1WPK A;  1MBE A;  2E19 A;  2JN6 A;  2LVS A;  4D7N A;  2DN0 A;  2CQX A;  1LE8 A;  4A3D J;  3A02 A;  2VI6 A;  4XID A;  2PMZ N;  3OOU A;  3HOY J;  3FIW A;  3QPL A;  2JA5 J;  3O8H A;  2Y9Z A;  1ZGW A;  2WAQ N;  3S15 J;  4A3I J;  3G1M A;  1B8I A;  1QPI A;  1BW6 A;  2VKE A;  2CU7 A;  4MFE A;  3S1Q J;  5HOD A;  2M34 A;  4BY7 J;  3S2H J;  1WCM J;  1JKO C;  2NOG A;  4I6Z A;  1RKW A;  2G0E A;  1JT0 A;  2EZK A;  3HGY A;  5EDN A;  1WH5 A;  1X2M A;  4UUS B;  3BR3 A;  3GTG J;  3L1P A;  2JK3 A;  2L0K A;  3FK7 A;  4CYC A;  2XPU A;  4A3J J;  2ZB9 A;  2DA1 A;  5C44 J;  1IG7 A; 
#chains in the Genus database with same CATH topology
 4XL9 A;  1K4T A;  1SMT A;  2EA2 A;  3MZ8 A;  4AIK A;  4M74 A;  4M3B A;  1IDY A;  1O7L A;  5LD2 C;  4C3J J;  2COB A;  4FX0 A;  4HV5 A;  2XSD C;  3SYT A;  1O3R A;  3BP8 A;  4BHC A;  2AO9 A;  2E71 A;  3WTW C;  3MKY B;  5E18 F;  4Y33 A;  1IXR C;  4J01 A;  2VPR A;  3HL2 A;  3A03 A;  4BJ6 C;  2B7E A;  2L01 A;  1OPC A;  2EV6 A;  2FJ1 A;  1PVE A;  4M6V A;  1IV6 A;  1HKQ A;  4M3D A;  2DO7 A;  3OYK A;  2A61 A;  3ISP A;  1NTC A;  3SFI A;  3WTX C;  4B09 A;  4BL0 B;  2FQ3 A;  3EDP A;  4ZDO A;  5L3C A;  5M5Y J;  3FXL A;  3FDY A;  4H0E A;  3OL3 A;  3RQI A;  1KON A;  4U7B A;  3H0D A;  3RTR A;  5HS8 A;  3L2W A;  2ZXJ A;  1W1W E;  3REO A;  2CUF A;  2IP2 A;  4RBO A;  1LEB A;  2ZJR F;  2ZME C;  2DFE A;  2EIL H;  4KIG A;  1ETV A;  2HXI A;  2JMW A;  2LK2 A;  4JBA A;  3OYM A;  1BOB A;  3DKW A;  4R79 A;  4U87 A;  1AKH B;  4UHT A;  3V8K A;  5EEG A;  2DMP A;  2WAQ A;  5JFR A;  2M8E A;  5B66 C;  4JX6 A;  2E7X A;  1IUF A;  4MEX F;  3RPQ A;  4V19 K;  5CLS A;  2F5C A;  1ZYR F;  3GXO A;  3N05 A;  1CF7 B;  1R9T J;  5FB2 A;  4IQJ A;  4QLC U;  1WGX A;  1FMV A;  2DOF A;  2VJ5 A;  3DTK A;  4LMY A;  4G9Y A;  3CCQ I;  4UB6 C;  4PJ0 C;  2R7V A;  3IKT A;  1MW7 A;  1NG6 A;  3TED A;  3IUO A;  1HQC A;  3I53 A;  1SAU A;  2K3P A;  2NVU B;  2PJR A;  1QVU A;  2X6O A;  3K4K A;  2MGQ A;  1EJ9 A;  3S14 J;  1WWX A;  4GO1 A;  3WTS C;  3A1Y A;  3HHG A;  2CG4 A;  2IXS A;  1UMQ A;  3DV8 A;  1J75 A;  2ME6 A;  4A0X A;  4E70 A;  3EUH A;  4WK8 F;  2ZBK A;  2H09 A;  5JVG F;  4XLP F;  1G8X A;  3CCV I;  3TDZ C;  2HYF A;  2MC4 A;  1BM9 A;  1ETY A;  2XIG A;  3HKZ N;  2VKV A;  2IGK A;  1X1D A;  2EH3 A;  3KE2 A;  1MJB A;  1ZG5 A;  4B44 A;  1R5G A;  4UUT A;  2DT7 B;  1LDD A;  2MAB A;  3LSH A;  4NBQ A;  3VPR A;  5IT9 K;  5DEQ A;  4LK1 F;  3R0A A;  3TO9 A;  3I71 A;  4Z6Y A;  3RKW A;  5DS9 A;  3VOD A;  3QU6 A;  3L2C A;  1JUM A;  2DT5 A;  3LSR A;  2EK5 A;  4BE0 A;  2BVM A;  2ZFW A;  1PJR A;  3P9I A;  3DU5 A;  2DA3 A;  2EBI A;  1IAW A;  2M0C A;  2QKM B;  5FFZ A;  2VB6 A;  3GVA A;  5L3B A;  4OIQ F;  4RB0 A;  2V6C A;  3RJP A;  2R7S A;  1EH6 A;  2CFX A;  3I0T A;  5DM6 F;  5C3E J;  4JX4 A;  5IP9 J;  3V7S A;  4Y15 A;  3ABL H;  4BQQ A;  1UCR A;  1D5V A;  5JHF A;  3RZO J;  4HG2 A;  4FET A;  2DA2 A;  2XRN A;  3IWF A;  2HOE A;  1N75 A;  2M4G A;  2QEN A;  4S0H B;  2ZFU A;  4MLO A;  2IS1 A;  2LKS A;  5CVU A;  1WKM A;  3S1N J;  2LNB A;  1QHG A;  4CXF A;  5FO5 A;  2XHK A;  2OD5 A;  1WJA A;  3ML6 A;  1ZG1 A;  4HDU A;  2DAO A;  3ASO H;  4QPQ A;  4BUP A;  1ZTR A;  4XM3 A;  5K5Q A;  1MZB A;  4E6K G;  4BDZ A;  2XGX A;  1Z1D A;  1XX5 A;  2NS7 A;  3F21 A;  2KP6 A;  2LSO A;  3FHN A;  2DOE A;  4HX8 A;  1G6N A;  4NQW B;  1DPR A;  5J3L A;  1GXQ A;  4GGG A;  1XMX A;  2CW7 A;  1J09 A;  3IAS 2;  1UAA A;  4DNC A;  3G3Z A;  3F6O A;  2XUB A;  4L9N A;  4RAG A;  2RQP A;  3JRE A;  2EFO A;  2KQR A;  4A6E A;  1BI3 A;  1V3F A;  4A0Z A;  1T8I A;  1IW7 F;  1X3Z B;  4OIR F;  3NEU A;  4B43 A;  1T98 A;  4IRH A;  1IC8 A;  3KP4 A;  3ECH A;  1R7J A;  2ZO4 A;  2G7H A;  4EM2 A;  2RRE A;  2YX7 A;  2Z9O A;  4QIW N;  1KGS A;  1I3Q J;  1H88 C;  4LIV A;  1IXS B;  1XDU A;  2I5U A;  2HDD A;  4BHB A;  3WTZ A;  1TZL A;  3L9F A;  2BV6 A;  1MBJ A;  4A3L J;  5EEH A;  5DTD A;  3S3M A;  4RB1 A;  4C2T A;  3COA C;  3WU1 B;  3ULQ B;  4DQ2 A;  2OCE A;  1VTN C;  1UZC A;  2BEO A;  1OCC H;  2NAZ A;  2LRD A;  3O3K A;  3J7A O;  3IAM 2;  1E3H A;  2FOK A;  3PL8 A;  4IHY A;  2KRC A;  3QWL A;  1HBX G;  1Z21 A;  4YG2 F;  2I10 A;  1R4N B;  2QUF A;  3ZMD A;  4BKX A;  5DCM B;  3C7J A;  4HBL A;  5DV5 A;  1NHA A;  2DJI A;  1LDK B;  3SJM A;  4GRI A;  1A6I A;  1RZ4 A;  2QF7 A;  3IH2 A;  3TW6 A;  2O8K A;  3IH3 A;  1RIO H;  3HRS A;  4RLQ A;  4BHP A;  2XV4 S;  2EIK H;  1R22 A;  3DBL B;  2PFB A;  1ZR2 A;  1VQ9 I;  1VQ7 I;  2RGV A;  3GYH X;  2XAJ A;  2V79 A;  2LF7 A;  2UXN A;  2A5Y B;  4Z2Y A;  2HI3 A;  3OS2 A;  3ZMZ A;  1XS9 A;  4PSW A;  2V9V A;  3ZGK A;  4CYC B;  4L9T A;  2FRH A;  2JRT A;  2L02 A;  5JI6 A;  2K27 A;  1JHH A;  1FC3 A;  3OR2 C;  4LJZ F;  4G7H F;  5F04 A;  2DQL A;  3SEQ A;  3OYI A;  2QKL B;  3NWT A;  2WA0 A;  5F27 A;  1RC9 A;  1ZAR A;  2HU9 A;  4IOA F;  3DPL C;  3MKZ A;  3HOX J;  1JTY A;  1POG A;  2BHZ A;  2ZSI B;  2CV2 A;  2DW4 A;  3J81 K;  3CLO A;  3FBI B;  3JR9 A;  2K40 A;  4Q48 A;  2CS3 A;  2HTS A;  3F6V A;  3Q5F A;  1HLV A;  1B72 A;  2KKO A;  4ZTJ A;  2EZH A;  2P6S A;  3PQK A;  1SAN A;  4RM2 A;  3CC2 I;  4U0V A;  1TQM A;  2K85 A;  5FKK A;  3GZ5 A;  2O9L A;  3BG5 A;  4XR6 A;  5B3S H;  4KT5 C;  1BJZ A;  2ZJ2 A;  2JJ7 A;  2KPM A;  1R00 A;  2A68 F;  1P4X A;  2JUC A;  2E7W A;  1Z05 A;  2W85 A;  2YS9 A;  4BBR J;  1ETK A;  2VL8 A;  5J47 A;  1XD7 A;  5DUI A;  1YJW I;  4XON A;  2FBI A;  3KP6 A;  2IA2 A;  3CP8 A;  3CDL A;  3QOD A;  3KP7 A;  3HZJ A;  3GLX A;  2V9P A;  2Y75 A;  4EJT A;  1FOW A;  2WAE A;  3S2W A;  2P5L C;  3HB9 A;  3GTK J;  2EQR A;  3NAR A;  1F5T A;  3CQZ J;  5CVI A;  2O61 A;  3KP2 A;  1XMA A;  4I0A A;  4CCM A;  4DBQ A;  5IPA A;  3WG9 A;  4LD5 A;  3V4G A;  1VI0 A;  3CDH A;  2HPM A;  3OYC A;  2F4O B;  1T6S A;  4EVI A;  5EZH A;  4B48 A;  3BPX A;  5EF6 A;  3A0H C;  2K9L A;  5FRN A;  1FIP A;  4KYW A;  1TWH J;  1LQ1 A;  2CGP A;  4JOM A;  3TP3 A;  1VQ4 I;  1ORK A;  5M3F J;  3ZQG A;  5JR3 A;  1BW5 A;  2BY3 A;  1YX3 A;  2F48 A;  1H0M A;  3L2Q A;  2P7C B;  3LSK A;  3A2K A;  1LEA A;  3HDD A;  1S29 A;  4BAC A;  1XCV A;  4HZF A;  5D5X B;  4EMS A;  2EV5 A;  2L4A A;  4OMZ A;  2K7L A;  1I6X A;  4HSR A;  1I50 J;  1WH7 A;  5DYM A;  4XN3 A;  2HS5 A;  4Q4Z F;  2HTJ A;  1YOV B;  3IV5 A;  1X2N A;  1KQ0 A;  1SVO A;  5J1R A;  2HOT A;  2QWW A;  4ENJ A;  3I59 B;  2HOA A;  2X85 A;  2KIM A;  4HRI A;  4LOC A;  3OYL A;  1UHW A;  5LFA A;  1VQP I;  3BCB A;  1S3J A;  1W5C C;  2FE3 A;  1KU7 A;  2P8T A;  3BTL A;  3WGH A;  5HNH A;  2QSG X;  3OYE A;  3I4P A;  3HSR A;  1QU3 A;  3F3X A;  3F8B A;  3CZ6 A;  2ZXI A;  2L9N A;  3LA7 A;  2QCO A;  3CCY A;  3GZN B;  3BWG A;  2LOO A;  5H20 A;  4BYY A;  4ENM A;  4HOB A;  4PCQ A;  2RDP A;  3KLO A;  1B9N A;  3K4B A;  3K69 A;  3GTO J;  5E3N A;  4W1U A;  3ZQF A;  4L18 B;  1FX7 A;  4DZP A;  2XDV A;  5KAF C;  4B4C A;  3SEZ A;  4ZJZ A;  3G71 I;  2KRF A;  3BR6 A;  3CES A;  3J7Y J;  4UVB A;  4ZYH A;  3T8R A;  5EGO A;  1QRY A;  2LRE A;  3LMM A;  2ID6 A;  3CMA I;  3F9K A;  1VQ8 I;  1FJL A;  2FUG 2;  1MBG A;  1S72 I;  1ZG3 A;  3ZQC A;  2ESH A;  2NVX J;  4NC7 A;  2B9S A;  5A2Q K;  4A3G J;  2WAF A;  3BT9 A;  3LST A;  1S7A A;  1I1G A;  3L7W A;  2VOO A;  3QAH A;  3G73 A;  4C3I J;  3KZZ A;  1WPK A;  4P5O A;  3GZ6 A;  2JN6 A;  3LQR A;  1Y39 A;  3EUA A;  1LB2 A;  1K78 A;  1XSD A;  1AA7 A;  1WVR A;  3OOU A;  5L3F A;  4A12 A;  3ZMT A;  3DP7 A;  4EM0 B;  4E7I A;  3HOY J;  2XVC A;  3GW2 A;  3QPL A;  2E36 A;  2RKH A;  2VT2 A;  2BE5 F;  2VC0 A;  2WAQ N;  4KIC A;  4ZYA A;  5J40 A;  4UVA A;  2DDA A;  3IWZ A;  1BW6 A;  1WJC A;  1U5T A;  4NB5 A;  2M34 A;  4BY7 J;  5BQT A;  1SEU A;  2IPQ X;  2L4M A;  3S2H J;  1JKO C;  3TL4 X;  2WBM A;  3W6K B;  3FBN B;  1O7F A;  2W1O A;  2PI0 A;  4RA2 A;  3HGY A;  3LA3 A;  3BR3 A;  4GYI A;  2Z33 A;  2XKP A;  3FK7 A;  4I02 A;  4F3Q A;  5C44 J;  3C18 A;  4ZYD A;  1FOX A;  1S8N A;  2R5Z B;  2CH0 A;  1A31 A;  2RAE A;  3BR0 A;  1DDN A;  1WJE A;  4NC8 A;  2R7D A;  5ICC A;  1Y0N A;  2X51 A;  1N25 A;  2X4H A;  2ICW G;  1R23 A;  2F4I A;  3LAP A;  1JKQ C;  2D1V A;  2F6C A;  4XLC A;  1FYL A;  3BJO A;  3FXM A;  4DYC A;  3PNV A;  1D5Y A;  3CO7 C;  1LVK A;  2TDX A;  2OC6 A;  3M1E A;  2V6E A;  3PUB A;  5J1Y A;  4FT8 A;  2QSH X;  3ZQL A;  1XB4 A;  3B02 A;  3PM1 A;  2XRO A;  2JZY A;  5DCF A;  3TDU C;  3R0J A;  3IHU A;  5ICG A;  5HS7 A;  4OIO F;  2BXZ A;  2BOL A;  5GTI C;  2X1C A;  2DPD A;  1GV2 A;  3OYF A;  4JYK A;  3K6G A;  2VXZ A;  1PYV A;  4PJM A;  2DK5 A;  1MH4 A;  3PIO F;  3OYG A;  3BG6 A;  5HVQ C;  4JK1 X;  3K4J A;  2ZKZ A;  4CYD A;  2E1C A;  1BL0 A;  3SZP A;  3K70 D;  3LSG A;  1OLT A;  3DBR B;  2HDW A;  3Q3S A;  1W5S A;  3H5N A;  4MGR A;  5CQG A;  1U2W A;  3SFZ A;  2CUJ A;  4UY8 I;  2K4B A;  4M3F A;  2GM4 A;  2QGU A;  2GA2 A;  4DYR A;  1YRN B;  3B73 A;  1YI2 I;  1OQY A;  1YX5 A;  2OTL I;  1SD7 A;  3L00 A;  2W82 A;  3WTT C;  2YU3 A;  4CCJ A;  2NXN B;  2CQN A;  4U7D A;  3I55 I;  2HVQ A;  2K5C A;  4R1H A;  1HW2 A;  2QQ8 A;  1TW2 A;  1FZP B;  5FLV A;  1MIJ A;  2BVL A;  2IEK A;  3F8M A;  4MFD A;  1RES A;  2KL4 A;  3QPT A;  3GX4 X;  4D7M A;  2H8R A;  1VQM I;  1APL C;  3OIQ A;  3JAM K;  1UST A;  1Z77 A;  4I98 B;  1FPQ A;  3H3U A;  4S05 A;  1UFM A;  3W6V A;  3IRR A;  2LP0 A;  2CV1 A;  4BY1 J;  3DEU A;  2XB0 X;  1Y8R B;  2BYV E;  2WV1 A;  4HQE A;  5GAH J;  1R6R A;  2YUS A;  5HLT A;  1P92 A;  3GLL A;  1ONV A;  4BXU A;  2IT0 A;  4OWR B;  3VB2 A;  2X0L A;  3BCA A;  5EJC A;  1HST A;  1TWA J;  3WG7 H;  2W00 A;  3FXR A;  2K9M A;  3CCM I;  2MSY A;  3H5R A;  3OSF A;  2Y69 H;  1IN4 A;  2GOX B;  4ZDP A;  4B47 A;  2VPL A;  3PNY A;  4RB3 C;  1MDM B;  1ZLK A;  2PQ8 A;  3PNT A;  1X58 A;  3AAF A;  1J59 A;  1UHM A;  4MQ9 F;  4M72 A;  3OIO A;  4A5N A;  5LLQ A;  4D1Q A;  1CGP A;  1YRN A;  4PUS A;  4JP0 A;  3QYB A;  5FFX A;  1U9O A;  2ZME A;  2BW3 B;  1WSU A;  2KFD A;  2QQA A;  1IZ1 A;  1T39 A;  4CO8 A;  3DEE A;  3QP5 A;  2JPB A;  4LFU A;  3D5R C;  3B6A A;  3LAJ A;  3I58 A;  3KLN A;  4YFX F;  2VJ4 A;  4UV9 A;  4GDF A;  3GBG A;  3KYL A;  4RAF A;  2ESN A;  3UKG A;  4A3F J;  3KIO A;  2ZC2 A;  2GA1 A;  2L9V A;  1VF9 A;  2JTV A;  1E17 A;  4A93 J;  3QOP A;  4UXN A;  4B3X A;  5E8I A;  1KU9 A;  1Z3X A;  4I0B A;  4QSH A;  2HVS A;  2W48 A;  4HF2 A;  1ZRC A;  2VBX A;  2R5Y B;  2FOW A;  1RR7 A;  3QQA A;  2MG4 A;  2KIU A;  5EG0 B;  1J0R A;  3O8G A;  4CZC A;  1K79 A;  2K9Q A;  3TQN A;  3S16 J;  3MCZ A;  1U9N A;  2LKX A;  4MO7 A;  2DFH A;  2RQQ A;  3CME I;  1VZ0 A;  3GTM J;  4ASN A;  3QOE A;  3F8C A;  4FE7 A;  2X6W A;  3E6B A;  2WB1 N;  5FLX K;  4YEJ A;  2L2O A;  3I4N J;  2JUG A;  1FLI A;  1ZLJ A;  2K02 A;  2OQG A;  1DP7 P;  3C2G A;  4Y4R A;  5CVR A;  2W7N A;  2VLA A;  4CSW A;  3BR5 A;  1BIA A;  3KZI C;  4NDL A;  1TC3 C;  2DMT A;  1J9I A;  5C4X J;  1P7I A;  4HDV A;  1V5E A;  2E1M C;  1QZY A;  3PSF A;  5LBQ A;  3OYD A;  4G6D A;  3QRF F;  1FBU A;  4UUS A;  2ME0 A;  4RMN A;  4RB2 C;  3MAJ A;  3S2D J;  1NH3 A;  4IHS A;  3C3W A;  4PK4 A;  4XLA A;  5GAG J;  1J5Y A;  2FF4 A;  1X19 A;  3PUF A;  1MND A;  5JLW A;  2M9H A;  1B59 A;  4II3 A;  4JQF A;  4DGW B;  3M8J A;  4G8X A;  2AHQ A;  1XGN A;  3DCF A;  3FWE A;  1OYI A;  3IP4 B;  3BOQ A;  4A69 C;  2R92 J;  1R5I D;  4LIU A;  4S04 A;  4XRM A;  1K7A A;  4HPQ A;  4WXC A;  4N4N B;  4UB8 C;  3T8T A;  2OZ6 A;  4A3E J;  4BU2 A;  1A04 A;  5AIQ A;  1HXD A;  2A69 F;  3E5U A;  4D5C A;  1YTY A;  1X3W B;  4RM3 A;  1G2H A;  3E0J B;  4BBS J;  1G3T A;  1YS6 A;  3HXL A;  4OU0 A;  4Q47 A;  2P7V B;  4XKB A;  5HS9 A;  2ZJQ F;  2ZXH A;  3QPH A;  3KP5 A;  5F64 A;  3WE2 A;  1ZK8 A;  1W7P B;  5IY5 H;  3WGI A;  1ACI A;  4DYQ A;  2J5P A;  4KIS A;  3GTJ J;  2MD0 A;  3S32 A;  2JSP A;  2O3F A;  4XMY A;  2DFF A;  2AXL A;  5BOX A;  3CCL I;  1L0O C;  2F5V A;  3CMM A;  3S93 A;  5AIP A;  4I2O A;  5J4V A;  3MN2 A;  2IS2 A;  3IKV A;  1AKH A;  1YYV A;  3NAU A;  3OR1 C;  1P2F A;  4DBR A;  1JKR C;  1STZ A;  2HYJ A;  5J1U A;  2ZJP F;  1QPM A;  2HXO A;  4QTR A;  1D8J A;  3IC7 A;  4IZZ A;  3S1M J;  4DJA A;  1JUP A;  3CC4 I;  3A0B C;  3ABM H;  2OPT A;  3SHF A;  2H8W A;  3JSO A;  1CF7 A;  5TIS C;  2K86 A;  3OYJ A;  1XCB A;  3JRI A;  1YW9 A;  2BBY A;  3E3V A;  1TT0 A;  2W57 A;  2OU2 A;  4HF0 A;  3K4C A;  1T0F C;  1DGW Y;  3E97 A;  4KMF A;  1K61 A;  3JCU C;  1D1B A;  5LGU A;  1KQ9 A;  1ZQ3 P;  2OZU A;  4G7O F;  1X4P A;  2CV0 A;  3HEF A;  2XAF A;  3U1K A;  2Y0M A;  3QPS A;  1RPW A;  1S5L C;  1U3E M;  3ZXS A;  2O5R A;  2ELH A;  2F5F A;  1SFO J;  1IJW C;  3T5X A;  3OY9 A;  4EM1 A;  1MJA A;  3TO6 A;  4YEL A;  1XPX A;  3P5J A;  4NHJ A;  3I4M J;  1H89 C;  1R36 A;  2R3S A;  2UXX A;  1OJL A;  2OCC H;  4L9V A;  3VYT B;  3FF5 A;  1EH8 A;  5JLX A;  5AON A;  3KX2 A;  3NWS A;  3VFZ A;  4X0G A;  2VQG A;  3ABU A;  3H9J A;  2WY8 Q;  3W2W A;  5FD5 A;  3G4S I;  3GFI A;  4IHX A;  1FP1 D;  1XGS A;  3HYI A;  1IRX A;  2VUM J;  1P7J A;  2HKO A;  1AU7 A;  1M1E B;  1OCP A;  1TW3 A;  1IXC A;  3E1S A;  1A6Q A;  1G4D A;  1HDD C;  4MQV A;  5H6Q A;  2E34 A;  2KJC A;  1JT6 A;  3RDI A;  5H6R A;  3S3N A;  4KIT B;  4D0P A;  4PSX A;  3MFK A;  2D5V A;  1HOM A;  2XAG A;  2DTR A;  4MEY F;  5TRD A;  2HR3 A;  1WJF A;  4WWC A;  2LR8 A;  4YFN F;  2FNP A;  4RDU A;  4BXX J;  2MYS A;  2X1E A;  1FIA A;  2VJI A;  3DEW A;  5IT9 Z;  3GWZ A;  3KPH A;  2IBD A;  5ILS A;  2M1B A;  1J2X A;  3JRA A;  1YE9 A;  2F5D A;  4G7Z F;  1HC8 A;  4B1R A;  4A2U A;  3BLY A;  2LBF B;  1LE8 B;  2L3D A;  4L5I A;  3I5U A;  5H2F C;  3CCJ I;  3ZMU A;  1BC8 C;  1XG1 A;  2FXA A;  2OA4 A;  1ITY A;  1IO2 A;  2LFB A;  1DU6 A;  4XKC A;  4LB6 B;  4PJJ A;  3CCS I;  1ZR4 A;  3BG3 A;  3RYP A;  4E4H A;  1FYK A;  2A07 F;  1XN7 A;  4LLL A;  5CJ9 A;  5FKM A;  3V8J A;  4EJV A;  5JVT A;  5ED4 A;  1D0X A;  4NQW A;  1VQO I;  3C2B A;  2HOS A;  1R49 A;  5KNL A;  4ESJ A;  1JJ8 C;  3ZQI A;  2WAD A;  1PP7 U;  1ZN2 A;  3JRG A;  1N77 A;  2JSC A;  2CW0 F;  1MBF A;  4BGD A;  1YG2 A;  2PEX A;  3KCC A;  1IN5 A;  4KDP A;  5BS6 A;  1Q1H A;  1MMS A;  3P9C A;  4IRI A;  5D6F A;  1OKR A;  1V55 H;  3E5X A;  4N0B A;  1O4X A;  2ELJ A;  1OCZ H;  5EZG A;  4HF1 A;  3ONQ A;  2NS0 A;  3DPU A;  4IOC F;  5EEA A;  4UNO A;  1WHU A;  5DDG A;  3WTY C;  2IS4 A;  1K6Y A;  2BGC A;  3F0C A;  5F0F A;  4DW6 A;  1K83 J;  5CQE A;  2PN6 A;  1GVJ A;  3CJN A;  1DP3 A;  1W7P D;  4M3E A;  5E1W A;  5ILU A;  2DFI A;  3K1P A;  1D1C A;  3WE3 A;  4PJN A;  1H9T A;  4QWQ A;  4IPA A;  2WB1 A;  2ID3 A;  1IRG A;  2P0W A;  2OJE D;  4KIB A;  4KFC A;  1X3U A;  4GXO A;  3VWB A;  3GEZ A;  1WRJ A;  1F36 A;  4BH9 A;  2HQ5 A;  3H0G J;  4I01 A;  1SVM A;  2IAI A;  9ANT A;  3GTP J;  2KHM A;  3DWL E;  1U0J A;  4ENN A;  1MBE A;  1Z3Y A;  1RUN A;  1VQ6 I;  2F5E A;  2LVS A;  2HPI A;  2CQX A;  4AIJ A;  1LE8 A;  1ZEL A;  4BEH B;  2VI6 A;  5DD4 A;  5DCM A;  1MNE A;  5HDN A;  2H27 A;  1X1P A;  2Z2S B;  1ZGW A;  3DTI A;  4NC6 A;  3HPG A;  4A3I J;  5HLH A;  3KET A;  3PSI A;  5HOO A;  1FWZ A;  4HX7 A;  3J80 K;  2VKE A;  5FRO A;  4GCV A;  4RGX A;  1BR1 A;  4ESF A;  1ZAO A;  2CU7 A;  1TP4 A;  4KUM A;  2A05 A;  3FMS A;  4CA0 A;  4IO9 F;  4RS8 A;  2KMU A;  2IA0 A;  3CCU I;  1V4R A;  3F22 A;  3D5S C;  1SVL A;  2MH9 A;  2G0E A;  5BPD A;  2H1L A;  2EZK A;  3LSM A;  5LRR A;  5D5W B;  1FNN A;  1WH5 A;  3GTG J;  3DF8 A;  3FM3 A;  3L1P A;  4UVC A;  3DQV C;  4CYC A;  2XPU A;  4A3J J;  2ZB9 A;  2M5W A;  4P1W A;  5BPI A;  5LEJ A;  1S7O A;  1IN8 A;  4U0Y A;  1PUF B;  3WHC A;  1DQU A;  1V5F A;  4A5M A;  5FD6 A;  1BC7 C;  3R61 A;  2JPC A;  3ELK A;  4XK4 A;  1DGR M;  2ZSH B;  3EET A;  2E2J J;  1XC5 A;  5F1J A;  2Y9Y A;  3M9A A;  4V2G A;  1OCO H;  1H8A C;  2PLY A;  2EPF A;  1SAX A;  1A5J A;  2ADU A;  3Q9V A;  2V7F A;  5IOY A;  2VE8 A;  2DXI A;  1TT5 B;  1USS A;  2L54 A;  4ZDL A;  5K7F A;  3JTH A;  3Q0W A;  1RET A;  3ZN1 A;  2IGM A;  5D6E A;  4BS9 A;  4CUG A;  2HZD A;  3SDG A;  2R7T A;  1ZGJ A;  4O3M A;  4O5V A;  2DDB A;  2KIQ A;  4KA4 A;  1F1Z A;  5E8G A;  2F2E A;  4AVP A;  4XIC A;  4IX7 A;  3SQN A;  1GUU A;  1WFX A;  4A3B J;  2MLG A;  1BN5 A;  3HOV J;  1MKM A;  3KFW X;  4F91 B;  1E3P A;  4YIF A;  2PMZ A;  3I54 A;  3K0L A;  1JGG A;  2NNN A;  3K2A A;  2MD5 A;  2IA1 A;  3J81 Z;  3CD6 I;  1ULY A;  3B6C A;  2A6E F;  3ZN0 A;  1S9H A;  5EYR A;  3ZPL A;  2JA8 J;  1ETO A;  5FKO A;  2XF5 A;  5TJJ A;  2DMN A;  1UJ8 A;  1FP2 A;  1G3S A;  3EQL F;  1BR4 A;  3VEP A;  2MFZ A;  1LNW A;  1G59 A;  4CCL A;  2EA4 A;  3ABT A;  2O6G E;  3FX3 A;  3H9G A;  3V7C A;  3ZP5 A;  2QQ9 A;  2V1N A;  3CJQ B;  3KYC B;  2DYR H;  5E3L A;  2EFW A;  4FCY A;  2ECB A;  1B4A A;  3CP2 A;  2FD5 A;  3J7A Y;  2O8X A;  3VOE A;  4A3M J;  2CQQ A;  5GAD J;  2ACJ A;  2NRA C;  3M8E A;  4I7H A;  3K4N A;  3WU2 C;  4CZZ A;  3M4O J;  3OSG A;  4WF2 A;  1ON1 A;  2M0M A;  3CCR I;  2HVR A;  2EIM H;  1MBH A;  1RKT A;  2MA3 A;  3R4K A;  4GYG A;  1Z91 A;  1Z67 A;  1Y1W J;  1LVA A;  2EJR A;  3ABK H;  4BNC A;  1FBQ A;  2XGE A;  4D5F A;  3OS0 A;  3JRB A;  5J8F A;  4BJT A;  3R6S A;  1JJ6 C;  1FSE A;  5HDG A;  3M7G A;  3WHB A;  4BAY A;  4N9H A;  3I59 A;  2CQ7 A;  2VQL A;  2Y0S N;  5KK1 A;  2K9S A;  2OBP A;  1R5H A;  3FKI J;  3WOD F;  4AYB N;  4O6J A;  2GZW A;  2ETH A;  1AWC A;  2QBY B;  2ZCW A;  2BXY A;  2XGD A;  3LFK A;  2HNH A;  3HOZ J;  4XRF A;  4LB5 A;  1OYW A;  3OYH A;  5K1Y A;  5L3D A;  4XKW A;  5K7Z A;  5L3E A;  3UNG C;  3E6M A;  1BI2 A;  1R1U A;  2R7O A;  4WXH A;  3G2B A;  1WI3 A;  4FQG A;  1P9Q C;  1FY7 A;  1YQA A;  3GF2 A;  4EJW A;  2KZV A;  4AWX B;  3RPU A;  2M45 A;  2DA7 A;  4PGG A;  2NVT J;  3PO3 J;  3A4C A;  2STT A;  5CVV A;  4IF4 A;  2FMY A;  3PO2 J;  3E6C C;  2HDC A;  5HLG A;  2CUZ A;  1FMW A;  3OYN A;  2NVQ J;  4CGZ A;  1SFU A;  2J5O A;  4J19 A;  4IKF A;  1IRF A;  2PX9 A;  5GPC A;  1BI1 A;  2AXT C;  4ON0 A;  1O3S A;  4Y13 A;  4BE2 A;  3OOP A;  2H6B A;  2E5Z A;  4C2U A;  1W36 C;  4A0Y A;  4EV0 A;  4MNU A;  1ZRF A;  4HYE A;  1GHC A;  3M07 A;  3H9Q A;  1KU2 A;  2VIX A;  3CUQ B;  2R7R A;  1JTX A;  3AKZ A;  3QU3 A;  2GOM A;  2K4J A;  4ITV A;  1I6H J;  2V9K A;  1BA5 A;  1ODD A;  2QZ8 A;  5F0H A;  2TRT A;  3BTI A;  3HBL A;  5GAE J;  1QO0 D;  3OMY A;  2EV0 A;  2VKH A;  1BIB A;  2JVG A;  2HWV A;  4PZJ A;  2E2H J;  2QBY A;  4X6A J;  3G1O A;  2M8G X;  2DU9 A;  3H92 A;  1Z7U A;  2CSO A;  1GXP A;  2NOJ B;  4PDK A;  1I5Z A;  4E7H A;  1E2X A;  4ENK A;  3OS1 A;  1XSV A;  3K2Z A;  2RN7 A;  2EZL A;  5CYV A;  5A2Q Z;  2M2E A;  1TQI A;  5IP7 J;  5DM7 F;  4BXF A;  1Z9C A;  5F1R A;  1T38 A;  1UHS A;  4KIF A;  1GT0 C;  5ERI A;  4OIN F;  2CMP A;  2KZG A;  4II2 A;  3DKY A;  3RYR A;  3TBI A;  1YFH A;  1A35 A;  2IRF G;  2LH9 A;  5DD8 A;  4E7L A;  2PBI A;  1FTT A;  3ZMS A;  3X2Q H;  4XLF A;  2PMU A;  3K7A J;  2FU4 A;  3MKL A;  1W0U A;  4R8H A;  2RVC A;  2XPW A;  3ZQ7 A;  2R5Z A;  3HTS B;  1IUY A;  4MTD A;  4YRV A;  4Y52 J;  3VSK A;  3FXQ A;  2KLO A;  3MD2 A;  5D8L B;  5FRM A;  3L2V A;  1QA6 A;  3BDD A;  1LJ9 A;  4RLF A;  3Q0U A;  3U9G A;  3U1D A;  4L9J A;  4GFB A;  2WV0 A;  2OUM A;  2E1M B;  2UZK A;  3K4L A;  4C30 A;  4C9Y A;  3BY6 A;  1RNL A;  3CDI A;  3GCM A;  5GP9 A;  3RPU D;  1OR7 C;  2RNJ A;  3Q9S A;  5KAI C;  3H35 A;  4BDY A;  2R7Q A;  2Y2Z A;  1X1C A;  4PJL A;  5HLI A;  5K7H A;  2NYX A;  3DU6 A;  4M9S A;  4DZJ A;  3V42 A;  2ZNZ A;  4Y17 A;  2XB5 A;  1SD4 A;  1IF1 A;  1HCR A;  1TLH B;  4YIR X;  4IJA A;  2CW8 A;  4EEF G;  2QLZ A;  2YR2 A;  1YO5 C;  1LFU P;  4M9X A;  4HST A;  4A3K J;  1IRZ A;  1BOA A;  3FK6 A;  3WGG A;  5B1A H;  1F43 A;  2RNG A;  1K4S A;  1XGO A;  1Y56 A;  3KYD B;  1UB9 A;  3F23 A;  2HKX A;  4NNJ A;  2FEZ A;  3LQQ A;  3FXK A;  5KVR A;  4I76 A;  1KYZ A;  4A6D A;  3HC7 A;  2QYO A;  1ENH A;  4HAM A;  2E60 A;  2WTE A;  4J00 A;  3ASN H;  4IQ4 A;  1I1S A;  3WTV C;  3DTE A;  1YLF A;  3VYU B;  4G12 A;  3ZR8 X;  5F08 A;  5LHG A;  3LFU A;  4ZYG A;  1IN6 A;  3FHZ A;  3O2P E;  1G3W A;  3FKJ A;  1Z6R A;  2L7F P;  1R1T A;  2QVO A;  3CUQ C;  1MSE C;  4IHT A;  1Y0U A;  3HRM A;  1JGS A;  1TBX A;  3DXJ F;  3CLQ A;  2XGC A;  2PG4 A;  3UR3 C;  2QM3 A;  3M3Y J;  2XF6 A;  4XKV A;  1Y6I A;  2H94 A;  3QYF A;  3P9K A;  1PP8 F;  5BNG A;  3SZG A;  1MMG A;  5D5U B;  2GLO A;  2W25 A;  2WWY A;  1J7K A;  2EB7 A;  4AID A;  2DPU A;  1MBK A;  3MMY B;  4B8X A;  3K10 A;  3VYS B;  1SD6 A;  2FA5 A;  4XRS A;  3HOU J;  3H36 A;  2BHY A;  2P4W A;  2PJR B;  2Y30 A;  3C2H A;  3AL0 B;  3PIP F;  4XOP A;  2O0Y A;  5HNF A;  3GFL A;  2Q0O A;  4F7Z A;  1MDM A;  3W2V A;  3JAM Z;  3FZV A;  2VBZ A;  3TOA A;  2FBH A;  2Y0S A;  1I27 A;  4XOR A;  2E5N A;  2LYC A;  1IV8 A;  4XLE A;  2EIJ H;  2E2I J;  4WX9 A;  4E7K A;  2YU9 J;  4AYB A;  4MHG A;  2OAZ A;  2G9W A;  4UV8 A;  1O3T A;  3DBH B;  3T1B A;  1Y8Q B;  2DA5 A;  2JA2 A;  1U8B A;  2BW3 A;  3CTA A;  1KA8 A;  4CH7 A;  5B5E C;  2ECC A;  3F8F A;  3OYB A;  1MMD A;  3L09 A;  2GIZ A;  4ZTF A;  3K1M A;  1FTZ A;  3JW4 A;  3HRU A;  1VND A;  4EGZ A;  1GLN A;  1ZRD A;  2DBB A;  4F52 A;  2A5W A;  5FKL A;  3E6D A;  2ZXW H;  2M87 A;  1Y1V J;  1U6G A;  1B8I B;  3MZH A;  1WJB A;  1WJ5 A;  3BG7 A;  1K6O A;  1VQK I;  5LRS A;  2MC3 A;  4LLG F;  3BQY A;  3HIF A;  5FKN A;  2R5Y A;  3AG1 H;  1IDZ A;  1KQ8 A;  2VKD A;  3MQ0 A;  1VQN I;  3FM5 A;  1T0F A;  2A6T A;  2CJJ A;  2V1D A;  5EG0 A;  4DIQ A;  4YFK F;  5CVJ A;  1V5G A;  4W97 A;  1S6L A;  1YHQ I;  2N8G A;  2A3S A;  4JX5 A;  1MGT A;  1ZKG A;  2R7U A;  3BJA A;  1ERD A;  2NVY J;  4CCO A;  1AOY A;  4H4K C;  1X1A A;  4PGH A;  2BY1 A;  3OWT A;  4WXD A;  2AQE A;  2HEO A;  5LHI A;  3KZY A;  1HKS A;  4LG3 A;  2KDZ A;  3S1R J;  1FYM A;  5F0C A;  1HKT A;  2E1N A;  4CDG A;  3JRC A;  4KN7 X;  4XSZ F;  3LSJ A;  1BI0 A;  3KEO A;  4L5E A;  6PAX A;  1ZGA A;  1B6A A;  1C0W A;  3CCE I;  4HEA 2;  1QGP A;  2X6Y A;  1A36 A;  2C6Y A;  4XID A;  2PMZ N;  3RKX A;  5L3G A;  2JA5 J;  1X4O A;  3O8H A;  5FLX Z;  2Y9Z A;  2O03 A;  4I99 C;  3ERE D;  2HYG D;  2G7U A;  4FAS D;  3I9V 2;  1B8I A;  1QPI A;  3K9T A;  4P55 A;  2VBW A;  3S1Q J;  4ZZD A;  5HOD A;  1WQ2 A;  2LG4 A;  1WCM J;  3KEY A;  4M6X A;  3AL0 C;  5J4Y A;  3PJR A;  1EA3 A;  4I6Z A;  1RKW A;  4I09 A;  5E1Z B;  5EDN A;  1X2M A;  3EUH C;  3J7Z I;  3G6E I;  5CPR B;  3BJ6 A;  1NG7 A;  4EJU A;  3RQ4 A;  1IG7 A;  1X1B A;  1W7P A;  2HQN A;  1QQI A;  4MIM A;  2I8D A;  5C4J J;  5D4R A;  3P7N A;  3AG4 H;  1IN7 A;  2MH2 A;  4ZZL A;  4XN0 A;  1SC7 A;  1SFE A;  3RKQ A;  3HJE A;  2DOA A;  1JE8 A;  3GME A;  1SMY F;  3MVP A;  4FIS A;  3DPT A;  2IS6 A;  3R60 A;  1LFP A;  3TO7 A;  1TTY A;  1RR8 C;  2X1D A;  1QNT A;  2OQR A;  2Z3Y A;  3ZRG A;  2LC2 A;  3LA2 A;  2XKO A;  4XNF A;  1XGM A;  2DLL A;  2VN2 A;  3NQO A;  2LY9 A;  5E20 A;  1BR2 A;  5K5O A;  2IGO A;  1HW1 A;  1EH7 A;  2KDO A;  5FJ8 J;  3NRV A;  2X48 A;  2XAQ A;  4HA8 A;  5E3O A;  1P4W A;  2Y31 A;  1PUE E;  2ELK A;  5CKT A;  3OV8 A;  2JA7 J;  3JRH A;  2R7X A;  4KJZ A;  1VFC A;  4PFO A;  2V1X A;  1T56 A;  3DFG A;  3HHH A;  3EYY A;  2LD5 A;  3CJT B;  5ILV A;  5D5V B;  5IYD J;  1B72 B;  4XSX F;  4L0Z B;  5HDK A;  5ICF A;  3WU0 A;  3KP3 A;  3S17 J;  1EF4 A;  1QHH D;  2QSF X;  2P5V A;  2GBY A;  2R7Z J;  2GWR A;  3BPV A;  1OFC X;  2R4G A;  1P4A A;  2Z1D A;  2M7A A;  2Z16 A;  5E1X A;  1LUJ B;  2XPV A;  1LPQ A;  4AC0 A;  1EKE A;  1B1B A;  1OCR H;  2XAH A;  1IGN A;  1QVT A;  3ERM A;  1D0Y A;  4OOI A;  1D8K A;  3FMQ A;  2YPR A;  2KIF A;  1T2K A;  4M3G A;  5TGT A;  1DU0 A;  4AM3 A;  1ZH5 A;  1NK2 P;  3DKX A;  3TW7 A;  2VJJ A;  3MEX A;  1SFK A;  1L3L A;  4U88 A;  3L2R A;  3S8P A;  3U2R A;  3BR1 A;  1E0E A;  1KZH A;  4KT6 A;  1TNT A;  5B1B H;  1GVD A;  3F72 A;  3ZMV A;  2IGN A;  2A6H F;  1T08 B;  3MZY A;  2M7B A;  2P81 A;  4B3A A;  2GQQ A;  2L7Z A;  3T0Y A;  3OYA A;  1H9G A;  3IL2 A;  1EV7 A;  1D3Y A;  5M3M J;  2W84 A;  3HOW J;  4HNT A;  1Z0X A;  3SZT A;  2LLK A;  2DQR A;  2RV8 A;  3D5L A;  2LBF A;  4IL6 C;  4QPO A;  2OTJ I;  2Q8K A;  1G3Y A;  1JHF A;  1QZE A;  1I3A A;  1F4K A;  2XAS A;  3V8L A;  1QBJ A;  2WC2 A;  1LFB A;  4HQM A;  3QYE A;  2KIS A;  5LEK A;  1TNS A;  1KU3 A;  3HSF A;  3TMO A;  2UWM A;  2B63 J;  3HGG A;  1UG2 A;  3CMY A;  4RAZ A;  2L7K A;  1YW8 A;  1PDN C;  2W24 A;  3BZC A;  4V2F A;  5M5X J;  2KT0 A;  1GDT A;  1TQP A;  4BJ5 C;  1V54 H;  2LF8 A;  5FGM A;  3RZD J;  3TGN A;  1U78 A;  2NS8 A;  2L9S A;  1ETX A;  3SXY A;  5ICE A;  3DLL F;  2GXG A;  3HM5 A;  4CHU A;  1WI9 A;  1YW7 A;  2F4M B;  3VYR B;  3VSL A;  2OV7 A;  5IP6 A;  1YS7 A;  3LSI A;  1MD0 A;  4P9F A;  2CYY A;  3PQJ A;  4BE1 A;  3GTQ J;  2HGC A;  1MSF C;  1VQL I;  1LDJ A;  1BJA A;  1R1V A;  2VXD A;  3M8F A;  3GTL J;  2D1H A;  4TV7 A;  3Q0V A;  4HNV A;  2LTP A;  3TP0 A;  5E3M A;  3M1C A;  1QZZ A;  2DJN A;  4ZYE A;  5LGN A;  2LDU A;  1T95 A;  2EFP A;  3H3Z A;  3HUG B;  3G1L A;  2LY1 A;  4LK0 F;  1N78 A;  1DPU A;  2AS5 F;  3VDX A;  2FSW A;  3HKZ A;  1JUS A;  4FE4 A;  2OF7 A;  4BEH A;  2MW8 A;  1DUX C;  4E7J A;  3RI4 A;  4RGU A;  4N9I A;  4AVZ A;  1XTA A;  2Y48 A;  5EGO B;  2XF7 A;  3AG2 H;  4AU7 A;  3ZCO A;  1CQT A;  1MNM C;  1TWC J;  1JKP C;  4OIP F;  1REP C;  1GV5 A;  4IXA A;  1HA8 A;  3JRF A;  4HNU A;  2EIN H;  4U0W A;  3HPH A;  4N4O B;  4F92 B;  1XMK A;  2FBK A;  4HLX A;  2BY2 A;  3H5A A;  4DOZ A;  2R0Q C;  5LHH A;  2VBY A;  2UV1 A;  3ECO A;  3CC7 I;  4IHV A;  4Q5S F;  3FXJ A;  3H3V K;  1ETQ A;  5DUK A;  2KRH A;  1RI7 A;  5KHD A;  1K78 B;  2LY2 A;  1ZHF A;  3K1N A;  2HZT A;  1PUF A;  1WJD A;  3MWM A;  2DCE A;  4NUB A;  4RGR A;  3EPZ A;  4ZC3 A;  3BZ6 A;  2V26 A;  3GFM A;  1RRJ A;  2PJP A;  4M71 A;  1E3O C;  2VQH A;  2ZNY A;  4L0Y B;  4RAY A;  3CUO A;  4XOT A;  2FX0 A;  2CRG A;  4AD9 A;  3J80 Z;  1U5T B;  2EZI A;  3JRD A;  2E35 A;  2DOD A;  4KN4 X;  3BTC A;  2LKP A;  4EGY A;  4LG0 B;  4P96 A;  2DA4 A;  4D9J A;  4BQN A;  3HSE A;  4ETS A;  5IT3 A;  4XBF A;  3HUG A;  1UG0 A;  3FIS A;  4A3C J;  2K9N A;  1D1A A;  3EUK L;  2B0L A;  2DK8 A;  3C1D A;  5K5R A;  1YJ9 I;  2X9D A;  3E7L A;  4IVN A;  3LOC A;  1AHD P;  5BMZ A;  4X1E A;  5E17 F;  1ETW A;  4ABZ A;  4K2E A;  3RIR A;  2QEX I;  4FTH A;  5D8K B;  4M9Z A;  2LMD A;  1ZRE A;  3ZQQ A;  4M6Y A;  5GPA A;  4HLY A;  1Z6T A;  2Z99 A;  3BG9 A;  1S7E A;  2CFO A;  2UUZ A;  3CF2 A;  2L5Q A;  4CCN A;  3U21 A;  1UEL B;  3BR2 A;  3OIP A;  3SDB A;  3CJR B;  3HOT A;  1KYW A;  2EWN A;  1YIT I;  4MTE A;  2ISZ A;  4AUX A;  2M30 A;  3LSP A;  3BRO A;  3KEQ A;  1HW5 A;  1LKX A;  1FT9 A;  5IOZ A;  2Z5U A;  3HRT A;  5FLM J;  2DTZ A;  1FOK A;  3I3L A;  3LWF A;  1OCT C;  1FSH A;  1W4M A;  1ON2 A;  4ANJ A;  3JSP A;  2O7O A;  1R4M B;  2WY7 Q;  2M4K A;  4XRS G;  1TL8 A;  2K3F A;  2CO5 A;  2X6X A;  3GFJ A;  4OMY A;  2FML A;  1D0Z A;  2JT1 A;  2V1U A;  2Q1Z B;  5GTH C;  1TWG J;  5IYB J;  1I39 A;  1W0T A;  2VE9 A;  3ZOB A;  1HDP A;  2BZT A;  2MBF A;  4LG0 A;  2P6T A;  4OAZ A;  1YIO A;  2AQF A;  3ROU A;  4F93 B;  1FEX A;  5IYC J;  3LL7 A;  4F55 A;  1BBY A;  2Q2E B;  4IHW A;  4EQQ A;  1MJ9 A;  1SD5 A;  2EFN A;  2JWT A;  2DI3 A;  2VQC A;  2HQA A;  3O6B B;  4L5J A;  1OMI A;  4CCK A;  4XQF A;  1YJN I;  1XSX A;  2H1K A;  2GXA A;  3GO5 A;  2XAU A;  1HF0 A;  3D0S A;  1VQ5 I;  1TWF J;  2PMH A;  2EFQ A;  3TKY A;  4HV6 A;  3CF5 F;  3FXO A;  1JXS A;  3L2U A;  1HSJ A;  4IRG A;  2GIV A;  4RGS A;  1OIS A;  2M3A A;  4IEJ A;  2R93 J;  5D4S A;  1O3Q A;  1WZ2 A;  2MLK A;  3OL4 A;  3K70 C;  1OR7 A;  3F8N A;  3N97 A;  1O57 A;  3A01 B;  1MMA A;  4LIT A;  4CIC A;  2IW5 A;  4BQO A;  5M5W J;  2L7M P;  2L9R A;  2GXB A;  3V7R A;  1U8R A;  1U5T C;  4C2M J;  3K4M A;  1W5T A;  2VOP A;  2JRM A;  1B9M A;  2DYS H;  4PFP A;  2STW A;  2R7F A;  2XC7 A;  3HOS A;  3PFI A;  3IRQ A;  2TCT A;  3W2A A;  4YII A;  1MH3 A;  3RSN A;  1W36 D;  2FQ4 A;  2DA6 A;  4EJO A;  3ESW B;  5E79 C;  4C3H J;  2CQK A;  4KNY A;  3S3O A;  5J8C A;  4AIH A;  2E1O A;  3FMR A;  3D1N I;  2XRL A;  3IH4 A;  2XSJ C;  5KCM A;  2V4J C;  3W3C A;  2FNA A;  3ZQH A;  3JTG A;  2DMU A;  2Q2E A;  3WTU C;  3AFH A;  2VC1 A;  2YX4 A;  1NK3 P;  1YIJ I;  2ISY A;  4M73 A;  4E7Z A;  3PFY A;  1Q1V A;  3W6J B;  4G94 A;  4G6Q A;  3LNQ A;  2ZME B;  4LGW A;  2IJL A;  3N4M A;  4UUV A;  4XLH A;  2VAS A;  3BQZ A;  1R58 A;  2KJB A;  4HX4 A;  3CO6 C;  3GUD A;  2R7W A;  3CUQ A;  2DMQ A;  4ESB A;  4ZH4 F;  2HQR A;  4FX4 A;  4Y7N J;  2CUE A;  2BY0 A;  1XDS A;  4HW0 A;  2COM A;  2JA6 J;  4LLN A;  3TOB A;  2QQB A;  2CWE A;  3E5Q A;  2H6C A;  4WCG A;  3A01 A;  1SFX A;  4KMU X;  2JVH A;  1T33 A;  4XLN F;  2VON A;  2DT6 A;  2RC4 A;  3BTJ A;  2NNY A;  2HFH A;  2VOD A;  1FBS A;  2D2W A;  3DLA A;  3BC8 A;  1FOY A;  2W4S A;  3AG3 H;  4G6T B;  3RCO A;  2E19 A;  5LGT A;  4D7N A;  2DN0 A;  4A3D J;  1MMN A;  3A02 A;  3HG9 A;  3FIW A;  2IVM A;  5J6X A;  3EYI A;  2QA4 I;  2YSR A;  3S15 J;  3G1M A;  4EAT A;  4OAY A;  3I64 A;  4FHT A;  4BQA A;  5F6F A;  4MFE A;  3BZK A;  1JI8 A;  4E7S A;  2D45 A;  2P5K A;  1Z7L A;  1RUO A;  3H1C A;  1P6R A;  2JQ7 A;  2NOG A;  3MKW B;  3HTU A;  4P9U A;  1JT0 A;  3RKY A;  3QP6 A;  1F9N A;  4UUS B;  2VT3 A;  1OYY A;  1R71 A;  2JK3 A;  2L0K A;  4Y3O A;  3I56 I;  3FXU A;  2DA1 A;  2GAU A;  5JHU A; 
#chains in the Genus database with same CATH homology
 4MIM A;  3WHC A;  2R5Z B;  1PUF B;  5C4J J;  4M3B A;  1IDY A;  4C3J J;  2RAE A;  4XK4 A;  3BR0 A;  2COB A;  2E2J J;  3RKQ A;  1XC5 A;  5F1J A;  2XSD C;  4FIS A;  3MVP A;  2AO9 A;  2Y9Y A;  4V2G A;  1H8A C;  2VPR A;  3A03 A;  1A5J A;  5IOY A;  2FJ1 A;  4M6V A;  1JKQ C;  1IV6 A;  4M3D A;  4DYC A;  3SFI A;  1NTC A;  2LY9 A;  1D5Y A;  5K7F A;  5M5Y J;  3Q0W A;  1RET A;  5J1Y A;  3SDG A;  3RQI A;  5FJ8 J;  3ZQL A;  2X48 A;  5E3O A;  3PM1 A;  2Y31 A;  2CUF A;  2ELK A;  4XIC A;  4RBO A;  2JA7 J;  1GUU A;  3JRH A;  4A3B J;  1VFC A;  1ETV A;  3HOV J;  2HXI A;  1GV2 A;  2JMW A;  2LK2 A;  1T56 A;  4JYK A;  2LD5 A;  1JGG A;  3K2A A;  1MH4 A;  5IYD J;  1AKH B;  3B6C A;  1B72 B;  1BL0 A;  2DMP A;  5EYR A;  4JX6 A;  1EF4 A;  3LSG A;  1IUF A;  3S17 J;  2GBY A;  3Q3S A;  2R7Z J;  2JA8 J;  1ETO A;  1OFC X;  5FKO A;  4M3F A;  2DMN A;  2GM4 A;  2XPV A;  4DYR A;  1R9T J;  4AC0 A;  1YRN B;  1WGX A;  1IGN A;  1QVT A;  3TED A;  5E3L A;  4M3G A;  1DU0 A;  4FCY A;  1NK2 P;  2ECB A;  1QVU A;  3TW7 A;  2X6O A;  5FLV A;  2MGQ A;  2IEK A;  4MFD A;  2FD5 A;  3S14 J;  4A3M J;  1RES A;  2CQQ A;  1UMQ A;  3BR1 A;  4D7M A;  2H8R A;  2ME6 A;  1APL C;  1GVD A;  1Z77 A;  3M4O J;  4B3A A;  2P81 A;  1ETY A;  3HKZ N;  3OSG A;  2VKV A;  2L7Z A;  3W6V A;  2EH3 A;  2LP0 A;  1MBH A;  1RKT A;  4BY1 J;  1Y1W J;  4UUT A;  2XB0 X;  3VPR A;  2WV1 A;  2XGE A;  2YUS A;  5M3M J;  4D5F A;  3JRB A;  3HOW J;  1Z0X A;  1JJ6 C;  2LLK A;  3WHB A;  5DS9 A;  1JUM A;  3LSR A;  2Y0S N;  1TWA J;  2K9S A;  2DA3 A;  2EBI A;  2MSY A;  2M0C A;  3FKI J;  3OSF A;  4AYB N;  1LFB A;  1X58 A;  5C3E J;  4JX4 A;  5IP9 J;  2XGD A;  3HOZ J;  3OIO A;  3RZO J;  5K7Z A;  2B63 J;  3HGG A;  1UG2 A;  3CMY A;  2DA2 A;  1YRN A;  4S0H B;  4JP0 A;  4MLO A;  1U9O A;  1WI3 A;  4V2F A;  5M5X J;  2KT0 A;  1GDT A;  3RZD J;  3S1N J;  3B6A A;  1U78 A;  2NS8 A;  3GBG A;  3PO3 J;  2DA7 A;  2NVT J;  1ETX A;  3PO2 J;  1ZTR A;  3HM5 A;  3UKG A;  4A3F J;  2NVQ J;  5IP6 A;  1VF9 A;  4J19 A;  2NS7 A;  4A93 J;  5GPC A;  3GTQ J;  1MSF C;  5J3L A;  4QSH A;  3GTL J;  2W48 A;  3Q0V A;  4HNV A;  2R5Y B;  2LTP A;  3TP0 A;  5E3M A;  2DJN A;  3JRE A;  3QQA A;  1RR7 A;  2MG4 A;  3G1L A;  5EG0 B;  3O8G A;  2K9Q A;  1JUS A;  3S16 J;  1IC8 A;  1U9N A;  1JTX A;  4FE4 A;  2OF7 A;  4MO7 A;  2MW8 A;  2LKX A;  1I6H J;  3GTM J;  1BA5 A;  4FE7 A;  5F0H A;  2TRT A;  2WB1 N;  3BTI A;  3HBL A;  4QIW N;  1I3Q J;  5EGO B;  1H88 C;  3I4N J;  2HDD A;  2E2H J;  4X6A J;  3G1O A;  2M8G X;  1CQT A;  1MBJ A;  1MNM C;  4A3L J;  1TWC J;  1JKP C;  1GV5 A;  5DTD A;  3JRF A;  3BR5 A;  2EZL A;  4NDL A;  1TC3 C;  2M2E A;  2DMT A;  5IP7 J;  5C4X J;  1P7I A;  1UHS A;  1GT0 C;  2R0Q C;  4IHY A;  4UUS A;  2ME0 A;  1FTT A;  3S2D J;  4IHV A;  3H3V K;  2I10 A;  1ETQ A;  3K7A J;  3MKL A;  1W0U A;  4BKX A;  2XPW A;  5JLW A;  2M9H A;  2R5Z A;  1PUF A;  2AHQ A;  1E3O C;  4Y52 J;  3DCF A;  3SJM A;  1A6I A;  3IH2 A;  2QF7 A;  4A69 C;  3TW6 A;  2FX0 A;  2O8K A;  3IH3 A;  2CRG A;  2R92 J;  3Q0U A;  4XRM A;  2EZI A;  3JRD A;  4GFB A;  3BTC A;  1ZR2 A;  4A3E J;  5GP9 A;  2DA4 A;  4D5C A;  1G2H A;  2HI3 A;  4BBS J;  2Y2Z A;  1XS9 A;  5K7H A;  3FIS A;  4CYC B;  4A3C J;  2K9N A;  4DZJ A;  2X9D A;  2XB5 A;  1ZK8 A;  3E7L A;  3LOC A;  1AHD P;  1HCR A;  4X1E A;  4DYQ A;  1ETW A;  5F04 A;  1LFU P;  4EEF G;  4ABZ A;  3GTJ J;  4A3K J;  5F27 A;  4FTH A;  1IRZ A;  3FK6 A;  1F43 A;  5GPA A;  3HOX J;  1JTY A;  1POG A;  3BG9 A;  1S7E A;  3MN2 A;  1AKH A;  3JR9 A;  3NAU A;  2K40 A;  1B72 A;  4I76 A;  1HLV A;  1JKR C;  2HYJ A;  3BR2 A;  5J1U A;  4QTR A;  2EZH A;  2HXO A;  3S1M J;  1ENH A;  1JUP A;  1SAN A;  2OPT A;  5FKK A;  2O9L A;  3BG5 A;  4AUX A;  3LSP A;  3JRI A;  4G12 A;  5IOZ A;  5F08 A;  5FLM J;  1BJZ A;  2DTZ A;  1OCT C;  2JJ7 A;  2O7O A;  4XRS G;  1K61 A;  2YS9 A;  4BBR J;  1ETK A;  2L7F P;  1ZQ3 P;  1MSE C;  3HEF A;  1TWG J;  5IYB J;  1W0T A;  3QPS A;  3ZOB A;  1HDP A;  3CDL A;  1RPW A;  2XGC A;  1FEX A;  5IYC J;  1IJW C;  1SFO J;  3M3Y J;  4IHW A;  3HB9 A;  3GTK J;  5BNG A;  2JWT A;  3I4M J;  2EQR A;  3NAR A;  1H89 C;  3CQZ J;  2GLO A;  2H1K A;  1OJL A;  5IPA A;  1HF0 A;  1VI0 A;  5JLX A;  1TWF J;  1MBK A;  5EZH A;  4XRS A;  5EF6 A;  3HOU J;  4IHX A;  1FIP A;  4IEJ A;  2R93 J;  1TWH J;  2Y30 A;  3TP3 A;  2VUM J;  1P7J A;  1ORK A;  5M3F J;  3ZQG A;  1BW5 A;  1AU7 A;  1OCP A;  1HDD C;  1JT6 A;  3A01 B;  3HDD A;  5M5W J;  2L7M P;  2D5V A;  2L9R A;  2E2I J;  1HOM A;  4C2M J;  2LR8 A;  1I50 J;  1WH7 A;  2YU9 J;  4RDU A;  4BXX J;  1FIA A;  1U8B A;  2DA5 A;  3DEW A;  2IBD A;  2TCT A;  3IV5 A;  1X2N A;  3JRA A;  1MH3 A;  2ECC A;  2FQ4 A;  2DA6 A;  4B1R A;  5J1R A;  2HOT A;  1LE8 B;  2HOA A;  1FTZ A;  4C3H J;  1VND A;  4LOC A;  1XG1 A;  1ITY A;  1DU6 A;  2LFB A;  1ZR4 A;  3BG3 A;  5FKL A;  2E1O A;  1Y1V J;  3D1N I;  2XRL A;  1B8I B;  3BTL A;  5FKM A;  3IH4 A;  3ZQH A;  2DMU A;  3C2B A;  2HOS A;  2QCO A;  3CCY A;  1JJ8 C;  3BQY A;  3ZQI A;  1NK3 P;  5FKN A;  2R5Y A;  1IDZ A;  1Q1V A;  3JRG A;  1MBF A;  3LNQ A;  2CJJ A;  5EG0 A;  3GTO J;  4W97 A;  5E3N A;  3BQZ A;  2N8G A;  4W1U A;  3ZQF A;  4JX5 A;  1O4X A;  4DZP A;  2DMQ A;  1ZKG A;  4B4C A;  5EZG A;  2NVY J;  5EEA A;  3BR6 A;  4Y7N J;  2CUE A;  5EGO A;  1QRY A;  3F0C A;  5F0F A;  4DW6 A;  2JA6 J;  1K83 J;  2ID6 A;  1FJL A;  4M3E A;  2KDZ A;  3A01 A;  3S1R J;  1MBG A;  1T33 A;  2NVX J;  5F0C A;  3ZQC A;  2ID3 A;  3BTJ A;  3JRC A;  4A3G J;  3BT9 A;  3LSJ A;  1F36 A;  2HQ5 A;  3H0G J;  4L5E A;  9ANT A;  2IAI A;  3GTP J;  4C3I J;  1WPK A;  1MBE A;  2E19 A;  2JN6 A;  2LVS A;  4D7N A;  2DN0 A;  2CQX A;  1LE8 A;  4A3D J;  3A02 A;  2VI6 A;  4XID A;  2PMZ N;  3OOU A;  3HOY J;  3FIW A;  3QPL A;  2JA5 J;  3O8H A;  2Y9Z A;  1ZGW A;  2WAQ N;  3S15 J;  4A3I J;  3G1M A;  1B8I A;  1QPI A;  1BW6 A;  2VKE A;  2CU7 A;  4MFE A;  3S1Q J;  5HOD A;  2M34 A;  4BY7 J;  3S2H J;  1WCM J;  1JKO C;  2NOG A;  4I6Z A;  1RKW A;  2G0E A;  1JT0 A;  2EZK A;  3HGY A;  5EDN A;  1WH5 A;  1X2M A;  4UUS B;  3BR3 A;  3GTG J;  3L1P A;  2JK3 A;  2L0K A;  3FK7 A;  4CYC A;  2XPU A;  4A3J J;  2ZB9 A;  2DA1 A;  5C44 J;  1IG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...