2LFBA

Homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
MARIDPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structure of the non-classical homeodomain from the rat liver LFB1/HNF1 transcription factor.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Dna-binding
molecule keywords LFB1/HNF1 TRANSCRIPTION FACTOR
total genus 34
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lfbA00
2LY9A 2CRGA 2X48A 3BG3A 2DTZA 2YUSA 1B72B 1LE8B 2MG4A 1IC8A 1BA5A 2ZB9A 2LR8A 1VNDA 4BBSJ 1ETKA 1JUSA 3LSJA 1HOMA 5C4XJ 3G1MA 2H1KA 3BR1A 1JUMA 4Y52J 3GTQJ 1AKHB 3BR6A 2AHQA 3RQIA 2R5YA 1B8IA 1TWFJ 3RKQA 3F0CA 5EGOA 1ZTRA 2Y9ZA 1Y1WJ 3HOUJ 1SANA 2GBYA 1JKOC 5FKLA 3S1QJ 4M3FA 2DA7A 2I10A 1I3QJ 5IOYA 3ZQLA 1ZR2A 3I4NJ 3BQYA 3K2AA 4A3MJ 4A3BJ 1U8BA 5J1UA 4M6VA 2ID6A 5K7FA 2QF7A 1TWGJ 2R7ZJ 4UUSB 4JX4A 4IHXA 2XGDA 3CCYA 2CU7A 4FCYA 4BBRJ 4C3JJ 1Q1VA 2MW8A 2E2IJ 2DA2A 3BT9A 2CJJA 2XGCA 2M0CA 5IP6A 2HQ5A 1K61A 4IEJA 2Y31A 3ZQFA 4D5FA 3PO3J 1MBEA 5M3FJ 3MN2A 1YRNA 5K7HA 3HDDA 1U78A 4XIDA 4IHYA 5FLVA 3GTGJ 3FISA 4M3GA 4HNVA 2R92J 5C44J 2DMNA 2DA6A 3HKZN 2O7OA 1QVUA 1OCTC 4M3BA 2R5ZA 2XPUA 4MLOA 1H8AC 3S1RJ 2RAEA 4BKXA 2K9SA 3Q3SA 4V2GA 2M2EA 2DJNA 4DYCA 5F08A 3H3VK 1HDPA 2LFBA 1NK3P 3JRFA 3BR2A 2LVSA 3H0GJ 1GT0C 2HOAA 4MFDA 1D5YA 2VUMJ 2JK3A 3DEWA 3UKGA 1Z0XA 5GPCA 1ETOA 1HLVA 2LTPA 4JYKA 1WH5A 2HYJA 4A3JJ 2HOTA 2JWTA 3FK7A 1R9TJ 4NDLA 1DU6A 1XC5A 2LD5A 3JRIA 3GTMJ 2HI3A 4S0HB 3S17J 2WB1N 1X2NA 3QPLA 5FJ8J 1H89C 4B3AA 1BW5A 4BY7J 1ETVA 3IH3A 1O4XA 2M34A 1VI0A 4A3CJ 1JKRC 2DMPA 2XPWA 2L7FP 1APLC 2DA1A 3BR3A 5EG0A 3CDLA 1UMQA 2EZHA 1AHDP 5IYCJ 3VPRA 2PMZN 2DA5A 1JT0A 1VF9A 1HCRA 1TWCJ 1BW6A 1VFCA 2ELKA 1XS9A 3A01B 5EF6A 4V2FA 1P7IA 1Z77A 4M3DA 5FKKA 2XSDC 1ENHA 1SFOJ 3S1MJ 1JT6A 3HM5A 1I6HJ 2XPVA 4A3KJ 4DW6A 1WH7A 3LNQA 4A3GJ 2WV1A 3GTOJ 3A02A 3MKLA 1MBJA 1MH4A 5C3EJ 5EEAA 3O8GA 4IHVA 2LK2A 4A3IJ 2JA5J 3QQAA 2L7ZA 3HGGA 5FKOA 1IGNA 2JJ7A 4XICA 1GV5A 1JUPA 4XRSG 4C3HJ 4BY1J 2TRTA 3SDGA 1FJLA 4FISA 3S14J 2K9QA 4MO7A 2Y2ZA 3CQZJ 5M5YJ 2EZLA 3Q0UA 1OCPA 5DS9A 2CQXA 1MBHA 1RR7A 2ME6A 2FD5A 3A01A 2HOSA 3A03A 1ZGWA 1QPIA 1A6IA 2X9DA 2L9RA 4IHWA 3S16J 3JR9A 3RZOJ 3E7LA 4GFBA 3I4MJ 3L1PA 2R5YB 3PO2J 1IDZA 1WGXA 3OSGA 2XGEA 3LSRA 2O8KA 4W97A 2IBDA 2XB5A 1GVDA 2JA6J 5E3LA 4QIWN 2DA3A 4X6AJ 3WHBA 2Y0SN 3JRDA 3BTLA 3HOZJ 3LOCA 1F43A 1T56A 3HOWJ 1LFBA 4QSHA 4C2MJ 1WI3A 5M3MJ 3NARA 4J19A 5GPAA 4BXXJ 1MBKA 5FKMA 1GDTA 2G0EA 4UUTA 2E2HJ 2KT0A 2NVYJ 2B63J 2GLOA 1IV6A 1ETXA 3HEFA 2R5ZB 4FE7A 2HXIA 5IP7J 3W6VA 2NOGA 2DMQA 2DMUA 1MSFC 3OOUA 1TC3C 4A3FJ 2ID3A 3HOYJ 3HB9A 2E19A 3HOXJ 1DU0A 4A93J 2KDZA 2ME0A 4RBOA 2DN0A 1RESA 5BNGA 4M3EA 2Y9YA 3WHCA 3OSFA 1RKWA 1H88C 2XRLA 3ZQGA 3QPSA 4XRMA 2ECBA 4UUSA 1YRNB 4QTRA 1POGA 2DA4A 2AO9A 2JMWA 3TW6A 4A69C 4JX6A 5J1YA 3B6CA 3BG9A 1HF0A 3BG5A 3NAUA 3BQZA 1IDYA 2VI6A 5E3NA 2COBA 4FTHA 3M4OJ 3RZDJ 4D7NA 1QVTA 3GTKJ 4EEFG 4AC0A 5EG0B 3TP3A 2DMTA 3CMYA 3TEDA 4A3EJ 2R0QC 1JKQC 3GTJJ 3DCFA 3ZQHA 1RKTA 2X6OA 2WAQN 2VKEA 3M3YJ 4AYBN 1ETQA 2FQ4A 4W1UA 2FJ1A 4MFEA 1BJZA 4AUXA 5EGOB 1T33A 2EBIA 4JP0A 3JRBA 2W48A 2EQRA 3K7AJ 5F0FA 4D7MA 1AKHA 3JREA 2VPRA 1TWHJ 2HXOA 4B4CA 3LSPA 2M8GX 2P81A 1GUUA 1FIAA 1P7JA 5J3LA 1OFCX 1PUFB 2TCTA 1LE8A 3HGYA 1MBFA 1W0UA 3B6AA 2CQQA 1ETWA 4A3LJ 5DTDA 1UHSA 2OPTA 3BR5A 3JRCA 4D5CA 2NS7A 2IAIA 2N8GA 3C2BA 1W0TA 1RPWA 3SJMA 1Y1VJ 3IH4A 3D1NI 4LOCA 2E2JJ 2Y30A 2HDDA 1ZQ3P 2NVQJ 1JTXA 2ECCA 1OJLA 4X1EA 1MBGA 5EZGA 5F27A 2CUEA 3S2HJ 1HDDC 5F0CA 2NVTJ 3ZOBA 3PM1A 5EYRA 2LLKA 4XRSA 3S2DJ 2LP0A 2JA8J 5EDNA 3HOVJ 2K40A 2IEKA 4DYQA 2L0KA 5IOZA 1ORKA 3S1NJ 4B1RA 1RETA 4ABZA 2R93J 4CYCB 1WCMJ 2LKXA 4Y7NJ 1JJ6C 4C3IJ 3JRAA 3ZQIA 1PUFA 1IJWC 3GBGA 2XB0X 3BR0A 3HBLA 5F1JA 5JLWA 2MGQA 3IH2A 5F04A 2CUFA 3FKIJ 4FE4A 5FLMJ 5GP9A 2EZKA 1U9NA 3G1LA 1I50J 1FTZA 2O9LA 3BTCA 1ZR4A 2OF7A 1B8IB 2YS9A 5IPAA 3TW7A 3BTIA 2GM4A 3BTJA 1CQTA 1JKPC 2D5VA 3S15J 1NTCA 4G12A 1XG1A 3LSGA 4XK4A 1TWAJ 5E3MA 1JTYA 2VKVA 3MVPA 5M5WJ 3JRHA 2YU9J 2JN6A 4L5EA 4RDUA 1ETYA 1IRZA 1B72A 3TP0A 3O8HA 1ITYA 1MH3A 3GTLJ 5E3OA 1K83J 5IYBJ 4DYRA 1ZKGA 2EZIA 1MSEC 3IV5A 5C4JJ 1ZK8A 1G2HA 1X58A 5HODA 4DZPA 1UG2A 2NVXJ 5K7ZA 1WPKA 3G1OA 5J1RA 4CYCA 5IYDJ 1FIPA 1MNMC 2EH3A 1F36A 1NK2P 4DZJA 4MIMA 3Q0VA 1EF4A 9ANTA 1GV2A 3GTPJ 2M9HA 2NS8A 1JJ8C 3FIWA 2E1OA 5JLXA 1U9OA 3SFIA 4I6ZA 5FKNA 1LFUP 2L7MP 1E3OC 5M5XJ 3ZQCA 4I76A 1BL0A 5IP9J 1IUFA 1AU7A 2MSYA 4JX5A 1S7EA 2JA7J 1FEXA 3Q0WA 3OIOA 3FK6A 1JGGA 1FTTA 5EZHA 2H8RA 2QCOA 4A3DJ 3JRGA 1IG7A 5F0HA 1QRYA 1X2MA 1A5JA 2K9NA 2FX0A
chains in the Genus database with same CATH superfamily
2OUMA 3MWMA 2X48A 2CRGA 1JHHA 3BG3A 3R6SA 2YUSA 4KIBA 1TL8A 4ESJA 5LGTA 2V1XA 3OOPA 1BA5A 1LFPA 2BYVE 1VNDA 3HUGA 4BBSJ 1S8NA 2NNYA 2BGCA 3I58A 4C30A 4CCJA 2LOOA 3CDIA 3PFIA 2H1KA 3DXJF 3K9TA 3L9FA 2ELJA 1ZN2A 4ENNA 2QM3A 4EQQA 3CCVI 1NHAA 2K5CA 1LQ1A 1Z67A 5HS9A 2MH2A 1TWFJ 3K4NA 3EYIA 3QOEA 3RQ4A 1Y1WJ 1R71A 3HOUJ 3HRTA 2JRMA 5FKLA 3BP8A 3BZ6A 4FASD 5CVJA 5IOYA 1I3QJ 1X1DA 3LQRA 4D9JA 3IRRA 4HEA2 1WZ2A 4XKWA 4PFOA 1W1WE 4A3BJ 4BGDA 3I55I 1U8BA 3GLLA 5J1UA 5JI6A 2K4BA 2XAUA 2QF7A 1TWGJ 3MZHA 2R7ZJ 1BI0A 1VQ9I 3X2QH 1HSTA 1QO0D 4LG0A 4IHXA 4NC7A 2YU3A 2V9PA 2XGDA 3ABMH 3K4BA 1Y39A 4FCYA 3U2RA 3TOBA 4BJ5C 4C3JJ 1Q1VA 2XVCA 4DOZA 2MW8A 4ZYGA 5LGUA 3DWLE 3BT9A 1XPXA 2BVLA 3E3VA 5LEKA 1WKMA 1DGRM 3ULQB 3MAJA 4IEJA 2F5VA 2WY7Q 5JHFA 3CD6I 2ZNZA 4D5FA 5L3EA 1Y0NA 1SFEA 5HVQC 2ZKZA 5M3FJ 5K7HA 4LJZF 5IT9K 4IHYA 3OS2A 2NRAC 2BBYA 2EV0A 2EIJH 2RDPA 2DA6A 1J5YA 1D0YA 3MKWB 2ZJ2A 5CQEA 1RZ4A 2P5LC 4G7HF 3K0LA 3OL3A 2DK8A 4MLOA 1H8AC 1NG6A 4BKXA 3GZ5A 2PI0A 2GA1A 3BZCA 2F5EA 4V2GA 2DJNA 4OWRB 1BIBA 2Y0SA 4HSTA 2LFBA 1NK3P 1TBXA 4Z2YA 2KIFA 1ZRFA 2Q1ZB 1RR8C 5LD2C 3H0GJ 4N0BA 1FY7A 1ZGAA 1S72I 1TW3A 2HOAA 1D5YA 5FRNA 3OS1A 3W2WA 1ETOA 4JYKA 2IGOA 1YFHA 3EQLF 3HSRA 5GADJ 4V19K 1DU6A 5HS7A 2KHMA 3S17J 2EIKH 5J8FA 3AAFA 2WB1N 4E7ZA 1UG0A 1T38A 3QPLA 5FJ8J 2Q0OA 2F4OB 2X6WA 1ETVA 3IH3A 2M34A 1FC3A 4WXCA 4O5VA 4PSWA 4C9YA 4Q47A 3F23A 1UCRA 3WGHA 2DA1A 1UMQA 2ADUA 2PEXA 3VPRA 3K6GA 2Y48A 1VF9A 2DU9A 1V55H 2JPBA 1ON2A 3GZNB 2ELKA 2YSRA 3E6MA 5HLHA 3CESA 1XS9A 2P6TA 4IOAF 3LSKA 1SFOJ 4RB3C 3FXKA 5FKKA 1ENHA 3QODA 1FYKA 2LBFB 1I6HJ 1W7PB 1USTA 4II3A 1WH7A 1FYLA 4A3GJ 4G6TB 3GTOJ 2CQ7A 2IGKA 1MH4A 3L09A 1MMDA 1KYZA 1LPQA 1RUOA 4XKCA 4B44A 2P6SA 1TW2A 4I99C 1N77A 1FOKA 3E0JB 1JGSA 1TLHB 5FKOA 1U8RA 4BACA 1GXQA 2D45A 4XRSG 3GO5A 3SDGA 1O3QA 2K9QA 3Q0UA 2L9SA 2VQGA 2ME6A 3VB2A 3IKVA 1BN5A 3A01A 5LFAA 3A03A 1ZGWA 3HRUA 2JRTA 2ZFWA 4OINF 4EV0A 3EDPA 3F3XA 2L9RA 3H36A 4XKVA 2O61A 3JR9A 3IRQA 3RZOJ 3I5UA 1XDUA 4RAGA 3PJRA 1IDZA 3OYCA 1LB2A 1EH6A 3BC8A 1D1BA 3OSGA 3H0DA 1K4TA 4CCOA 3HTUA 4XLHA 3DKWA 1O3TA 3BJ6A 2DQRA 1R1TA 2STWA 3FDYA 3BTLA 3LFKA 4PZJA 1ZREA 2STTA 1IN7A 3HOWJ 5BQTA 3QYEA 1T8IA 3W2VA 5M3MJ 4BXXJ 5GPAA 1QA6A 4HDVA 1MBKA 2P5VA 3ZQQA 1J7KA 4JOMA 3FF5A 2M4KA 3DPUA 4M74A 2FF4A 1FBQA 3J81Z 1E17A 3H9JA 4RLFA 4CUGA 4H0EA 3KP7A 2HXIA 4CCNA 3W6VA 2XAGA 2DMQA 1P4AA 3A0BC 5GAHJ 4PSXA 4A3FJ 4HSRA 4BE2A 2XDVA 2O8XA 5A2QK 1R5HA 2UWMA 2KDZA 4LLLA 2DN0A 4Q48A 5ED4A 4ZDLA 4MQ9F 2CFOA 3ZCOA 3J80K 3QPTA 2L3DA 1EH8A 4M3EA 5ERIA 1U6GA 1X1CA 1RKWA 4BS9A 1DPRA 3CCRI 4CHUA 2O6GE 1Z1DA 4XRMA 5BOXA 2E1MB 4UUSA 2XSJC 5CVRA 4L9JA 5HDGA 1I1SA 2B0LA 1N75A 3A0HC 3JW4A 3M7GA 1FBUA 1HF0A 1VQ8I 2HS5A 3BQZA 3FXJA 2XF7A 2VI6A 4ZTFA 4OIPF 2VXDA 2AS5F 1QNTA 4FTHA 3M4OJ 1DGWY 2ZMEC 4A0ZA 1D1AA 4HPQA 2V79A 4ZZDA 1T95A 2HU9A 2XF6A 3OYJA 4CICA 3J81K 2R0QC 3G6EI 1XDSA 1UELB 3I4PA 3ZQHA 3ERMA 4QPOA 2WAQN 4HAMA 3M3YJ 2ZMEB 3HKZA 2MLKA 3A2KA 1E0EA 3K1NA 3KYDB 4E7JA 1ETQA 2A6TA 2ZFUA 4YFKF 4P55A 3SZPA 2IS6A 3KP3A 2HYFA 4GCVA 1BJZA 4AUXA 2H6CA 4N4NB 3PIPF 3TBIA 2CS3A 3K7AJ 4IXAA 1PP7U 2W57A 3PNYA 3K4KA 4HQEA 4L0YB 2RREA 2HFHA 2M8GX 2VIXA 2VASA 2X1EA 2P81A 1P7JA 2Q2EB 3BPVA 1OFCX 1XGOA 2Q8KA 4BQQA 1I27A 3ZP5A 3ZPLA 3WG9A 3TO6A 3HGYA 1T0FC 1R23A 1W0UA 3F22A 2OAZA 2RC4A 4A3LJ 4A5NA 4CZZA 5D4SA 3RYRA 2VT2A 4OAZA 5K5RA 3JRCA 2JTVA 1IAWA 2ISYA 1U2WA 2X1CA 5DV5A 3OYAA 3SJMA 2HPIA 5B1BH 4BQNA 4EM1A 2HDDA 1K6YA 2K27A 1P4XA 1MBGA 2ETHA 2A68F 2CUEA 2DK5A 1TQPA 5EYRA 3C1DA 1OISA 2JA8J 1FSHA 5EDNA 2K40A 3M1EA 2IEKA 5H2FC 4DYQA 4CXFA 3OYLA 2JVGA 3I53A 1ORKA 4B48A 1RETA 1WCMJ 4ZDPA 3K4JA 3NQOA 2PG4A 4A6DA 3WTUC 1TNSA 3FM3A 3GBGA 2XB0X 1IRFA 1L0OC 2DLLA 5F1JA 5JLWA 4BE0A 3HG9A 3TQNA 3IH2A 4ON0A 5F04A 3HRSA 3FKIJ 3G1LA 1FTZA 5D6EA 2WBMA 4M9SA 3WTVC 1ZR4A 1R36A 4FHTA 1W5SA 5HLTA 3TW7A 4A6EA 2GM4A 3RDIA 2PMUA 1KQ9A 1S7AA 4QLCU 2D5VA 3JAMZ 2L4MA 4BHCA 1Y8QB 2VC1A 2WAQA 2Z16A 2KRCA 4ZTJA 5E3MA 2KKOA 2XV4S 1AOYA 1QHGA 1JTYA 3HUGB 4N4OB 3OYDA 2AQEA 3MVPA 2RNGA 5ILSA 3JRHA 3F8MA 1IXRC 1BOAA 2YU9J 4RDUA 1C0WA 3CMEI 5KCMA 4HZFA 1ITYA 3OR1C 2A5YB 2VKHA 3F6OA 5E20A 1YJNI 2EINH 1MSEC 3WTSC 2DFHA 1MMNA 3KP5A 2JQ7A 1O7LA 1G2HA 1XX5A 4DZPA 1UG2A 3L00A 4ENJA 1FMWA 3CZ6A 3EETA 2EH3A 3H9QA 2IA2A 1G6NA 1BI3A 4I09A 3BJOA 5TGTA 1EF4A 1AWCA 2DQLA 9ANTA 2QGUA 4NQWB 4AIDA 1PP8F 3C18A 2E1OA 4ITVA 1U9OA 3SFIA 3GF2A 5FKNA 1R58A 1R1UA 3KZIC 1T98A 1IUFA 4ZYAA 3LSMA 4YG2F 3KP6A 2ZC2A 5J6XA 1R22A 2F2EA 4G94A 1EJ9A 3Q0WA 3OIOA 2QQBA 3FK6A 2MBFA 3V7CA 4CCMA 1UB9A 3DU5A 2HR3A 2BY0A 2FEZA 4PDKA 4JQFA 1HC8A 3KETA 3T5XA 2H27A 1GHCA 1A5JA 2WWYA 5FROA 3DPTA 2ZBKA 3GMEA 3S3NA 3QYFA 3BJAA 3IWZA 1MDMA 2F6CA 3QYBA 5GAGJ 2ZB9A 5J8CA 2GOMA 1X3WB 3K4CA 2VQHA 2NYXA 1HKSA 3ABKH 3IP4B 5C4XJ 1HOMA 4LIVA 1QU3A 1XTAA 1JUMA 4Y15A 1IO2A 1UHMA 2X1DA 3V42A 4S04A 1AKHB 2AHQA 3E6DA 2HVRA 1BI1A 2BW3A 4HF1A 1BOBA 4ETSA 2VBXA 1B8IA 3F0CA 1LVKA 1Z05A 2PMZA 2DO7A 2RGVA 2HGCA 2DBBA 1JKOC 1IN4A 3F8FA 3NRVA 3EUHC 2EV5A 1ZR2A 2CUZA 2E35A 1YQAA 3BQYA 2K85A 2CW8A 4Y17A 1LDJA 3WTYC 1B9MA 2F4MB 1K7AA 3ZMTA 2ID6A 3M8FA 4EM0B 2CW0F 4P9FA 4KMFA 4IHTA 3W3CA 1DDNA 1ACIA 3MD2A 1SD4A 4GXOA 4JX4A 5J40A 1BR4A 2M1BA 5AIQA 1O57A 3V4GA 2M87A 4BH9A 1LNWA 4XLNF 4BBRJ 3SQNA 4WXDA 1TT0A 1W5TA 2HQ5A 1K61A 2Y31A 4GYIA 1MZBA 3ZQFA 3ERED 2IGNA 1NG7A 3PO3J 3VDXA 1OYIA 3HDDA 1U78A 4IQJA 3GTGJ 5FFZA 2FBIA 4M3GA 1CF7A 2R92J 2DMNA 1HW1A 1ZHFA 3LFUA 3HKZN 1QVUA 3HOSA 2FU4A 1WI9A 2R5ZA 3E1SA 1OR7A 3FHZA 2KMUA 3BCAA 1OYWA 2BHZA 2NS0A 1DPUA 1ZYRF 3CUQC 3D5LA 4ZJZA 3IKTA 2M2EA 3HHHA 2LKPA 1KA8A 3TO7A 1OCCH 2V1DA 3PUFA 4YELA 3VSLA 3JRFA 2LVSA 1TQIA 2DFIA 4I0AA 2EV6A 1GT0C 3ABUA 2P7CB 4LIUA 2VUMJ 1X19A 2EA4A 3DEWA 5LRRA 2IP2A 2CSOA 1X1AA 3FBIB 1Z0XA 3J7AO 1HLVA 3W2AA 1I3AA 4XOTA 2HOTA 1VQOI 1R9TJ 4NDLA 2K3FA 1XC5A 3ZN1A 3JRIA 4RS8A 4EJWA 1H89C 4B8XA 3G2BA 5EEHA 3DFGA 3K69A 4ZC3A 1KU2A 1VI0A 4LGWA 1O3SA 2HQNA 2XPWA 2L7FP 2CG4A 2RV8A 4D0PA 5DCFA 3BR3A 3GZ6A 1T08B 1KGSA 1D8KA 4I0BA 4HV5A 3S93A 1W7PD 1W36D 4PK4A 4M6XA 1K4SA 1BM9A 1VFCA 1ZG5A 5EF6A 2L9VA 1Z77A 4M3DA 4XRFA 4OMYA 3DBHB 4GYGA 1JT6A 3HM5A 1P92A 1P4WA 5L3CA 4U7BA 4U87A 2VQCA 3ML6A 1Q1HA 4B3XA 3MKLA 4E7HA 5LHIA 4IHVA 3QQAA 4RLQA 2DPDA 2KJCA 2R7DA 3HGGA 2L7ZA 1V5FA 3UR3C 2G7HA 2Y69H 3JSPA 3PFYA 4M6YA 2V7FA 2ISZA 4C3HJ 2H09A 4BY1J 2TRTA 3G73A 3S14J 1W7PA 2VJIA 4IRGA 5IT3A 2EZLA 3OR2C 1R00A 2CV0A 1OCPA 2A3SA 1Y8RB 5ILVA 1MW7A 1OQYA 2PJRA 3H5NA 5JHUA 1B9NA 1IF1A 1A6IA 2WAFA 3V8LA 3CO6C 2KIQA 5FD6A 1V5EA 3KPHA 2VOOA 3E7LA 1S29A 1T6SA 2M3AA 2ZSIB 3G71I 3L2VA 2E34A 2R5YB 2DFEA 2GWRA 1ONVA 3T0YA 4OIQF 2D1HA 3LSRA 1EH7A 1DP3A 4F52A 4UXNA 4L5IA 1A6QA 3F9KA 2VLAA 4X6AJ 3WHBA 3GXOA 2PFBA 4M73A 4KITB 2Z2SB 3LOCA 4RAYA 1XMKA 1T56A 4C2MJ 3KCCA 2KRFA 4HX4A 4J19A 4E70A 3JAMK 2G0EA 2YX7A 3I0TA 1HW2A 2NVYJ 3ISPA 1LUJB 3AFHA 3E5QA 2GXBA 1IV6A 3RCOA 2XHKA 3HEFA 2UZKA 3LSIA 3LA3A 1LKXA 2XAFA 3OOUA 2A07F 5D8LB 4UV9A 2X51A 3DQVC 4Y33A 2H94A 1Z6RA 1D1CA 3M9AA 3HOXJ 1JI8A 4CSWA 3UNGC 4Y4RA 3ESWB 4RBOA 3O6BB 4OIRF 4WCGA 3KLNA 2HPMA 1RESA 1YLFA 2KISA 3CCUI 3EYYA 1YW9A 4RB1A 2IW5A 2IA1A 2QSGX 3QPSA 1FSEA 4DIQA 2VB6A 3TW6A 3J80Z 3PNTA 3FMSA 4U0WA 3B6CA 3O3KA 3OYIA 1YJWI 3BG5A 4PJJA 4E7KA 2A6HF 1QBJA 1FWZA 2E7WA 3GYHX 2COBA 1J09A 2B7EA 4PJMA 3DV8A 2L5QA 3RZDJ 3PSIA 4D7NA 4CH7A 2L7KA 4AD9A 1VQ7I 2RKHA 4NB5A 1K78B 4AC0A 3PL8A 3FXUA 5EG0B 3DEEA 3ZN0A 2OZUA 2FE3A 3ROUA 3TP3A 3GX4X 1U3EM 2K9MA 1J75A 2DMTA 4BHPA 3CMYA 3TEDA 3IHUA 2W7NA 4A3EJ 3GTJJ 2X6OA 4E7SA 4UVCA 4YRVA 1X3UA 2FMLA 1MJBA 2XKOA 3ZMUA 4AIHA 2FQ4A 2P0WA 1R6RA 3VSKA 2FJ1A 4PGGA 4MFEA 1YIOA 4R79A 1T0FA 2BW3B 2W48A 4S05A 5F0FA 5F1RA 5HLGA 3JREA 1AKHA 1QHHD 3E5XA 2IGMA 2VPRA 1BR2A 2WADA 2CQNA 2LMDA 4XMYA 4ENKA 1OMIA 3BG7A 3FZVA 3LSPA 3OMYA 1HKQA 5DM6F 1WJCA 4P5OA 1GUUA 4WXHA 5J3LA 3DLAA 1N25A 3CJRB 1GVJA 3NWSA 3D5RC 2P8TA 4HF0A 2QUFA 3TDZC 3C2HA 3DTKA 5E1ZB 1WJFA 2OJED 3B6AA 1WJDA 2CQQA 1ETWA 2G7UA 3CCEI 1SFUA 2V6EA 1YYVA 2MA3A 4CZCA 5TJJA 3R61A 1JXSA 1IXSB 2ICWG 1VTNC 4OIOF 3BCBA 4IQ4A 4D5CA 2NS7A 2EFNA 1Z3YA 3PNVA 4NQWA 2KQRA 3F6VA 1F9NA 2OD5A 3IH4A 1JE8A 4KICA 4BU2A 3HTSB 2DOEA 2Y30A 5E1XA 5H6QA 4Q5SF 2NVQJ 1JTXA 3CJNA 3LA7A 2VC0A 3DF8A 2KZGA 5F27A 3W6JB 3S2HJ 1HDDC 2NVTJ 3PM1A 2LLKA 3S2DJ 2LP0A 1VQKI 3V7RA 1WSUA 1U5TC 4AIKA 1D0ZA 2L0KA 4KYWA 4HQMA 1ZELA 3S1NJ 3CCMI 3LSHA 4CYCB 2JSCA 2LKXA 4Y7NJ 1PUEE 4C3IJ 3JRAA 2M7BA 5DUIA 1PUFA 2EWNA 4I2OA 4FETA 2R7WA 3PQKA 4PGHA 1E3PA 4P9UA 3HBLA 2LY1A 3CMAI 5A2QZ 2CGPA 4ZYEA 2HVSA 3HJEA 1YW7A 2EFOA 2QQ8A 2V26A 1YITI 1Z7UA 5GP9A 2EZKA 1F1ZA 2TDXA 4RGRA 3ZRGA 2O9LA 3HHGA 3BOQA 2IJLA 5H6RA 2W25A 3DKYA 3KEYA 3OV8A 3MMYB 1ZLJA 4P1WA 5K5QA 3TGNA 2YS9A 3RPUD 4EJTA 4HX8A 3BTIA 2D2WA 1CQTA 1JKPC 2H6BA 4XN3A 3WU0A 5IY5H 2WTEA 1NTCA 2OA4A 3OIPA 1XG1A 5HDNA 4XK4A 3RKWA 3DBRB 5M5WJ 4G6QA 1HW5A 1XB4A 3RIRA 2W4SA 1ETYA 4BDYA 1EV7A 3TP0A 3O8HA 1B72A 4UHTA 4M71A 1ZKGA 2EZIA 4C2TA 3WG7H 3K2ZA 1UAAA 2BXZA 1MMAA 1S7OA 4XQFA 2LF8A 2X6XA 4AWXB 5HODA 4LLGF 1RNLA 4YEJA 4CDGA 1TZLA 1P9QC 1WPKA 1XSXA 1FIPA 1MNMC 4F7ZA 1NK2P 4YIFA 2EIMH 4MIMA 1E3HA 2VN2A 1R4NB 4KT6A 3K4MA 2ZNYA 3KP4A 2M9HA 2NS8A 5JLXA 4I6ZA 3CCSI 5D5UB 1E3OC 3U21A 2V9VA 2GIZA 4GGGA 4BJ6C 3HSEA 2JUGA 2UV1A 5IP9J 4O6JA 1YHQI 2I8DA 5HLIA 1FEXA 3CP8A 4LK1F 3V7SA 1HSJA 5DYMA 1JGGA 5E1WA 2H8RA 2ZO4A 2DT6A 1XN7A 3L2UA 3TDUC 2KZVA 2BY3A 1VQLI 4HYEA 2FX0A 3CC2I 3NWTA 1VQ6I 2M8EA 1S6LA 2LY9A 2VE8A 4XKBA 2E60A 1O3RA 2EJRA 3S3MA 2GIVA 2K3PA 2XAQA 4RM2A 2LR8A 1G4DA 2I5UA 3KZYA 3LSJA 1JUSA 4UB8C 1IV8A 2ZMEA 3H9GA 3GTQJ 2DXIA 3C7JA 4XLCA 2KIMA 5L3DA 2ZXWH 3CUQA 3F72A 2RQPA 1ON1A 3I9V2 4ZYHA 2COMA 2HYGD 4IRIA 3RKQA 2IS4A 4PJ0C 5EGOA 1MNDA 4K2EA 1VZ0A 2IT0A 3W6KB 3I71A 3VEPA 2W1OA 4P96A 1QPMA 4M3FA 4KDPA 2DA7A 2I10A 3KX2A 3P7NA 3K70C 3ZQLA 4KISA 5D8KB 4XR6A 5CVVA 4A3MJ 3OYFA 5HDKA 1T39A 2M45A 4RA2A 4B09A 2RQQA 4M6VA 3FXOA 1FPQA 3JSOA 3CCLI 3GFJA 4GO1A 1LDDA 4UUSB 4YFNF 2L02A 3P9KA 1A36A 4MEYF 2ESHA 3RYPA 2LH9A 1SD7A 3WTZA 5KAFC 4FT8A 5B1AH 5D5WB 3WU1B 3D0SA 2K7LA 1OR7C 4LLNA 1B4AA 1P6RA 4QPQA 4RGSA 2V4JC 4G7ZF 2XF5A 1MBEA 3MN2A 1YRNA 4XIDA 3HPGA 1MMSA 1ZG3A 3HRMA 5FLVA 2MFZA 1YJ9I 4D1QA 3FISA 1X1BA 4HW0A 4HNVA 2E1MC 2HOEA 4L18B 1WVRA 3ZQ7A 4M3BA 3BDDA 3I54A 4UVBA 5LEJA 2GAUA 2HTSA 2DOAA 2XPUA 2JT1A 2E1CA 2R7RA 3GWZA 1MJAA 4AM3A 2QQAA 2VPLA 2LREA 4G7OF 2ELHA 2R7VA 1G3TA 1LVAA 2Y0MA 2L2OA 1UFMA 3K4LA 5F08A 1SVOA 4Y3OA 4DBRA 1PVEA 2P4WA 3I64A 4HF2A 1X4OA 3BLYA 2QENA 3LSTA 4KFCA 2PJPA 3JTHA 3K1MA 3OS0A 4BEHB 3ZGKA 1V5GA 2CWEA 2OU2A 4YIRX 2LTPA 4XL9A 3K70D 1WH5A 4BEHA 2HYJA 5L3GA 4MQVA 2RVCA 2BOLA 3SZGA 2LD5A 2FNAA 2QZ8A 2HI3A 3FHNA 4S0HB 4BL0B 3RJPA 1XGSA 3AG3H 3J7ZI 4RAZA 2XGXA 2IXSA 4OAYA 1O4XA 5J4VA 1JKRC 2DMPA 4OOIA 3M07A 2K9LA 1APLC 1SMYF 2LY2A 2E5NA 4MHGA 4XORA 1JT0A 1HCRA 1BW6A 2Z99A 1XMAA 2FNPA 1D0XA 2HQRA 1LJ9A 1IW7F 3CMMA 2OBPA 2DTRA 3JCUC 3A01B 2VOPA 5LBQA 2XSDC 2IVMA 2PLYA 1SVMA 4FQGA 1KYWA 2XPVA 5CVUA 4A3KJ 4DW6A 1G3SA 5EEGA 3L2CA 4XN0A 3ZMVA 3LNQA 3GW2A 2WV1A 2R4GA 1WWXA 5DEQA 2HDCA 2LKSA 3A02A 2NXNB 4BXFA 1MBJA 5C3EJ 3M8JA 1SEUA 3O8GA 1VQNI 2LK2A 5JFRA 3P9IA 4A3IJ 1IN5A 2OCEA 4KNYA 1QQIA 3V8KA 3I59B 1ZH5A 2Z3YA 1IGNA 3QPHA 4M9XA 3OYBA 4XICA 4DQ2A 4KA4A 1JUPA 4IHSA 3LQQA 4FISA 2XASA 5KAIC 1F5TA 1G3YA 2GZWA 2Y2ZA 4MO7A 3CQZJ 3ASOH 3QOPA 4DBQA 2JZYA 2VBYA 1HKTA 2CQXA 4PJNA 3PQJA 1YS7A 2RN7A 1R1VA 2FD5A 2HOSA 1J2XA 1QPIA 1DUXC 2DODA 2X9DA 2IRFG 1S3JA 4B47A 2DYRH 3HXLA 1T2KA 2MC3A 4XLFA 3U1KA 3L2QA 5B3SH 3P5JA 3CUQB 4BXUA 1VQMI 3PO2J 3T8TA 1TNTA 2O8KA 2R7SA 2X0LA 2XB5A 1GVDA 4QIWN 1V3FA 3KP2A 2QLZA 4MNUA 3HOZJ 3U9GA 3IAS2 1F43A 1EA3A 2VONA 1LFBA 4UV8A 4II2A 4QSHA 1WI3A 3NARA 3LAJA 3VYUB 2Z33A 1MIJA 4YFXF 2L01A 1R49A 5FKMA 1YI2I 2E2HJ 1K79A 2KT0A 1YX5A 2CFXA 4G8XA 2GLOA 3VFZA 3BWGA 1ETXA 4UB6C 2R5ZB 2R7TA 3L2RA 1SFXA 3CUOA 3L7WA 1MSFC 1I5ZA 1LEBA 2OV7A 4A2UA 2PJRB 2QKMB 2ESNA 5CPRB 1S5LC 3HOYJ 3HB9A 4A93J 1IRXA 2F4IA 4XLAA 4XLEA 2ME0A 3N97A 5K5OA 4NNJA 4XM3A 5BNGA 2KLOA 2Y9YA 3OYGA 3OSFA 2O0YA 3K10A 1H88C 3KLOA 2XRLA 4G6DA 1UJ8A 4L5JA 4ZH4F 2AXLA 2X85A 2VJJA 1OCOH 2DA4A 3AL0B 2JMWA 1H0MA 1IUYA 4JX6A 1XCBA 4KIGA 5J4YA 3BG9A 5J1YA 4MTEA 1FP2A 3E97A 2R7UA 2QYOA 4CA0A 3SXYA 1R5GA 3RPQA 3ABLH 4A12A 5DD8A 4XSXF 1JHFA 1QVTA 5D5XB 4XOPA 4EEFG 3VYSB 3J7YJ 2JUCA 2KJBA 3QU6A 5CQGA 5DCMA 3N4MA 3TOAA 1WQ2A 3J7AY 1RKTA 4AIJA 1XGNA 1KONA 4HOBA 2F5DA 3EUKL 4AYBN 1ZARA 2DOFA 2MD0A 4HNTA 5IT9Z 1B1BA 4CYDA 4WF2A 2LYCA 1UHWA 1Y0UA 2R7OA 2QQ9A 3H1CA 1ZG1A 2O03A 5E18F 1T33A 2WB1A 2MH9A 4OU0A 2EBIA 3JRBA 2DDAA 5CVIA 2KFDA 1A31A 1TWHJ 4RGUA 1V4RA 2E1NA 2ZSHB 4B4CA 1ZRDA 2CV1A 2PX9A 3V8JA 4CGZA 1FIAA 2E71A 2MD5A 1XCVA 5CYVA 1PUFB 2TCTA 3QWLA 2VL8A 4BQAA 5CLSA 1LE8A 2VQLA 1MBFA 1OPCA 2R3SA 4HNUA 3GFLA 1FZPB 4BDZA 5DTDA 1UHSA 4BYYA 2OPTA 2O5RA 1QZZA 2W85A 2DJIA 3F8NA 2BXYA 1U5TA 4Z6YA 5BPDA 3C2BA 2HTJA 2ZXJA 3FBNB 2DT5A 5TRDA 3Q9SA 3B73A 1WHUA 1FP1D 3D1NI 3AG2H 5L3BA 2E2JJ 5BS6A 1SD6A 2QBYB 2ECCA 1W4MA 4X1EA 2K86A 4EATA 2XAHA 4EJVA 5F0CA 3ZOBA 3SEZA 1Y6IA 4XRSA 1IRGA 4HRIA 3HC7A 1Z3XA 1N78A 2V1UA 1QZEA 2FMYA 1FX7A 5IOZA 2EILH 4IKFA 5LHHA 3HYIA 1SMTA 2HQAA 4ABZA 4B1RA 3OYEA 5KNLA 3B02A 5H20A 2KDOA 1F4KA 5B66C 2P7VB 4WX9A 5LGNA 5D6FA 1FYMA 3BR0A 2FBKA 1YOVB 3M8EA 3SFZA 1GLNA 3DKXA 1MJ9A 2R7QA 1G59A 1I50J 3KFWX 2CQKA 1S9HA 4M9ZA 3BTCA 2YPRA 1MD0A 1WRJA 5IPAA 3CLQA 3HPHA 4KT5C 1WJAA 5FGMA 3IAM2 3FX3A 4RB2C 2BY2A 2CV2A 2C6YA 2G9WA 1KU3A 2BHYA 1TWAJ 3CJTB 2QVOA 2QKLB 1XSDA 3RTRA 5DCMB 2JN6A 2GOXB 2OC6A 1IRZA 3WGIA 4NC8A 3IC7A 4I7HA 4R1HA 1MH3A 3GTLJ 1KU7A 4TV7A 1QGPA 2V9KA 1M1EB 2NAZA 1K83J 1OCZH 4FX0A 5IYBJ 4DYRA 5E3OA 2HEOA 1YW8A 3T8RA 4CCLA 2LNBA 4LB6B 1ZK8A 4IO9F 5GTHC 1Z9CA 3H3UA 1FOWA 3JTGA 3S3OA 1X58A 3HOTA 4ENMA 5HOOA 2LG4A 1BR1A 3OIQA 1J59A 1A04A 2NVXJ 3WGGA 3S32A 3T1BA 1SFKA 4L9VA 5K7ZA 2GA2A 4F93B 5J47A 4OMZA 4IJAA 1QZYA 5IYDJ 3REOA 1F36A 4XLPF 2XROA 3E6CC 2FSWA 2V6CA 3Q0VA 3DPLC 5FD5A 2A05A 2B9SA 1JJ8C 3FIWA 4FX4A 4KN7X 2FRHA 2L7MP 3OL4A 2FA5A 2BE5F 2OQGA 3FMQA 5LHGA 3CLOA 2JSPA 5DDGA 1VQ5I 3E6BA 1BL0A 1Z6TA 2QBYA 3VWBA 2P5KA 3F21A 4IPAA 2EFQA 2MSYA 1AU7A 2J5PA 4JX5A 4LFUA 2JA7J 2LC2A 5DM7F 3MFKA 2Q2EA 4HG2A 2V1NA 3H35A 1SC7A 4F91B 1D8JA 2QCOA 4CO8A 5ICEA 1IG7A 5F0HA 1QRYA 4PCQA 3WODF 1X2MA 3RKXA 2IS2A 3DU6A 3CC7I 3HIFA 3SDBA 2FOWA 2DTZA 1B72B 1LE8B 2MG4A 2KP6A 5JVGF 3BG6A 1ERDA 5CKTA 1IC8A 4HLYA 4AU7A 2VXZA 1GXPA 4KN4X 1FOXA 2M7AA 4LMYA 2ZJRF 1ETKA 2MC4A 3GEZA 3G1MA 5FRMA 3I3LA 4GRIA 1AA7A 3BR1A 3GFIA 4Y52J 1RI7A 3E5UA 1OLTA 3BR6A 1TP4A 3GVAA 4DNCA 3CJQB 3RQIA 2E36A 5HS8A 2R5YA 2ZCWA 4WK8F 2Z5UA 2X6YA 2MLGA 4R8HA 4U0VA 4BNCA 1G3WA 5FLXK 2ZJPF 1TQMA 1ZTRA 3G3ZA 2Y9ZA 1SANA 2GBYA 5HNFA 3S1QJ 2XKPA 3MKZA 2A61A 3FM5A 5E8IA 2AXTC 4AYBA 4BQOA 3I4NJ 3P9CA 5FB2A 2HKOA 3FXRA 3K2AA 1FOYA 4YIIA 2OTLI 1YS6A 1RRJA 2DCEA 3SHFA 5K7FA 4G9YA 3A4CA 3C3WA 2M0MA 2FUG2 1Z7LA 2UXXA 1B59A 1LEAA 3CCYA 3I59A 4ZYDA 2CU7A 2A6EF 5E17F 4E7IA 2R7FA 2E2IJ 2DA2A 1R5ID 3LA2A 2CJJA 2XGCA 2M0CA 5IP6A 3CO7C 5TISC 4C2UA 3BROA 5E8GA 1I1GA 3FWEA 4HLXA 2MABA 1E2XA 2M30A 3CP2A 3RPUA 5C44J 1D3YA 3KYCB 2O7OA 2W24A 1OCTC 4I02A 3TMOA 5HNHA 3D5SC 3S1RJ 2RAEA 4N9HA 1BJAA 1R4MB 1U0JA 4MEXF 2BVMA 3DTIA 5AIPA 2K9SA 3Q3SA 5F6FA 2VODA 3CF2A 2XIGA 1YE9A 4U88A 4DYCA 3H3VK 3SEQA 1HDPA 2HDWA 4CCKA 3BR2A 2EFWA 4E4HA 1FLIA 3VODA 4MFDA 4ZZLA 3LL7A 2JK3A 2CH0A 3UKGA 4EMSA 4JBAA 1RUNA 2GXAA 5GPCA 5BPIA 3TKYA 3QP6A 2FQ3A 3PIOF 2BZTA 4A3JJ 1YG2A 2JWTA 4RGXA 3FK7A 5ILUA 2D1VA 2KRHA 3F8CA 1L3LA 4UNOA 3GTMJ 4L9NA 1V54H 2DPUA 3S8PA 1X2NA 2CUJA 3OYNA 1XD7A 4B3AA 2QSHX 2HNHA 4F55A 1OKRA 4BY7J 2QWWA 3HL2A 1BW5A 4NUBA 5BMZA 1IN6A 4A3CJ 1MGTA 3CF5F 1IZ1A 1ULYA 5EG0A 3CDLA 4EGZA 4J01A 2EZHA 1K78A 1AHDP 5IYCJ 3CCQI 2PMZN 2DA5A 1TWCJ 4EM2A 3IWFA 1SAUA 2VJ4A 3VYRB 5K1YA 4V2FA 2FXAA 1P7IA 4XBFA 3S1MJ 4GDFA 5GAEJ 1MKMA 4E7LA 1W5CC 5DUKA 2KPMA 2LBFA 3H5RA 5EEAA 4RM3A 3COAC 2JA5J 5KHDA 2K02A 1KQ8A 1PDNC 3GCMA 5AONA 5KK1A 3WE3A 3IL2A 2JJ7A 2VBZA 2BEOA 5CJ9A 1GV5A 1USSA 3AL0C 1BBYA 2XC7A 2WY8Q 1FJLA 2WV0A 1BC8C 3DP7A 4QWQA 4ZDOA 5M5YJ 5DS9A 5EJCA 1MBHA 1RR7A 1MMGA 1I39A 1KZHA 4DJAA 2ZXIA 2AQFA 2GXGA 3RI4A 4AVPA 2UUZA 4A0YA 3WU2C 4B43A 1B6AA 1YX3A 3DEUA 4BE1A 4E6KG 1FBSA 4IRHA 3BZKA 4IHWA 3S16J 4XONA 3FXQA 1HQCA 4LD5A 1YIJI 1H9TA 3LWFA 3OYHA 4GFBA 1P2FA 4O3MA 3I4MJ 3L1PA 2OCCH 2VKDA 2JVHA 3ECHA 3FKJA 3SYTA 3Q5FA 1HA8A 2X4HA 1IXCA 1J9IA 3FXMA 1WGXA 2XGEA 4W97A 2IBDA 3R60A 2JA6J 5E3LA 1HXDA 2DA3A 2Y0SN 3JRDA 1STZA 2PQ8A 1RIOH 4LB5A 1MDMB 2OQRA 1GDTA 2CO5A 4UUTA 5ICCA 2EA2A 3R0JA 4EVIA 2B63J 4JK1X 1TTYA 2BV6A 2YR2A 4N9IA 3WE2A 4MTDA 5ICGA 1KU9A 4FE7A 5IP7J 4LITA 2NOGA 4RMNA 4KIFA 1XMXA 2DMUA 3N05A 1DP7P 3QU3A 4UUVA 1TC3C 1BC7C 3MZ8A 2ID3A 2E19A 1DU0A 1MNEA 3F8BA 2VBWA 2RNJA 2H1LA 3OY9A 1X3ZB 2QA4I 2HZDA 2F5FA 4BJTA 3DBLB 1XGMA 3WHCA 3K1PA 2LDUA 3LMMA 5LRSA 4HA8A 4J00A 3DLLF 3G4SI 3ZQGA 3BY6A 1XSVA 2OZ6A 3Q9VA 2A5WA 2VT3A 3GUDA 2EFPA 4LG0B 2ECBA 1YRNB 3WTXC 4QTRA 1POGA 4F3QA 2AO9A 1G8XA 4A69C 1BI2A 2EPFA 1R7JA 3KEQA 2M4GA 3NAUA 3ONQA 3ASNH 1IDYA 3A1YA 2LRDA 4I01A 4BAYA 4RB0A 5E3NA 1I6XA 2F5CA 2HWVA 1OYYA 3ZR8X 2NOJB 4NHJA 4DGWB 3RKYA 3GTKJ 4BUPA 4PJLA 5FLXZ 6PAXA 3AKZA 4EGYA 3S2WA 4ANJA 2FBHA 1JKQC 3DCFA 1K6OA 1BIAA 1WJBA 1X4PA 3I56I 5FO5A 4IVNA 3HSFA 3ZXSA 2VKEA 5E79C 1EKEA 3KZZA 3EUHA 2W82A 3ZMSA 1REPC 2DW4A 3CCJI 2QEXI 1YTYA 4UY8I 2JPCA 4RAFA 4W1UA 2KL4A 3RSNA 5EGOB 2QSFX 3PUBA 1PJRA 4JP0A 2EQRA 4D7MA 2KIUA 2L54A 1A35A 1X1PA 2HXOA 5ICFA 4IX7A 2WC2A 2ACJA 1Y56A 3KE2A 1H9GA 4Q4ZF 4LG3A 3L2WA 3C2GA 4EJOA 3ZMZA 2M5WA 3M1CA 1WJEA 1SAXA 2XRNA 2XUBA 2DT7B 3CC4I 3BR5A 5GTIC 5D4RA 4IOCF 1SD5A 4M72A 2R7XA 4XSZF 2HZTA 5L3FA 2IAIA 2N8GA 3ZMDA 3MKYB 2HKXA 2VE9A 1W0TA 1RPWA 2NVUB 1CF7B 1Y1VJ 1IN8A 3OYKA 4LOCA 2IA0A 1HBXG 3MCZA 1ZQ3P 4ESFA 2EB7A 2A69F 2OTJI 2ZJQF 3AG1H 1OJLA 2XAJA 5EZGA 4IZZA 3KYLA 4Y13A 1ZAOA 2ZXHA 4U7DA 5KVRA 4U0YA 3HOVJ 2PN6A 4IL6C 3DTEA 2NNNA 4A5MA 4HBLA 3CDHA 1RC9A 2R93J 5DD4A 4LK0F 3H3ZA 4HDUA 4PUSA 4PFPA 1JJ6C 3OYMA 4KUMA 2IPQX 4KMUX 3TO9A 4HV6A 3ZQIA 5B5EC 5D5VB 1ZGJA 3OWTA 5JVTA 2IS1A 1D5VA 1IJWC 2FOKA 3CTAA 4XNFA 3IUOA 3QAHA 2JA2A 1FNNA 4H4KC 2MGQA 1KQ0A 2CUFA 2J5OA 3NEUA 4F92B 4FE4A 2VJ5A 4HX7A 5FLMJ 1U9NA 2K4JA 2Z1DA 1FMVA 2E7XA 4ASNA 2PMHA 1FT9A 3MZYA 3PSFA 4L9TA 2OF7A 3ECOA 1B8IB 4L0ZB 2CMPA 3GLXA 2EK5A 3BTJA 1YO5C 1UZCA 3LAPA 3S15J 2L9NA 3ABTA 1CGPA 4G12A 3SZTA 3LSGA 2VKVA 2LF7A 2WA0A 1O7FA 4L5EA 2L4AA 1Z21A 3FXLA 4ESBA 1PYVA 2DAOA 4UVAA 2UXNA 4EJUA 1VQ4I 4X0GA 2WAEA 1W36C 2BY1A 3ELKA 4BHBA 3H5AA 2F48A 3EUAA 3WTTC 3IV5A 5C4JJ 3U1DA 1Z91A 1ZLKA 3O2PE 3FMRA 2W84A 3GFMA 3TL4X 3WTWC 5FFXA 2CYYA 1VQPI 3MQ0A 3G1OA 5J1RA 4CYCA 2W00A 4DZJA 5LLQA 2DYSH 4WWCA 1GV2A 3GTPJ 1WJ5A 1OCRH 4KJZA 3KEOA 2DDBA 5JR3A 1LFUP 5F64A 2DFFA 2Z9OA 3QP5A 4IF4A 5M5XJ 3BPXA 3ZQCA 1LDKB 4I76A 3VOEA 2O3FA 2DI3A 3MEXA 3EPZA 4I98B 3KIOA 1ZRCA 3AG4H 2LSOA 2PBIA 1S7EA 3R4KA 2GQQA 4MGRA 4NC6A 2HVQA 1TT5B 3R0AA 1NH3A 1WFXA 1DQUA 1U5TB 5EZHA 1SVLA 3HZJA 1FTTA 2E5ZA 2Y75A 4A3DJ 1ODDA 2MYSA 2YX4A 4AVZA 2H8WA 3JRGA 2CW7A 1J0RA 4A0XA 4NBQA 3VYTB 2K9NA 3H92A 3QRFF
chains in the Genus database with same CATH topology
2LY9A 2CRGA 2X48A 3BG3A 2DTZA 2YUSA 1B72B 1LE8B 2MG4A 1IC8A 1BA5A 2ZB9A 2LR8A 1VNDA 4BBSJ 1ETKA 1JUSA 3LSJA 1HOMA 5C4XJ 3G1MA 2H1KA 3BR1A 1JUMA 4Y52J 3GTQJ 1AKHB 3BR6A 2AHQA 3RQIA 2R5YA 1B8IA 1TWFJ 3RKQA 3F0CA 5EGOA 1ZTRA 2Y9ZA 1Y1WJ 3HOUJ 1SANA 2GBYA 1JKOC 5FKLA 3S1QJ 4M3FA 2DA7A 2I10A 1I3QJ 5IOYA 3ZQLA 1ZR2A 3I4NJ 3BQYA 3K2AA 4A3MJ 4A3BJ 1U8BA 5J1UA 4M6VA 2ID6A 5K7FA 2QF7A 1TWGJ 2R7ZJ 4UUSB 4JX4A 4IHXA 2XGDA 3CCYA 2CU7A 4FCYA 4BBRJ 4C3JJ 1Q1VA 2MW8A 2E2IJ 2DA2A 3BT9A 2CJJA 2XGCA 2M0CA 5IP6A 2HQ5A 1K61A 4IEJA 2Y31A 3ZQFA 4D5FA 3PO3J 1MBEA 5M3FJ 3MN2A 1YRNA 5K7HA 3HDDA 1U78A 4XIDA 4IHYA 5FLVA 3GTGJ 3FISA 4M3GA 4HNVA 2R92J 5C44J 2DMNA 2DA6A 3HKZN 2O7OA 1QVUA 1OCTC 4M3BA 2R5ZA 2XPUA 4MLOA 1H8AC 3S1RJ 2RAEA 4BKXA 2K9SA 3Q3SA 4V2GA 2M2EA 2DJNA 4DYCA 5F08A 3H3VK 1HDPA 2LFBA 1NK3P 3JRFA 3BR2A 2LVSA 3H0GJ 1GT0C 2HOAA 4MFDA 1D5YA 2VUMJ 2JK3A 3DEWA 3UKGA 1Z0XA 5GPCA 1ETOA 1HLVA 2LTPA 4JYKA 1WH5A 2HYJA 4A3JJ 2HOTA 2JWTA 3FK7A 1R9TJ 4NDLA 1DU6A 1XC5A 2LD5A 3JRIA 3GTMJ 2HI3A 4S0HB 3S17J 2WB1N 1X2NA 3QPLA 5FJ8J 1H89C 4B3AA 1BW5A 4BY7J 1ETVA 3IH3A 1O4XA 2M34A 1VI0A 4A3CJ 1JKRC 2DMPA 2XPWA 2L7FP 1APLC 2DA1A 3BR3A 5EG0A 3CDLA 1UMQA 2EZHA 1AHDP 5IYCJ 3VPRA 2PMZN 2DA5A 1JT0A 1VF9A 1HCRA 1TWCJ 1BW6A 1VFCA 2ELKA 1XS9A 3A01B 5EF6A 4V2FA 1P7IA 1Z77A 4M3DA 5FKKA 2XSDC 1ENHA 1SFOJ 3S1MJ 1JT6A 3HM5A 1I6HJ 2XPVA 4A3KJ 4DW6A 1WH7A 3LNQA 4A3GJ 2WV1A 3GTOJ 3A02A 3MKLA 1MBJA 1MH4A 5C3EJ 5EEAA 3O8GA 4IHVA 2LK2A 4A3IJ 2JA5J 3QQAA 2L7ZA 3HGGA 5FKOA 1IGNA 2JJ7A 4XICA 1GV5A 1JUPA 4XRSG 4C3HJ 4BY1J 2TRTA 3SDGA 1FJLA 4FISA 3S14J 2K9QA 4MO7A 2Y2ZA 3CQZJ 5M5YJ 2EZLA 3Q0UA 1OCPA 5DS9A 2CQXA 1MBHA 1RR7A 2ME6A 2FD5A 3A01A 2HOSA 3A03A 1ZGWA 1QPIA 1A6IA 2X9DA 2L9RA 4IHWA 3S16J 3JR9A 3RZOJ 3E7LA 4GFBA 3I4MJ 3L1PA 2R5YB 3PO2J 1IDZA 1WGXA 3OSGA 2XGEA 3LSRA 2O8KA 4W97A 2IBDA 2XB5A 1GVDA 2JA6J 5E3LA 4QIWN 2DA3A 4X6AJ 3WHBA 2Y0SN 3JRDA 3BTLA 3HOZJ 3LOCA 1F43A 1T56A 3HOWJ 1LFBA 4QSHA 4C2MJ 1WI3A 5M3MJ 3NARA 4J19A 5GPAA 4BXXJ 1MBKA 5FKMA 1GDTA 2G0EA 4UUTA 2E2HJ 2KT0A 2NVYJ 2B63J 2GLOA 1IV6A 1ETXA 3HEFA 2R5ZB 4FE7A 2HXIA 5IP7J 3W6VA 2NOGA 2DMQA 2DMUA 1MSFC 3OOUA 1TC3C 4A3FJ 2ID3A 3HOYJ 3HB9A 2E19A 3HOXJ 1DU0A 4A93J 2KDZA 2ME0A 4RBOA 2DN0A 1RESA 5BNGA 4M3EA 2Y9YA 3WHCA 3OSFA 1RKWA 1H88C 2XRLA 3ZQGA 3QPSA 4XRMA 2ECBA 4UUSA 1YRNB 4QTRA 1POGA 2DA4A 2AO9A 2JMWA 3TW6A 4A69C 4JX6A 5J1YA 3B6CA 3BG9A 1HF0A 3BG5A 3NAUA 3BQZA 1IDYA 2VI6A 5E3NA 2COBA 4FTHA 3M4OJ 3RZDJ 4D7NA 1QVTA 3GTKJ 4EEFG 4AC0A 5EG0B 3TP3A 2DMTA 3CMYA 3TEDA 4A3EJ 2R0QC 1JKQC 3GTJJ 3DCFA 3ZQHA 1RKTA 2X6OA 2WAQN 2VKEA 3M3YJ 4AYBN 1ETQA 2FQ4A 4W1UA 2FJ1A 4MFEA 1BJZA 4AUXA 5EGOB 1T33A 2EBIA 4JP0A 3JRBA 2W48A 2EQRA 3K7AJ 5F0FA 4D7MA 1AKHA 3JREA 2VPRA 1TWHJ 2HXOA 4B4CA 3LSPA 2M8GX 2P81A 1GUUA 1FIAA 1P7JA 5J3LA 1OFCX 1PUFB 2TCTA 1LE8A 3HGYA 1MBFA 1W0UA 3B6AA 2CQQA 1ETWA 4A3LJ 5DTDA 1UHSA 2OPTA 3BR5A 3JRCA 4D5CA 2NS7A 2IAIA 2N8GA 3C2BA 1W0TA 1RPWA 3SJMA 1Y1VJ 3IH4A 3D1NI 4LOCA 2E2JJ 2Y30A 2HDDA 1ZQ3P 2NVQJ 1JTXA 2ECCA 1OJLA 4X1EA 1MBGA 5EZGA 5F27A 2CUEA 3S2HJ 1HDDC 5F0CA 2NVTJ 3ZOBA 3PM1A 5EYRA 2LLKA 4XRSA 3S2DJ 2LP0A 2JA8J 5EDNA 3HOVJ 2K40A 2IEKA 4DYQA 2L0KA 5IOZA 1ORKA 3S1NJ 4B1RA 1RETA 4ABZA 2R93J 4CYCB 1WCMJ 2LKXA 4Y7NJ 1JJ6C 4C3IJ 3JRAA 3ZQIA 1PUFA 1IJWC 3GBGA 2XB0X 3BR0A 3HBLA 5F1JA 5JLWA 2MGQA 3IH2A 5F04A 2CUFA 3FKIJ 4FE4A 5FLMJ 5GP9A 2EZKA 1U9NA 3G1LA 1I50J 1FTZA 2O9LA 3BTCA 1ZR4A 2OF7A 1B8IB 2YS9A 5IPAA 3TW7A 3BTIA 2GM4A 3BTJA 1CQTA 1JKPC 2D5VA 3S15J 1NTCA 4G12A 1XG1A 3LSGA 4XK4A 1TWAJ 5E3MA 1JTYA 2VKVA 3MVPA 5M5WJ 3JRHA 2YU9J 2JN6A 4L5EA 4RDUA 1ETYA 1IRZA 1B72A 3TP0A 3O8HA 1ITYA 1MH3A 3GTLJ 5E3OA 1K83J 5IYBJ 4DYRA 1ZKGA 2EZIA 1MSEC 3IV5A 5C4JJ 1ZK8A 1G2HA 1X58A 5HODA 4DZPA 1UG2A 2NVXJ 5K7ZA 1WPKA 3G1OA 5J1RA 4CYCA 5IYDJ 1FIPA 1MNMC 2EH3A 1F36A 1NK2P 4DZJA 4MIMA 3Q0VA 1EF4A 9ANTA 1GV2A 3GTPJ 2M9HA 2NS8A 1JJ8C 3FIWA 2E1OA 5JLXA 1U9OA 3SFIA 4I6ZA 5FKNA 1LFUP 2L7MP 1E3OC 5M5XJ 3ZQCA 4I76A 1BL0A 5IP9J 1IUFA 1AU7A 2MSYA 4JX5A 1S7EA 2JA7J 1FEXA 3Q0WA 3OIOA 3FK6A 1JGGA 1FTTA 5EZHA 2H8RA 2QCOA 4A3DJ 3JRGA 1IG7A 5F0HA 1QRYA 1X2MA 1A5JA 2K9NA 2FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY9 A;  2CRG A;  2X48 A;  3BG3 A;  2DTZ A;  2YUS A;  1B72 B;  1LE8 B;  2MG4 A;  1IC8 A;  1BA5 A;  2ZB9 A;  2LR8 A;  1VND A;  4BBS J;  1ETK A;  1JUS A;  3LSJ A;  1HOM A;  5C4X J;  3G1M A;  2H1K A;  3BR1 A;  1JUM A;  4Y52 J;  3GTQ J;  1AKH B;  3BR6 A;  2AHQ A;  3RQI A;  2R5Y A;  1B8I A;  1TWF J;  3RKQ A;  3F0C A;  5EGO A;  1ZTR A;  2Y9Z A;  1Y1W J;  3HOU J;  1SAN A;  2GBY A;  1JKO C;  5FKL A;  3S1Q J;  4M3F A;  2DA7 A;  2I10 A;  1I3Q J;  5IOY A;  3ZQL A;  1ZR2 A;  3I4N J;  3BQY A;  3K2A A;  4A3M J;  4A3B J;  1U8B A;  5J1U A;  4M6V A;  2ID6 A;  5K7F A;  2QF7 A;  1TWG J;  2R7Z J;  4UUS B;  4JX4 A;  4IHX A;  2XGD A;  3CCY A;  2CU7 A;  4FCY A;  4BBR J;  4C3J J;  1Q1V A;  2MW8 A;  2E2I J;  2DA2 A;  3BT9 A;  2CJJ A;  2XGC A;  2M0C A;  5IP6 A;  2HQ5 A;  1K61 A;  4IEJ A;  2Y31 A;  3ZQF A;  4D5F A;  3PO3 J;  1MBE A;  5M3F J;  3MN2 A;  1YRN A;  5K7H A;  3HDD A;  1U78 A;  4XID A;  4IHY A;  5FLV A;  3GTG J;  3FIS A;  4M3G A;  4HNV A;  2R92 J;  5C44 J;  2DMN A;  2DA6 A;  3HKZ N;  2O7O A;  1QVU A;  1OCT C;  4M3B A;  2R5Z A;  2XPU A;  4MLO A;  1H8A C;  3S1R J;  2RAE A;  4BKX A;  2K9S A;  3Q3S A;  4V2G A;  2M2E A;  2DJN A;  4DYC A;  5F08 A;  3H3V K;  1HDP A;  2LFB A;  1NK3 P;  3JRF A;  3BR2 A;  2LVS A;  3H0G J;  1GT0 C;  2HOA A;  4MFD A;  1D5Y A;  2VUM J;  2JK3 A;  3DEW A;  3UKG A;  1Z0X A;  5GPC A;  1ETO A;  1HLV A;  2LTP A;  4JYK A;  1WH5 A;  2HYJ A;  4A3J J;  2HOT A;  2JWT A;  3FK7 A;  1R9T J;  4NDL A;  1DU6 A;  1XC5 A;  2LD5 A;  3JRI A;  3GTM J;  2HI3 A;  4S0H B;  3S17 J;  2WB1 N;  1X2N A;  3QPL A;  5FJ8 J;  1H89 C;  4B3A A;  1BW5 A;  4BY7 J;  1ETV A;  3IH3 A;  1O4X A;  2M34 A;  1VI0 A;  4A3C J;  1JKR C;  2DMP A;  2XPW A;  2L7F P;  1APL C;  2DA1 A;  3BR3 A;  5EG0 A;  3CDL A;  1UMQ A;  2EZH A;  1AHD P;  5IYC J;  3VPR A;  2PMZ N;  2DA5 A;  1JT0 A;  1VF9 A;  1HCR A;  1TWC J;  1BW6 A;  1VFC A;  2ELK A;  1XS9 A;  3A01 B;  5EF6 A;  4V2F A;  1P7I A;  1Z77 A;  4M3D A;  5FKK A;  2XSD C;  1ENH A;  1SFO J;  3S1M J;  1JT6 A;  3HM5 A;  1I6H J;  2XPV A;  4A3K J;  4DW6 A;  1WH7 A;  3LNQ A;  4A3G J;  2WV1 A;  3GTO J;  3A02 A;  3MKL A;  1MBJ A;  1MH4 A;  5C3E J;  5EEA A;  3O8G A;  4IHV A;  2LK2 A;  4A3I J;  2JA5 J;  3QQA A;  2L7Z A;  3HGG A;  5FKO A;  1IGN A;  2JJ7 A;  4XIC A;  1GV5 A;  1JUP A;  4XRS G;  4C3H J;  4BY1 J;  2TRT A;  3SDG A;  1FJL A;  4FIS A;  3S14 J;  2K9Q A;  4MO7 A;  2Y2Z A;  3CQZ J;  5M5Y J;  2EZL A;  3Q0U A;  1OCP A;  5DS9 A;  2CQX A;  1MBH A;  1RR7 A;  2ME6 A;  2FD5 A;  3A01 A;  2HOS A;  3A03 A;  1ZGW A;  1QPI A;  1A6I A;  2X9D A;  2L9R A;  4IHW A;  3S16 J;  3JR9 A;  3RZO J;  3E7L A;  4GFB A;  3I4M J;  3L1P A;  2R5Y B;  3PO2 J;  1IDZ A;  1WGX A;  3OSG A;  2XGE A;  3LSR A;  2O8K A;  4W97 A;  2IBD A;  2XB5 A;  1GVD A;  2JA6 J;  5E3L A;  4QIW N;  2DA3 A;  4X6A J;  3WHB A;  2Y0S N;  3JRD A;  3BTL A;  3HOZ J;  3LOC A;  1F43 A;  1T56 A;  3HOW J;  1LFB A;  4QSH A;  4C2M J;  1WI3 A;  5M3M J;  3NAR A;  4J19 A;  5GPA A;  4BXX J;  1MBK A;  5FKM A;  1GDT A;  2G0E A;  4UUT A;  2E2H J;  2KT0 A;  2NVY J;  2B63 J;  2GLO A;  1IV6 A;  1ETX A;  3HEF A;  2R5Z B;  4FE7 A;  2HXI A;  5IP7 J;  3W6V A;  2NOG A;  2DMQ A;  2DMU A;  1MSF C;  3OOU A;  1TC3 C;  4A3F J;  2ID3 A;  3HOY J;  3HB9 A;  2E19 A;  3HOX J;  1DU0 A;  4A93 J;  2KDZ A;  2ME0 A;  4RBO A;  2DN0 A;  1RES A;  5BNG A;  4M3E A;  2Y9Y A;  3WHC A;  3OSF A;  1RKW A;  1H88 C;  2XRL A;  3ZQG A;  3QPS A;  4XRM A;  2ECB A;  4UUS A;  1YRN B;  4QTR A;  1POG A;  2DA4 A;  2AO9 A;  2JMW A;  3TW6 A;  4A69 C;  4JX6 A;  5J1Y A;  3B6C A;  3BG9 A;  1HF0 A;  3BG5 A;  3NAU A;  3BQZ A;  1IDY A;  2VI6 A;  5E3N A;  2COB A;  4FTH A;  3M4O J;  3RZD J;  4D7N A;  1QVT A;  3GTK J;  4EEF G;  4AC0 A;  5EG0 B;  3TP3 A;  2DMT A;  3CMY A;  3TED A;  4A3E J;  2R0Q C;  1JKQ C;  3GTJ J;  3DCF A;  3ZQH A;  1RKT A;  2X6O A;  2WAQ N;  2VKE A;  3M3Y J;  4AYB N;  1ETQ A;  2FQ4 A;  4W1U A;  2FJ1 A;  4MFE A;  1BJZ A;  4AUX A;  5EGO B;  1T33 A;  2EBI A;  4JP0 A;  3JRB A;  2W48 A;  2EQR A;  3K7A J;  5F0F A;  4D7M A;  1AKH A;  3JRE A;  2VPR A;  1TWH J;  2HXO A;  4B4C A;  3LSP A;  2M8G X;  2P81 A;  1GUU A;  1FIA A;  1P7J A;  5J3L A;  1OFC X;  1PUF B;  2TCT A;  1LE8 A;  3HGY A;  1MBF A;  1W0U A;  3B6A A;  2CQQ A;  1ETW A;  4A3L J;  5DTD A;  1UHS A;  2OPT A;  3BR5 A;  3JRC A;  4D5C A;  2NS7 A;  2IAI A;  2N8G A;  3C2B A;  1W0T A;  1RPW A;  3SJM A;  1Y1V J;  3IH4 A;  3D1N I;  4LOC A;  2E2J J;  2Y30 A;  2HDD A;  1ZQ3 P;  2NVQ J;  1JTX A;  2ECC A;  1OJL A;  4X1E A;  1MBG A;  5EZG A;  5F27 A;  2CUE A;  3S2H J;  1HDD C;  5F0C A;  2NVT J;  3ZOB A;  3PM1 A;  5EYR A;  2LLK A;  4XRS A;  3S2D J;  2LP0 A;  2JA8 J;  5EDN A;  3HOV J;  2K40 A;  2IEK A;  4DYQ A;  2L0K A;  5IOZ A;  1ORK A;  3S1N J;  4B1R A;  1RET A;  4ABZ A;  2R93 J;  4CYC B;  1WCM J;  2LKX A;  4Y7N J;  1JJ6 C;  4C3I J;  3JRA A;  3ZQI A;  1PUF A;  1IJW C;  3GBG A;  2XB0 X;  3BR0 A;  3HBL A;  5F1J A;  5JLW A;  2MGQ A;  3IH2 A;  5F04 A;  2CUF A;  3FKI J;  4FE4 A;  5FLM J;  5GP9 A;  2EZK A;  1U9N A;  3G1L A;  1I50 J;  1FTZ A;  2O9L A;  3BTC A;  1ZR4 A;  2OF7 A;  1B8I B;  2YS9 A;  5IPA A;  3TW7 A;  3BTI A;  2GM4 A;  3BTJ A;  1CQT A;  1JKP C;  2D5V A;  3S15 J;  1NTC A;  4G12 A;  1XG1 A;  3LSG A;  4XK4 A;  1TWA J;  5E3M A;  1JTY A;  2VKV A;  3MVP A;  5M5W J;  3JRH A;  2YU9 J;  2JN6 A;  4L5E A;  4RDU A;  1ETY A;  1IRZ A;  1B72 A;  3TP0 A;  3O8H A;  1ITY A;  1MH3 A;  3GTL J;  5E3O A;  1K83 J;  5IYB J;  4DYR A;  1ZKG A;  2EZI A;  1MSE C;  3IV5 A;  5C4J J;  1ZK8 A;  1G2H A;  1X58 A;  5HOD A;  4DZP A;  1UG2 A;  2NVX J;  5K7Z A;  1WPK A;  3G1O A;  5J1R A;  4CYC A;  5IYD J;  1FIP A;  1MNM C;  2EH3 A;  1F36 A;  1NK2 P;  4DZJ A;  4MIM A;  3Q0V A;  1EF4 A;  9ANT A;  1GV2 A;  3GTP J;  2M9H A;  2NS8 A;  1JJ8 C;  3FIW A;  2E1O A;  5JLX A;  1U9O A;  3SFI A;  4I6Z A;  5FKN A;  1LFU P;  2L7M P;  1E3O C;  5M5X J;  3ZQC A;  4I76 A;  1BL0 A;  5IP9 J;  1IUF A;  1AU7 A;  2MSY A;  4JX5 A;  1S7E A;  2JA7 J;  1FEX A;  3Q0W A;  3OIO A;  3FK6 A;  1JGG A;  1FTT A;  5EZH A;  2H8R A;  2QCO A;  4A3D J;  3JRG A;  1IG7 A;  5F0H A;  1QRY A;  1X2M A;  1A5J A;  2K9N A;  2FX0 A; 
#chains in the Genus database with same CATH topology
 2OUM A;  3MWM A;  2X48 A;  2CRG A;  1JHH A;  3BG3 A;  3R6S A;  2YUS A;  4KIB A;  1TL8 A;  4ESJ A;  5LGT A;  2V1X A;  3OOP A;  1BA5 A;  1LFP A;  2BYV E;  1VND A;  3HUG A;  4BBS J;  1S8N A;  2NNY A;  2BGC A;  3I58 A;  4C30 A;  4CCJ A;  2LOO A;  3CDI A;  3PFI A;  2H1K A;  3DXJ F;  3K9T A;  3L9F A;  2ELJ A;  1ZN2 A;  4ENN A;  2QM3 A;  4EQQ A;  3CCV I;  1NHA A;  2K5C A;  1LQ1 A;  1Z67 A;  5HS9 A;  2MH2 A;  1TWF J;  3K4N A;  3EYI A;  3QOE A;  3RQ4 A;  1Y1W J;  1R71 A;  3HOU J;  3HRT A;  2JRM A;  5FKL A;  3BP8 A;  3BZ6 A;  4FAS D;  5CVJ A;  5IOY A;  1I3Q J;  1X1D A;  3LQR A;  4D9J A;  3IRR A;  4HEA 2;  1WZ2 A;  4XKW A;  4PFO A;  1W1W E;  4A3B J;  4BGD A;  3I55 I;  1U8B A;  3GLL A;  5J1U A;  5JI6 A;  2K4B A;  2XAU A;  2QF7 A;  1TWG J;  3MZH A;  2R7Z J;  1BI0 A;  1VQ9 I;  3X2Q H;  1HST A;  1QO0 D;  4LG0 A;  4IHX A;  4NC7 A;  2YU3 A;  2V9P A;  2XGD A;  3ABM H;  3K4B A;  1Y39 A;  4FCY A;  3U2R A;  3TOB A;  4BJ5 C;  4C3J J;  1Q1V A;  2XVC A;  4DOZ A;  2MW8 A;  4ZYG A;  5LGU A;  3DWL E;  3BT9 A;  1XPX A;  2BVL A;  3E3V A;  5LEK A;  1WKM A;  1DGR M;  3ULQ B;  3MAJ A;  4IEJ A;  2F5V A;  2WY7 Q;  5JHF A;  3CD6 I;  2ZNZ A;  4D5F A;  5L3E A;  1Y0N A;  1SFE A;  5HVQ C;  2ZKZ A;  5M3F J;  5K7H A;  4LJZ F;  5IT9 K;  4IHY A;  3OS2 A;  2NRA C;  2BBY A;  2EV0 A;  2EIJ H;  2RDP A;  2DA6 A;  1J5Y A;  1D0Y A;  3MKW B;  2ZJ2 A;  5CQE A;  1RZ4 A;  2P5L C;  4G7H F;  3K0L A;  3OL3 A;  2DK8 A;  4MLO A;  1H8A C;  1NG6 A;  4BKX A;  3GZ5 A;  2PI0 A;  2GA1 A;  3BZC A;  2F5E A;  4V2G A;  2DJN A;  4OWR B;  1BIB A;  2Y0S A;  4HST A;  2LFB A;  1NK3 P;  1TBX A;  4Z2Y A;  2KIF A;  1ZRF A;  2Q1Z B;  1RR8 C;  5LD2 C;  3H0G J;  4N0B A;  1FY7 A;  1ZGA A;  1S72 I;  1TW3 A;  2HOA A;  1D5Y A;  5FRN A;  3OS1 A;  3W2W A;  1ETO A;  4JYK A;  2IGO A;  1YFH A;  3EQL F;  3HSR A;  5GAD J;  4V19 K;  1DU6 A;  5HS7 A;  2KHM A;  3S17 J;  2EIK H;  5J8F A;  3AAF A;  2WB1 N;  4E7Z A;  1UG0 A;  1T38 A;  3QPL A;  5FJ8 J;  2Q0O A;  2F4O B;  2X6W A;  1ETV A;  3IH3 A;  2M34 A;  1FC3 A;  4WXC A;  4O5V A;  4PSW A;  4C9Y A;  4Q47 A;  3F23 A;  1UCR A;  3WGH A;  2DA1 A;  1UMQ A;  2ADU A;  2PEX A;  3VPR A;  3K6G A;  2Y48 A;  1VF9 A;  2DU9 A;  1V55 H;  2JPB A;  1ON2 A;  3GZN B;  2ELK A;  2YSR A;  3E6M A;  5HLH A;  3CES A;  1XS9 A;  2P6T A;  4IOA F;  3LSK A;  1SFO J;  4RB3 C;  3FXK A;  5FKK A;  1ENH A;  3QOD A;  1FYK A;  2LBF B;  1I6H J;  1W7P B;  1UST A;  4II3 A;  1WH7 A;  1FYL A;  4A3G J;  4G6T B;  3GTO J;  2CQ7 A;  2IGK A;  1MH4 A;  3L09 A;  1MMD A;  1KYZ A;  1LPQ A;  1RUO A;  4XKC A;  4B44 A;  2P6S A;  1TW2 A;  4I99 C;  1N77 A;  1FOK A;  3E0J B;  1JGS A;  1TLH B;  5FKO A;  1U8R A;  4BAC A;  1GXQ A;  2D45 A;  4XRS G;  3GO5 A;  3SDG A;  1O3Q A;  2K9Q A;  3Q0U A;  2L9S A;  2VQG A;  2ME6 A;  3VB2 A;  3IKV A;  1BN5 A;  3A01 A;  5LFA A;  3A03 A;  1ZGW A;  3HRU A;  2JRT A;  2ZFW A;  4OIN F;  4EV0 A;  3EDP A;  3F3X A;  2L9R A;  3H36 A;  4XKV A;  2O61 A;  3JR9 A;  3IRQ A;  3RZO J;  3I5U A;  1XDU A;  4RAG A;  3PJR A;  1IDZ A;  3OYC A;  1LB2 A;  1EH6 A;  3BC8 A;  1D1B A;  3OSG A;  3H0D A;  1K4T A;  4CCO A;  3HTU A;  4XLH A;  3DKW A;  1O3T A;  3BJ6 A;  2DQR A;  1R1T A;  2STW A;  3FDY A;  3BTL A;  3LFK A;  4PZJ A;  1ZRE A;  2STT A;  1IN7 A;  3HOW J;  5BQT A;  3QYE A;  1T8I A;  3W2V A;  5M3M J;  4BXX J;  5GPA A;  1QA6 A;  4HDV A;  1MBK A;  2P5V A;  3ZQQ A;  1J7K A;  4JOM A;  3FF5 A;  2M4K A;  3DPU A;  4M74 A;  2FF4 A;  1FBQ A;  3J81 Z;  1E17 A;  3H9J A;  4RLF A;  4CUG A;  4H0E A;  3KP7 A;  2HXI A;  4CCN A;  3W6V A;  2XAG A;  2DMQ A;  1P4A A;  3A0B C;  5GAH J;  4PSX A;  4A3F J;  4HSR A;  4BE2 A;  2XDV A;  2O8X A;  5A2Q K;  1R5H A;  2UWM A;  2KDZ A;  4LLL A;  2DN0 A;  4Q48 A;  5ED4 A;  4ZDL A;  4MQ9 F;  2CFO A;  3ZCO A;  3J80 K;  3QPT A;  2L3D A;  1EH8 A;  4M3E A;  5ERI A;  1U6G A;  1X1C A;  1RKW A;  4BS9 A;  1DPR A;  3CCR I;  4CHU A;  2O6G E;  1Z1D A;  4XRM A;  5BOX A;  2E1M B;  4UUS A;  2XSJ C;  5CVR A;  4L9J A;  5HDG A;  1I1S A;  2B0L A;  1N75 A;  3A0H C;  3JW4 A;  3M7G A;  1FBU A;  1HF0 A;  1VQ8 I;  2HS5 A;  3BQZ A;  3FXJ A;  2XF7 A;  2VI6 A;  4ZTF A;  4OIP F;  2VXD A;  2AS5 F;  1QNT A;  4FTH A;  3M4O J;  1DGW Y;  2ZME C;  4A0Z A;  1D1A A;  4HPQ A;  2V79 A;  4ZZD A;  1T95 A;  2HU9 A;  2XF6 A;  3OYJ A;  4CIC A;  3J81 K;  2R0Q C;  3G6E I;  1XDS A;  1UEL B;  3I4P A;  3ZQH A;  3ERM A;  4QPO A;  2WAQ N;  4HAM A;  3M3Y J;  2ZME B;  3HKZ A;  2MLK A;  3A2K A;  1E0E A;  3K1N A;  3KYD B;  4E7J A;  1ETQ A;  2A6T A;  2ZFU A;  4YFK F;  4P55 A;  3SZP A;  2IS6 A;  3KP3 A;  2HYF A;  4GCV A;  1BJZ A;  4AUX A;  2H6C A;  4N4N B;  3PIP F;  3TBI A;  2CS3 A;  3K7A J;  4IXA A;  1PP7 U;  2W57 A;  3PNY A;  3K4K A;  4HQE A;  4L0Y B;  2RRE A;  2HFH A;  2M8G X;  2VIX A;  2VAS A;  2X1E A;  2P81 A;  1P7J A;  2Q2E B;  3BPV A;  1OFC X;  1XGO A;  2Q8K A;  4BQQ A;  1I27 A;  3ZP5 A;  3ZPL A;  3WG9 A;  3TO6 A;  3HGY A;  1T0F C;  1R23 A;  1W0U A;  3F22 A;  2OAZ A;  2RC4 A;  4A3L J;  4A5N A;  4CZZ A;  5D4S A;  3RYR A;  2VT2 A;  4OAZ A;  5K5R A;  3JRC A;  2JTV A;  1IAW A;  2ISY A;  1U2W A;  2X1C A;  5DV5 A;  3OYA A;  3SJM A;  2HPI A;  5B1B H;  4BQN A;  4EM1 A;  2HDD A;  1K6Y A;  2K27 A;  1P4X A;  1MBG A;  2ETH A;  2A68 F;  2CUE A;  2DK5 A;  1TQP A;  5EYR A;  3C1D A;  1OIS A;  2JA8 J;  1FSH A;  5EDN A;  2K40 A;  3M1E A;  2IEK A;  5H2F C;  4DYQ A;  4CXF A;  3OYL A;  2JVG A;  3I53 A;  1ORK A;  4B48 A;  1RET A;  1WCM J;  4ZDP A;  3K4J A;  3NQO A;  2PG4 A;  4A6D A;  3WTU C;  1TNS A;  3FM3 A;  3GBG A;  2XB0 X;  1IRF A;  1L0O C;  2DLL A;  5F1J A;  5JLW A;  4BE0 A;  3HG9 A;  3TQN A;  3IH2 A;  4ON0 A;  5F04 A;  3HRS A;  3FKI J;  3G1L A;  1FTZ A;  5D6E A;  2WBM A;  4M9S A;  3WTV C;  1ZR4 A;  1R36 A;  4FHT A;  1W5S A;  5HLT A;  3TW7 A;  4A6E A;  2GM4 A;  3RDI A;  2PMU A;  1KQ9 A;  1S7A A;  4QLC U;  2D5V A;  3JAM Z;  2L4M A;  4BHC A;  1Y8Q B;  2VC1 A;  2WAQ A;  2Z16 A;  2KRC A;  4ZTJ A;  5E3M A;  2KKO A;  2XV4 S;  1AOY A;  1QHG A;  1JTY A;  3HUG B;  4N4O B;  3OYD A;  2AQE A;  3MVP A;  2RNG A;  5ILS A;  3JRH A;  3F8M A;  1IXR C;  1BOA A;  2YU9 J;  4RDU A;  1C0W A;  3CME I;  5KCM A;  4HZF A;  1ITY A;  3OR1 C;  2A5Y B;  2VKH A;  3F6O A;  5E20 A;  1YJN I;  2EIN H;  1MSE C;  3WTS C;  2DFH A;  1MMN A;  3KP5 A;  2JQ7 A;  1O7L A;  1G2H A;  1XX5 A;  4DZP A;  1UG2 A;  3L00 A;  4ENJ A;  1FMW A;  3CZ6 A;  3EET A;  2EH3 A;  3H9Q A;  2IA2 A;  1G6N A;  1BI3 A;  4I09 A;  3BJO A;  5TGT A;  1EF4 A;  1AWC A;  2DQL A;  9ANT A;  2QGU A;  4NQW B;  4AID A;  1PP8 F;  3C18 A;  2E1O A;  4ITV A;  1U9O A;  3SFI A;  3GF2 A;  5FKN A;  1R58 A;  1R1U A;  3KZI C;  1T98 A;  1IUF A;  4ZYA A;  3LSM A;  4YG2 F;  3KP6 A;  2ZC2 A;  5J6X A;  1R22 A;  2F2E A;  4G94 A;  1EJ9 A;  3Q0W A;  3OIO A;  2QQB A;  3FK6 A;  2MBF A;  3V7C A;  4CCM A;  1UB9 A;  3DU5 A;  2HR3 A;  2BY0 A;  2FEZ A;  4PDK A;  4JQF A;  1HC8 A;  3KET A;  3T5X A;  2H27 A;  1GHC A;  1A5J A;  2WWY A;  5FRO A;  3DPT A;  2ZBK A;  3GME A;  3S3N A;  3QYF A;  3BJA A;  3IWZ A;  1MDM A;  2F6C A;  3QYB A;  5GAG J;  2ZB9 A;  5J8C A;  2GOM A;  1X3W B;  3K4C A;  2VQH A;  2NYX A;  1HKS A;  3ABK H;  3IP4 B;  5C4X J;  1HOM A;  4LIV A;  1QU3 A;  1XTA A;  1JUM A;  4Y15 A;  1IO2 A;  1UHM A;  2X1D A;  3V42 A;  4S04 A;  1AKH B;  2AHQ A;  3E6D A;  2HVR A;  1BI1 A;  2BW3 A;  4HF1 A;  1BOB A;  4ETS A;  2VBX A;  1B8I A;  3F0C A;  1LVK A;  1Z05 A;  2PMZ A;  2DO7 A;  2RGV A;  2HGC A;  2DBB A;  1JKO C;  1IN4 A;  3F8F A;  3NRV A;  3EUH C;  2EV5 A;  1ZR2 A;  2CUZ A;  2E35 A;  1YQA A;  3BQY A;  2K85 A;  2CW8 A;  4Y17 A;  1LDJ A;  3WTY C;  1B9M A;  2F4M B;  1K7A A;  3ZMT A;  2ID6 A;  3M8F A;  4EM0 B;  2CW0 F;  4P9F A;  4KMF A;  4IHT A;  3W3C A;  1DDN A;  1ACI A;  3MD2 A;  1SD4 A;  4GXO A;  4JX4 A;  5J40 A;  1BR4 A;  2M1B A;  5AIQ A;  1O57 A;  3V4G A;  2M87 A;  4BH9 A;  1LNW A;  4XLN F;  4BBR J;  3SQN A;  4WXD A;  1TT0 A;  1W5T A;  2HQ5 A;  1K61 A;  2Y31 A;  4GYI A;  1MZB A;  3ZQF A;  3ERE D;  2IGN A;  1NG7 A;  3PO3 J;  3VDX A;  1OYI A;  3HDD A;  1U78 A;  4IQJ A;  3GTG J;  5FFZ A;  2FBI A;  4M3G A;  1CF7 A;  2R92 J;  2DMN A;  1HW1 A;  1ZHF A;  3LFU A;  3HKZ N;  1QVU A;  3HOS A;  2FU4 A;  1WI9 A;  2R5Z A;  3E1S A;  1OR7 A;  3FHZ A;  2KMU A;  3BCA A;  1OYW A;  2BHZ A;  2NS0 A;  1DPU A;  1ZYR F;  3CUQ C;  3D5L A;  4ZJZ A;  3IKT A;  2M2E A;  3HHH A;  2LKP A;  1KA8 A;  3TO7 A;  1OCC H;  2V1D A;  3PUF A;  4YEL A;  3VSL A;  3JRF A;  2LVS A;  1TQI A;  2DFI A;  4I0A A;  2EV6 A;  1GT0 C;  3ABU A;  2P7C B;  4LIU A;  2VUM J;  1X19 A;  2EA4 A;  3DEW A;  5LRR A;  2IP2 A;  2CSO A;  1X1A A;  3FBI B;  1Z0X A;  3J7A O;  1HLV A;  3W2A A;  1I3A A;  4XOT A;  2HOT A;  1VQO I;  1R9T J;  4NDL A;  2K3F A;  1XC5 A;  3ZN1 A;  3JRI A;  4RS8 A;  4EJW A;  1H89 C;  4B8X A;  3G2B A;  5EEH A;  3DFG A;  3K69 A;  4ZC3 A;  1KU2 A;  1VI0 A;  4LGW A;  1O3S A;  2HQN A;  2XPW A;  2L7F P;  2CG4 A;  2RV8 A;  4D0P A;  5DCF A;  3BR3 A;  3GZ6 A;  1T08 B;  1KGS A;  1D8K A;  4I0B A;  4HV5 A;  3S93 A;  1W7P D;  1W36 D;  4PK4 A;  4M6X A;  1K4S A;  1BM9 A;  1VFC A;  1ZG5 A;  5EF6 A;  2L9V A;  1Z77 A;  4M3D A;  4XRF A;  4OMY A;  3DBH B;  4GYG A;  1JT6 A;  3HM5 A;  1P92 A;  1P4W A;  5L3C A;  4U7B A;  4U87 A;  2VQC A;  3ML6 A;  1Q1H A;  4B3X A;  3MKL A;  4E7H A;  5LHI A;  4IHV A;  3QQA A;  4RLQ A;  2DPD A;  2KJC A;  2R7D A;  3HGG A;  2L7Z A;  1V5F A;  3UR3 C;  2G7H A;  2Y69 H;  3JSP A;  3PFY A;  4M6Y A;  2V7F A;  2ISZ A;  4C3H J;  2H09 A;  4BY1 J;  2TRT A;  3G73 A;  3S14 J;  1W7P A;  2VJI A;  4IRG A;  5IT3 A;  2EZL A;  3OR2 C;  1R00 A;  2CV0 A;  1OCP A;  2A3S A;  1Y8R B;  5ILV A;  1MW7 A;  1OQY A;  2PJR A;  3H5N A;  5JHU A;  1B9N A;  1IF1 A;  1A6I A;  2WAF A;  3V8L A;  3CO6 C;  2KIQ A;  5FD6 A;  1V5E A;  3KPH A;  2VOO A;  3E7L A;  1S29 A;  1T6S A;  2M3A A;  2ZSI B;  3G71 I;  3L2V A;  2E34 A;  2R5Y B;  2DFE A;  2GWR A;  1ONV A;  3T0Y A;  4OIQ F;  2D1H A;  3LSR A;  1EH7 A;  1DP3 A;  4F52 A;  4UXN A;  4L5I A;  1A6Q A;  3F9K A;  2VLA A;  4X6A J;  3WHB A;  3GXO A;  2PFB A;  4M73 A;  4KIT B;  2Z2S B;  3LOC A;  4RAY A;  1XMK A;  1T56 A;  4C2M J;  3KCC A;  2KRF A;  4HX4 A;  4J19 A;  4E70 A;  3JAM K;  2G0E A;  2YX7 A;  3I0T A;  1HW2 A;  2NVY J;  3ISP A;  1LUJ B;  3AFH A;  3E5Q A;  2GXB A;  1IV6 A;  3RCO A;  2XHK A;  3HEF A;  2UZK A;  3LSI A;  3LA3 A;  1LKX A;  2XAF A;  3OOU A;  2A07 F;  5D8L B;  4UV9 A;  2X51 A;  3DQV C;  4Y33 A;  2H94 A;  1Z6R A;  1D1C A;  3M9A A;  3HOX J;  1JI8 A;  4CSW A;  3UNG C;  4Y4R A;  3ESW B;  4RBO A;  3O6B B;  4OIR F;  4WCG A;  3KLN A;  2HPM A;  1RES A;  1YLF A;  2KIS A;  3CCU I;  3EYY A;  1YW9 A;  4RB1 A;  2IW5 A;  2IA1 A;  2QSG X;  3QPS A;  1FSE A;  4DIQ A;  2VB6 A;  3TW6 A;  3J80 Z;  3PNT A;  3FMS A;  4U0W A;  3B6C A;  3O3K A;  3OYI A;  1YJW I;  3BG5 A;  4PJJ A;  4E7K A;  2A6H F;  1QBJ A;  1FWZ A;  2E7W A;  3GYH X;  2COB A;  1J09 A;  2B7E A;  4PJM A;  3DV8 A;  2L5Q A;  3RZD J;  3PSI A;  4D7N A;  4CH7 A;  2L7K A;  4AD9 A;  1VQ7 I;  2RKH A;  4NB5 A;  1K78 B;  4AC0 A;  3PL8 A;  3FXU A;  5EG0 B;  3DEE A;  3ZN0 A;  2OZU A;  2FE3 A;  3ROU A;  3TP3 A;  3GX4 X;  1U3E M;  2K9M A;  1J75 A;  2DMT A;  4BHP A;  3CMY A;  3TED A;  3IHU A;  2W7N A;  4A3E J;  3GTJ J;  2X6O A;  4E7S A;  4UVC A;  4YRV A;  1X3U A;  2FML A;  1MJB A;  2XKO A;  3ZMU A;  4AIH A;  2FQ4 A;  2P0W A;  1R6R A;  3VSK A;  2FJ1 A;  4PGG A;  4MFE A;  1YIO A;  4R79 A;  1T0F A;  2BW3 B;  2W48 A;  4S05 A;  5F0F A;  5F1R A;  5HLG A;  3JRE A;  1AKH A;  1QHH D;  3E5X A;  2IGM A;  2VPR A;  1BR2 A;  2WAD A;  2CQN A;  2LMD A;  4XMY A;  4ENK A;  1OMI A;  3BG7 A;  3FZV A;  3LSP A;  3OMY A;  1HKQ A;  5DM6 F;  1WJC A;  4P5O A;  1GUU A;  4WXH A;  5J3L A;  3DLA A;  1N25 A;  3CJR B;  1GVJ A;  3NWS A;  3D5R C;  2P8T A;  4HF0 A;  2QUF A;  3TDZ C;  3C2H A;  3DTK A;  5E1Z B;  1WJF A;  2OJE D;  3B6A A;  1WJD A;  2CQQ A;  1ETW A;  2G7U A;  3CCE I;  1SFU A;  2V6E A;  1YYV A;  2MA3 A;  4CZC A;  5TJJ A;  3R61 A;  1JXS A;  1IXS B;  2ICW G;  1VTN C;  4OIO F;  3BCB A;  4IQ4 A;  4D5C A;  2NS7 A;  2EFN A;  1Z3Y A;  3PNV A;  4NQW A;  2KQR A;  3F6V A;  1F9N A;  2OD5 A;  3IH4 A;  1JE8 A;  4KIC A;  4BU2 A;  3HTS B;  2DOE A;  2Y30 A;  5E1X A;  5H6Q A;  4Q5S F;  2NVQ J;  1JTX A;  3CJN A;  3LA7 A;  2VC0 A;  3DF8 A;  2KZG A;  5F27 A;  3W6J B;  3S2H J;  1HDD C;  2NVT J;  3PM1 A;  2LLK A;  3S2D J;  2LP0 A;  1VQK I;  3V7R A;  1WSU A;  1U5T C;  4AIK A;  1D0Z A;  2L0K A;  4KYW A;  4HQM A;  1ZEL A;  3S1N J;  3CCM I;  3LSH A;  4CYC B;  2JSC A;  2LKX A;  4Y7N J;  1PUE E;  4C3I J;  3JRA A;  2M7B A;  5DUI A;  1PUF A;  2EWN A;  4I2O A;  4FET A;  2R7W A;  3PQK A;  4PGH A;  1E3P A;  4P9U A;  3HBL A;  2LY1 A;  3CMA I;  5A2Q Z;  2CGP A;  4ZYE A;  2HVS A;  3HJE A;  1YW7 A;  2EFO A;  2QQ8 A;  2V26 A;  1YIT I;  1Z7U A;  5GP9 A;  2EZK A;  1F1Z A;  2TDX A;  4RGR A;  3ZRG A;  2O9L A;  3HHG A;  3BOQ A;  2IJL A;  5H6R A;  2W25 A;  3DKY A;  3KEY A;  3OV8 A;  3MMY B;  1ZLJ A;  4P1W A;  5K5Q A;  3TGN A;  2YS9 A;  3RPU D;  4EJT A;  4HX8 A;  3BTI A;  2D2W A;  1CQT A;  1JKP C;  2H6B A;  4XN3 A;  3WU0 A;  5IY5 H;  2WTE A;  1NTC A;  2OA4 A;  3OIP A;  1XG1 A;  5HDN A;  4XK4 A;  3RKW A;  3DBR B;  5M5W J;  4G6Q A;  1HW5 A;  1XB4 A;  3RIR A;  2W4S A;  1ETY A;  4BDY A;  1EV7 A;  3TP0 A;  3O8H A;  1B72 A;  4UHT A;  4M71 A;  1ZKG A;  2EZI A;  4C2T A;  3WG7 H;  3K2Z A;  1UAA A;  2BXZ A;  1MMA A;  1S7O A;  4XQF A;  2LF8 A;  2X6X A;  4AWX B;  5HOD A;  4LLG F;  1RNL A;  4YEJ A;  4CDG A;  1TZL A;  1P9Q C;  1WPK A;  1XSX A;  1FIP A;  1MNM C;  4F7Z A;  1NK2 P;  4YIF A;  2EIM H;  4MIM A;  1E3H A;  2VN2 A;  1R4N B;  4KT6 A;  3K4M A;  2ZNY A;  3KP4 A;  2M9H A;  2NS8 A;  5JLX A;  4I6Z A;  3CCS I;  5D5U B;  1E3O C;  3U21 A;  2V9V A;  2GIZ A;  4GGG A;  4BJ6 C;  3HSE A;  2JUG A;  2UV1 A;  5IP9 J;  4O6J A;  1YHQ I;  2I8D A;  5HLI A;  1FEX A;  3CP8 A;  4LK1 F;  3V7S A;  1HSJ A;  5DYM A;  1JGG A;  5E1W A;  2H8R A;  2ZO4 A;  2DT6 A;  1XN7 A;  3L2U A;  3TDU C;  2KZV A;  2BY3 A;  1VQL I;  4HYE A;  2FX0 A;  3CC2 I;  3NWT A;  1VQ6 I;  2M8E A;  1S6L A;  2LY9 A;  2VE8 A;  4XKB A;  2E60 A;  1O3R A;  2EJR A;  3S3M A;  2GIV A;  2K3P A;  2XAQ A;  4RM2 A;  2LR8 A;  1G4D A;  2I5U A;  3KZY A;  3LSJ A;  1JUS A;  4UB8 C;  1IV8 A;  2ZME A;  3H9G A;  3GTQ J;  2DXI A;  3C7J A;  4XLC A;  2KIM A;  5L3D A;  2ZXW H;  3CUQ A;  3F72 A;  2RQP A;  1ON1 A;  3I9V 2;  4ZYH A;  2COM A;  2HYG D;  4IRI A;  3RKQ A;  2IS4 A;  4PJ0 C;  5EGO A;  1MND A;  4K2E A;  1VZ0 A;  2IT0 A;  3W6K B;  3I71 A;  3VEP A;  2W1O A;  4P96 A;  1QPM A;  4M3F A;  4KDP A;  2DA7 A;  2I10 A;  3KX2 A;  3P7N A;  3K70 C;  3ZQL A;  4KIS A;  5D8K B;  4XR6 A;  5CVV A;  4A3M J;  3OYF A;  5HDK A;  1T39 A;  2M45 A;  4RA2 A;  4B09 A;  2RQQ A;  4M6V A;  3FXO A;  1FPQ A;  3JSO A;  3CCL I;  3GFJ A;  4GO1 A;  1LDD A;  4UUS B;  4YFN F;  2L02 A;  3P9K A;  1A36 A;  4MEY F;  2ESH A;  3RYP A;  2LH9 A;  1SD7 A;  3WTZ A;  5KAF C;  4FT8 A;  5B1A H;  5D5W B;  3WU1 B;  3D0S A;  2K7L A;  1OR7 C;  4LLN A;  1B4A A;  1P6R A;  4QPQ A;  4RGS A;  2V4J C;  4G7Z F;  2XF5 A;  1MBE A;  3MN2 A;  1YRN A;  4XID A;  3HPG A;  1MMS A;  1ZG3 A;  3HRM A;  5FLV A;  2MFZ A;  1YJ9 I;  4D1Q A;  3FIS A;  1X1B A;  4HW0 A;  4HNV A;  2E1M C;  2HOE A;  4L18 B;  1WVR A;  3ZQ7 A;  4M3B A;  3BDD A;  3I54 A;  4UVB A;  5LEJ A;  2GAU A;  2HTS A;  2DOA A;  2XPU A;  2JT1 A;  2E1C A;  2R7R A;  3GWZ A;  1MJA A;  4AM3 A;  2QQA A;  2VPL A;  2LRE A;  4G7O F;  2ELH A;  2R7V A;  1G3T A;  1LVA A;  2Y0M A;  2L2O A;  1UFM A;  3K4L A;  5F08 A;  1SVO A;  4Y3O A;  4DBR A;  1PVE A;  2P4W A;  3I64 A;  4HF2 A;  1X4O A;  3BLY A;  2QEN A;  3LST A;  4KFC A;  2PJP A;  3JTH A;  3K1M A;  3OS0 A;  4BEH B;  3ZGK A;  1V5G A;  2CWE A;  2OU2 A;  4YIR X;  2LTP A;  4XL9 A;  3K70 D;  1WH5 A;  4BEH A;  2HYJ A;  5L3G A;  4MQV A;  2RVC A;  2BOL A;  3SZG A;  2LD5 A;  2FNA A;  2QZ8 A;  2HI3 A;  3FHN A;  4S0H B;  4BL0 B;  3RJP A;  1XGS A;  3AG3 H;  3J7Z I;  4RAZ A;  2XGX A;  2IXS A;  4OAY A;  1O4X A;  5J4V A;  1JKR C;  2DMP A;  4OOI A;  3M07 A;  2K9L A;  1APL C;  1SMY F;  2LY2 A;  2E5N A;  4MHG A;  4XOR A;  1JT0 A;  1HCR A;  1BW6 A;  2Z99 A;  1XMA A;  2FNP A;  1D0X A;  2HQR A;  1LJ9 A;  1IW7 F;  3CMM A;  2OBP A;  2DTR A;  3JCU C;  3A01 B;  2VOP A;  5LBQ A;  2XSD C;  2IVM A;  2PLY A;  1SVM A;  4FQG A;  1KYW A;  2XPV A;  5CVU A;  4A3K J;  4DW6 A;  1G3S A;  5EEG A;  3L2C A;  4XN0 A;  3ZMV A;  3LNQ A;  3GW2 A;  2WV1 A;  2R4G A;  1WWX A;  5DEQ A;  2HDC A;  2LKS A;  3A02 A;  2NXN B;  4BXF A;  1MBJ A;  5C3E J;  3M8J A;  1SEU A;  3O8G A;  1VQN I;  2LK2 A;  5JFR A;  3P9I A;  4A3I J;  1IN5 A;  2OCE A;  4KNY A;  1QQI A;  3V8K A;  3I59 B;  1ZH5 A;  2Z3Y A;  1IGN A;  3QPH A;  4M9X A;  3OYB A;  4XIC A;  4DQ2 A;  4KA4 A;  1JUP A;  4IHS A;  3LQQ A;  4FIS A;  2XAS A;  5KAI C;  1F5T A;  1G3Y A;  2GZW A;  2Y2Z A;  4MO7 A;  3CQZ J;  3ASO H;  3QOP A;  4DBQ A;  2JZY A;  2VBY A;  1HKT A;  2CQX A;  4PJN A;  3PQJ A;  1YS7 A;  2RN7 A;  1R1V A;  2FD5 A;  2HOS A;  1J2X A;  1QPI A;  1DUX C;  2DOD A;  2X9D A;  2IRF G;  1S3J A;  4B47 A;  2DYR H;  3HXL A;  1T2K A;  2MC3 A;  4XLF A;  3U1K A;  3L2Q A;  5B3S H;  3P5J A;  3CUQ B;  4BXU A;  1VQM I;  3PO2 J;  3T8T A;  1TNT A;  2O8K A;  2R7S A;  2X0L A;  2XB5 A;  1GVD A;  4QIW N;  1V3F A;  3KP2 A;  2QLZ A;  4MNU A;  3HOZ J;  3U9G A;  3IAS 2;  1F43 A;  1EA3 A;  2VON A;  1LFB A;  4UV8 A;  4II2 A;  4QSH A;  1WI3 A;  3NAR A;  3LAJ A;  3VYU B;  2Z33 A;  1MIJ A;  4YFX F;  2L01 A;  1R49 A;  5FKM A;  1YI2 I;  2E2H J;  1K79 A;  2KT0 A;  1YX5 A;  2CFX A;  4G8X A;  2GLO A;  3VFZ A;  3BWG A;  1ETX A;  4UB6 C;  2R5Z B;  2R7T A;  3L2R A;  1SFX A;  3CUO A;  3L7W A;  1MSF C;  1I5Z A;  1LEB A;  2OV7 A;  4A2U A;  2PJR B;  2QKM B;  2ESN A;  5CPR B;  1S5L C;  3HOY J;  3HB9 A;  4A93 J;  1IRX A;  2F4I A;  4XLA A;  4XLE A;  2ME0 A;  3N97 A;  5K5O A;  4NNJ A;  4XM3 A;  5BNG A;  2KLO A;  2Y9Y A;  3OYG A;  3OSF A;  2O0Y A;  3K10 A;  1H88 C;  3KLO A;  2XRL A;  4G6D A;  1UJ8 A;  4L5J A;  4ZH4 F;  2AXL A;  2X85 A;  2VJJ A;  1OCO H;  2DA4 A;  3AL0 B;  2JMW A;  1H0M A;  1IUY A;  4JX6 A;  1XCB A;  4KIG A;  5J4Y A;  3BG9 A;  5J1Y A;  4MTE A;  1FP2 A;  3E97 A;  2R7U A;  2QYO A;  4CA0 A;  3SXY A;  1R5G A;  3RPQ A;  3ABL H;  4A12 A;  5DD8 A;  4XSX F;  1JHF A;  1QVT A;  5D5X B;  4XOP A;  4EEF G;  3VYS B;  3J7Y J;  2JUC A;  2KJB A;  3QU6 A;  5CQG A;  5DCM A;  3N4M A;  3TOA A;  1WQ2 A;  3J7A Y;  1RKT A;  4AIJ A;  1XGN A;  1KON A;  4HOB A;  2F5D A;  3EUK L;  4AYB N;  1ZAR A;  2DOF A;  2MD0 A;  4HNT A;  5IT9 Z;  1B1B A;  4CYD A;  4WF2 A;  2LYC A;  1UHW A;  1Y0U A;  2R7O A;  2QQ9 A;  3H1C A;  1ZG1 A;  2O03 A;  5E18 F;  1T33 A;  2WB1 A;  2MH9 A;  4OU0 A;  2EBI A;  3JRB A;  2DDA A;  5CVI A;  2KFD A;  1A31 A;  1TWH J;  4RGU A;  1V4R A;  2E1N A;  2ZSH B;  4B4C A;  1ZRD A;  2CV1 A;  2PX9 A;  3V8J A;  4CGZ A;  1FIA A;  2E71 A;  2MD5 A;  1XCV A;  5CYV A;  1PUF B;  2TCT A;  3QWL A;  2VL8 A;  4BQA A;  5CLS A;  1LE8 A;  2VQL A;  1MBF A;  1OPC A;  2R3S A;  4HNU A;  3GFL A;  1FZP B;  4BDZ A;  5DTD A;  1UHS A;  4BYY A;  2OPT A;  2O5R A;  1QZZ A;  2W85 A;  2DJI A;  3F8N A;  2BXY A;  1U5T A;  4Z6Y A;  5BPD A;  3C2B A;  2HTJ A;  2ZXJ A;  3FBN B;  2DT5 A;  5TRD A;  3Q9S A;  3B73 A;  1WHU A;  1FP1 D;  3D1N I;  3AG2 H;  5L3B A;  2E2J J;  5BS6 A;  1SD6 A;  2QBY B;  2ECC A;  1W4M A;  4X1E A;  2K86 A;  4EAT A;  2XAH A;  4EJV A;  5F0C A;  3ZOB A;  3SEZ A;  1Y6I A;  4XRS A;  1IRG A;  4HRI A;  3HC7 A;  1Z3X A;  1N78 A;  2V1U A;  1QZE A;  2FMY A;  1FX7 A;  5IOZ A;  2EIL H;  4IKF A;  5LHH A;  3HYI A;  1SMT A;  2HQA A;  4ABZ A;  4B1R A;  3OYE A;  5KNL A;  3B02 A;  5H20 A;  2KDO A;  1F4K A;  5B66 C;  2P7V B;  4WX9 A;  5LGN A;  5D6F A;  1FYM A;  3BR0 A;  2FBK A;  1YOV B;  3M8E A;  3SFZ A;  1GLN A;  3DKX A;  1MJ9 A;  2R7Q A;  1G59 A;  1I50 J;  3KFW X;  2CQK A;  1S9H A;  4M9Z A;  3BTC A;  2YPR A;  1MD0 A;  1WRJ A;  5IPA A;  3CLQ A;  3HPH A;  4KT5 C;  1WJA A;  5FGM A;  3IAM 2;  3FX3 A;  4RB2 C;  2BY2 A;  2CV2 A;  2C6Y A;  2G9W A;  1KU3 A;  2BHY A;  1TWA J;  3CJT B;  2QVO A;  2QKL B;  1XSD A;  3RTR A;  5DCM B;  2JN6 A;  2GOX B;  2OC6 A;  1IRZ A;  3WGI A;  4NC8 A;  3IC7 A;  4I7H A;  4R1H A;  1MH3 A;  3GTL J;  1KU7 A;  4TV7 A;  1QGP A;  2V9K A;  1M1E B;  2NAZ A;  1K83 J;  1OCZ H;  4FX0 A;  5IYB J;  4DYR A;  5E3O A;  2HEO A;  1YW8 A;  3T8R A;  4CCL A;  2LNB A;  4LB6 B;  1ZK8 A;  4IO9 F;  5GTH C;  1Z9C A;  3H3U A;  1FOW A;  3JTG A;  3S3O A;  1X58 A;  3HOT A;  4ENM A;  5HOO A;  2LG4 A;  1BR1 A;  3OIQ A;  1J59 A;  1A04 A;  2NVX J;  3WGG A;  3S32 A;  3T1B A;  1SFK A;  4L9V A;  5K7Z A;  2GA2 A;  4F93 B;  5J47 A;  4OMZ A;  4IJA A;  1QZY A;  5IYD J;  3REO A;  1F36 A;  4XLP F;  2XRO A;  3E6C C;  2FSW A;  2V6C A;  3Q0V A;  3DPL C;  5FD5 A;  2A05 A;  2B9S A;  1JJ8 C;  3FIW A;  4FX4 A;  4KN7 X;  2FRH A;  2L7M P;  3OL4 A;  2FA5 A;  2BE5 F;  2OQG A;  3FMQ A;  5LHG A;  3CLO A;  2JSP A;  5DDG A;  1VQ5 I;  3E6B A;  1BL0 A;  1Z6T A;  2QBY A;  3VWB A;  2P5K A;  3F21 A;  4IPA A;  2EFQ A;  2MSY A;  1AU7 A;  2J5P A;  4JX5 A;  4LFU A;  2JA7 J;  2LC2 A;  5DM7 F;  3MFK A;  2Q2E A;  4HG2 A;  2V1N A;  3H35 A;  1SC7 A;  4F91 B;  1D8J A;  2QCO A;  4CO8 A;  5ICE A;  1IG7 A;  5F0H A;  1QRY A;  4PCQ A;  3WOD F;  1X2M A;  3RKX A;  2IS2 A;  3DU6 A;  3CC7 I;  3HIF A;  3SDB A;  2FOW A;  2DTZ A;  1B72 B;  1LE8 B;  2MG4 A;  2KP6 A;  5JVG F;  3BG6 A;  1ERD A;  5CKT A;  1IC8 A;  4HLY A;  4AU7 A;  2VXZ A;  1GXP A;  4KN4 X;  1FOX A;  2M7A A;  4LMY A;  2ZJR F;  1ETK A;  2MC4 A;  3GEZ A;  3G1M A;  5FRM A;  3I3L A;  4GRI A;  1AA7 A;  3BR1 A;  3GFI A;  4Y52 J;  1RI7 A;  3E5U A;  1OLT A;  3BR6 A;  1TP4 A;  3GVA A;  4DNC A;  3CJQ B;  3RQI A;  2E36 A;  5HS8 A;  2R5Y A;  2ZCW A;  4WK8 F;  2Z5U A;  2X6Y A;  2MLG A;  4R8H A;  4U0V A;  4BNC A;  1G3W A;  5FLX K;  2ZJP F;  1TQM A;  1ZTR A;  3G3Z A;  2Y9Z A;  1SAN A;  2GBY A;  5HNF A;  3S1Q J;  2XKP A;  3MKZ A;  2A61 A;  3FM5 A;  5E8I A;  2AXT C;  4AYB A;  4BQO A;  3I4N J;  3P9C A;  5FB2 A;  2HKO A;  3FXR A;  3K2A A;  1FOY A;  4YII A;  2OTL I;  1YS6 A;  1RRJ A;  2DCE A;  3SHF A;  5K7F A;  4G9Y A;  3A4C A;  3C3W A;  2M0M A;  2FUG 2;  1Z7L A;  2UXX A;  1B59 A;  1LEA A;  3CCY A;  3I59 A;  4ZYD A;  2CU7 A;  2A6E F;  5E17 F;  4E7I A;  2R7F A;  2E2I J;  2DA2 A;  1R5I D;  3LA2 A;  2CJJ A;  2XGC A;  2M0C A;  5IP6 A;  3CO7 C;  5TIS C;  4C2U A;  3BRO A;  5E8G A;  1I1G A;  3FWE A;  4HLX A;  2MAB A;  1E2X A;  2M30 A;  3CP2 A;  3RPU A;  5C44 J;  1D3Y A;  3KYC B;  2O7O A;  2W24 A;  1OCT C;  4I02 A;  3TMO A;  5HNH A;  3D5S C;  3S1R J;  2RAE A;  4N9H A;  1BJA A;  1R4M B;  1U0J A;  4MEX F;  2BVM A;  3DTI A;  5AIP A;  2K9S A;  3Q3S A;  5F6F A;  2VOD A;  3CF2 A;  2XIG A;  1YE9 A;  4U88 A;  4DYC A;  3H3V K;  3SEQ A;  1HDP A;  2HDW A;  4CCK A;  3BR2 A;  2EFW A;  4E4H A;  1FLI A;  3VOD A;  4MFD A;  4ZZL A;  3LL7 A;  2JK3 A;  2CH0 A;  3UKG A;  4EMS A;  4JBA A;  1RUN A;  2GXA A;  5GPC A;  5BPI A;  3TKY A;  3QP6 A;  2FQ3 A;  3PIO F;  2BZT A;  4A3J J;  1YG2 A;  2JWT A;  4RGX A;  3FK7 A;  5ILU A;  2D1V A;  2KRH A;  3F8C A;  1L3L A;  4UNO A;  3GTM J;  4L9N A;  1V54 H;  2DPU A;  3S8P A;  1X2N A;  2CUJ A;  3OYN A;  1XD7 A;  4B3A A;  2QSH X;  2HNH A;  4F55 A;  1OKR A;  4BY7 J;  2QWW A;  3HL2 A;  1BW5 A;  4NUB A;  5BMZ A;  1IN6 A;  4A3C J;  1MGT A;  3CF5 F;  1IZ1 A;  1ULY A;  5EG0 A;  3CDL A;  4EGZ A;  4J01 A;  2EZH A;  1K78 A;  1AHD P;  5IYC J;  3CCQ I;  2PMZ N;  2DA5 A;  1TWC J;  4EM2 A;  3IWF A;  1SAU A;  2VJ4 A;  3VYR B;  5K1Y A;  4V2F A;  2FXA A;  1P7I A;  4XBF A;  3S1M J;  4GDF A;  5GAE J;  1MKM A;  4E7L A;  1W5C C;  5DUK A;  2KPM A;  2LBF A;  3H5R A;  5EEA A;  4RM3 A;  3COA C;  2JA5 J;  5KHD A;  2K02 A;  1KQ8 A;  1PDN C;  3GCM A;  5AON A;  5KK1 A;  3WE3 A;  3IL2 A;  2JJ7 A;  2VBZ A;  2BEO A;  5CJ9 A;  1GV5 A;  1USS A;  3AL0 C;  1BBY A;  2XC7 A;  2WY8 Q;  1FJL A;  2WV0 A;  1BC8 C;  3DP7 A;  4QWQ A;  4ZDO A;  5M5Y J;  5DS9 A;  5EJC A;  1MBH A;  1RR7 A;  1MMG A;  1I39 A;  1KZH A;  4DJA A;  2ZXI A;  2AQF A;  2GXG A;  3RI4 A;  4AVP A;  2UUZ A;  4A0Y A;  3WU2 C;  4B43 A;  1B6A A;  1YX3 A;  3DEU A;  4BE1 A;  4E6K G;  1FBS A;  4IRH A;  3BZK A;  4IHW A;  3S16 J;  4XON A;  3FXQ A;  1HQC A;  4LD5 A;  1YIJ I;  1H9T A;  3LWF A;  3OYH A;  4GFB A;  1P2F A;  4O3M A;  3I4M J;  3L1P A;  2OCC H;  2VKD A;  2JVH A;  3ECH A;  3FKJ A;  3SYT A;  3Q5F A;  1HA8 A;  2X4H A;  1IXC A;  1J9I A;  3FXM A;  1WGX A;  2XGE A;  4W97 A;  2IBD A;  3R60 A;  2JA6 J;  5E3L A;  1HXD A;  2DA3 A;  2Y0S N;  3JRD A;  1STZ A;  2PQ8 A;  1RIO H;  4LB5 A;  1MDM B;  2OQR A;  1GDT A;  2CO5 A;  4UUT A;  5ICC A;  2EA2 A;  3R0J A;  4EVI A;  2B63 J;  4JK1 X;  1TTY A;  2BV6 A;  2YR2 A;  4N9I A;  3WE2 A;  4MTD A;  5ICG A;  1KU9 A;  4FE7 A;  5IP7 J;  4LIT A;  2NOG A;  4RMN A;  4KIF A;  1XMX A;  2DMU A;  3N05 A;  1DP7 P;  3QU3 A;  4UUV A;  1TC3 C;  1BC7 C;  3MZ8 A;  2ID3 A;  2E19 A;  1DU0 A;  1MNE A;  3F8B A;  2VBW A;  2RNJ A;  2H1L A;  3OY9 A;  1X3Z B;  2QA4 I;  2HZD A;  2F5F A;  4BJT A;  3DBL B;  1XGM A;  3WHC A;  3K1P A;  2LDU A;  3LMM A;  5LRS A;  4HA8 A;  4J00 A;  3DLL F;  3G4S I;  3ZQG A;  3BY6 A;  1XSV A;  2OZ6 A;  3Q9V A;  2A5W A;  2VT3 A;  3GUD A;  2EFP A;  4LG0 B;  2ECB A;  1YRN B;  3WTX C;  4QTR A;  1POG A;  4F3Q A;  2AO9 A;  1G8X A;  4A69 C;  1BI2 A;  2EPF A;  1R7J A;  3KEQ A;  2M4G A;  3NAU A;  3ONQ A;  3ASN H;  1IDY A;  3A1Y A;  2LRD A;  4I01 A;  4BAY A;  4RB0 A;  5E3N A;  1I6X A;  2F5C A;  2HWV A;  1OYY A;  3ZR8 X;  2NOJ B;  4NHJ A;  4DGW B;  3RKY A;  3GTK J;  4BUP A;  4PJL A;  5FLX Z;  6PAX A;  3AKZ A;  4EGY A;  3S2W A;  4ANJ A;  2FBH A;  1JKQ C;  3DCF A;  1K6O A;  1BIA A;  1WJB A;  1X4P A;  3I56 I;  5FO5 A;  4IVN A;  3HSF A;  3ZXS A;  2VKE A;  5E79 C;  1EKE A;  3KZZ A;  3EUH A;  2W82 A;  3ZMS A;  1REP C;  2DW4 A;  3CCJ I;  2QEX I;  1YTY A;  4UY8 I;  2JPC A;  4RAF A;  4W1U A;  2KL4 A;  3RSN A;  5EGO B;  2QSF X;  3PUB A;  1PJR A;  4JP0 A;  2EQR A;  4D7M A;  2KIU A;  2L54 A;  1A35 A;  1X1P A;  2HXO A;  5ICF A;  4IX7 A;  2WC2 A;  2ACJ A;  1Y56 A;  3KE2 A;  1H9G A;  4Q4Z F;  4LG3 A;  3L2W A;  3C2G A;  4EJO A;  3ZMZ A;  2M5W A;  3M1C A;  1WJE A;  1SAX A;  2XRN A;  2XUB A;  2DT7 B;  3CC4 I;  3BR5 A;  5GTI C;  5D4R A;  4IOC F;  1SD5 A;  4M72 A;  2R7X A;  4XSZ F;  2HZT A;  5L3F A;  2IAI A;  2N8G A;  3ZMD A;  3MKY B;  2HKX A;  2VE9 A;  1W0T A;  1RPW A;  2NVU B;  1CF7 B;  1Y1V J;  1IN8 A;  3OYK A;  4LOC A;  2IA0 A;  1HBX G;  3MCZ A;  1ZQ3 P;  4ESF A;  2EB7 A;  2A69 F;  2OTJ I;  2ZJQ F;  3AG1 H;  1OJL A;  2XAJ A;  5EZG A;  4IZZ A;  3KYL A;  4Y13 A;  1ZAO A;  2ZXH A;  4U7D A;  5KVR A;  4U0Y A;  3HOV J;  2PN6 A;  4IL6 C;  3DTE A;  2NNN A;  4A5M A;  4HBL A;  3CDH A;  1RC9 A;  2R93 J;  5DD4 A;  4LK0 F;  3H3Z A;  4HDU A;  4PUS A;  4PFP A;  1JJ6 C;  3OYM A;  4KUM A;  2IPQ X;  4KMU X;  3TO9 A;  4HV6 A;  3ZQI A;  5B5E C;  5D5V B;  1ZGJ A;  3OWT A;  5JVT A;  2IS1 A;  1D5V A;  1IJW C;  2FOK A;  3CTA A;  4XNF A;  3IUO A;  3QAH A;  2JA2 A;  1FNN A;  4H4K C;  2MGQ A;  1KQ0 A;  2CUF A;  2J5O A;  3NEU A;  4F92 B;  4FE4 A;  2VJ5 A;  4HX7 A;  5FLM J;  1U9N A;  2K4J A;  2Z1D A;  1FMV A;  2E7X A;  4ASN A;  2PMH A;  1FT9 A;  3MZY A;  3PSF A;  4L9T A;  2OF7 A;  3ECO A;  1B8I B;  4L0Z B;  2CMP A;  3GLX A;  2EK5 A;  3BTJ A;  1YO5 C;  1UZC A;  3LAP A;  3S15 J;  2L9N A;  3ABT A;  1CGP A;  4G12 A;  3SZT A;  3LSG A;  2VKV A;  2LF7 A;  2WA0 A;  1O7F A;  4L5E A;  2L4A A;  1Z21 A;  3FXL A;  4ESB A;  1PYV A;  2DAO A;  4UVA A;  2UXN A;  4EJU A;  1VQ4 I;  4X0G A;  2WAE A;  1W36 C;  2BY1 A;  3ELK A;  4BHB A;  3H5A A;  2F48 A;  3EUA A;  3WTT C;  3IV5 A;  5C4J J;  3U1D A;  1Z91 A;  1ZLK A;  3O2P E;  3FMR A;  2W84 A;  3GFM A;  3TL4 X;  3WTW C;  5FFX A;  2CYY A;  1VQP I;  3MQ0 A;  3G1O A;  5J1R A;  4CYC A;  2W00 A;  4DZJ A;  5LLQ A;  2DYS H;  4WWC A;  1GV2 A;  3GTP J;  1WJ5 A;  1OCR H;  4KJZ A;  3KEO A;  2DDB A;  5JR3 A;  1LFU P;  5F64 A;  2DFF A;  2Z9O A;  3QP5 A;  4IF4 A;  5M5X J;  3BPX A;  3ZQC A;  1LDK B;  4I76 A;  3VOE A;  2O3F A;  2DI3 A;  3MEX A;  3EPZ A;  4I98 B;  3KIO A;  1ZRC A;  3AG4 H;  2LSO A;  2PBI A;  1S7E A;  3R4K A;  2GQQ A;  4MGR A;  4NC6 A;  2HVQ A;  1TT5 B;  3R0A A;  1NH3 A;  1WFX A;  1DQU A;  1U5T B;  5EZH A;  1SVL A;  3HZJ A;  1FTT A;  2E5Z A;  2Y75 A;  4A3D J;  1ODD A;  2MYS A;  2YX4 A;  4AVZ A;  2H8W A;  3JRG A;  2CW7 A;  1J0R A;  4A0X A;  4NBQ A;  3VYT B;  2K9N A;  3H92 A;  3QRF F; 
#chains in the Genus database with same CATH homology
 2LY9 A;  2CRG A;  2X48 A;  3BG3 A;  2DTZ A;  2YUS A;  1B72 B;  1LE8 B;  2MG4 A;  1IC8 A;  1BA5 A;  2ZB9 A;  2LR8 A;  1VND A;  4BBS J;  1ETK A;  1JUS A;  3LSJ A;  1HOM A;  5C4X J;  3G1M A;  2H1K A;  3BR1 A;  1JUM A;  4Y52 J;  3GTQ J;  1AKH B;  3BR6 A;  2AHQ A;  3RQI A;  2R5Y A;  1B8I A;  1TWF J;  3RKQ A;  3F0C A;  5EGO A;  1ZTR A;  2Y9Z A;  1Y1W J;  3HOU J;  1SAN A;  2GBY A;  1JKO C;  5FKL A;  3S1Q J;  4M3F A;  2DA7 A;  2I10 A;  1I3Q J;  5IOY A;  3ZQL A;  1ZR2 A;  3I4N J;  3BQY A;  3K2A A;  4A3M J;  4A3B J;  1U8B A;  5J1U A;  4M6V A;  2ID6 A;  5K7F A;  2QF7 A;  1TWG J;  2R7Z J;  4UUS B;  4JX4 A;  4IHX A;  2XGD A;  3CCY A;  2CU7 A;  4FCY A;  4BBR J;  4C3J J;  1Q1V A;  2MW8 A;  2E2I J;  2DA2 A;  3BT9 A;  2CJJ A;  2XGC A;  2M0C A;  5IP6 A;  2HQ5 A;  1K61 A;  4IEJ A;  2Y31 A;  3ZQF A;  4D5F A;  3PO3 J;  1MBE A;  5M3F J;  3MN2 A;  1YRN A;  5K7H A;  3HDD A;  1U78 A;  4XID A;  4IHY A;  5FLV A;  3GTG J;  3FIS A;  4M3G A;  4HNV A;  2R92 J;  5C44 J;  2DMN A;  2DA6 A;  3HKZ N;  2O7O A;  1QVU A;  1OCT C;  4M3B A;  2R5Z A;  2XPU A;  4MLO A;  1H8A C;  3S1R J;  2RAE A;  4BKX A;  2K9S A;  3Q3S A;  4V2G A;  2M2E A;  2DJN A;  4DYC A;  5F08 A;  3H3V K;  1HDP A;  2LFB A;  1NK3 P;  3JRF A;  3BR2 A;  2LVS A;  3H0G J;  1GT0 C;  2HOA A;  4MFD A;  1D5Y A;  2VUM J;  2JK3 A;  3DEW A;  3UKG A;  1Z0X A;  5GPC A;  1ETO A;  1HLV A;  2LTP A;  4JYK A;  1WH5 A;  2HYJ A;  4A3J J;  2HOT A;  2JWT A;  3FK7 A;  1R9T J;  4NDL A;  1DU6 A;  1XC5 A;  2LD5 A;  3JRI A;  3GTM J;  2HI3 A;  4S0H B;  3S17 J;  2WB1 N;  1X2N A;  3QPL A;  5FJ8 J;  1H89 C;  4B3A A;  1BW5 A;  4BY7 J;  1ETV A;  3IH3 A;  1O4X A;  2M34 A;  1VI0 A;  4A3C J;  1JKR C;  2DMP A;  2XPW A;  2L7F P;  1APL C;  2DA1 A;  3BR3 A;  5EG0 A;  3CDL A;  1UMQ A;  2EZH A;  1AHD P;  5IYC J;  3VPR A;  2PMZ N;  2DA5 A;  1JT0 A;  1VF9 A;  1HCR A;  1TWC J;  1BW6 A;  1VFC A;  2ELK A;  1XS9 A;  3A01 B;  5EF6 A;  4V2F A;  1P7I A;  1Z77 A;  4M3D A;  5FKK A;  2XSD C;  1ENH A;  1SFO J;  3S1M J;  1JT6 A;  3HM5 A;  1I6H J;  2XPV A;  4A3K J;  4DW6 A;  1WH7 A;  3LNQ A;  4A3G J;  2WV1 A;  3GTO J;  3A02 A;  3MKL A;  1MBJ A;  1MH4 A;  5C3E J;  5EEA A;  3O8G A;  4IHV A;  2LK2 A;  4A3I J;  2JA5 J;  3QQA A;  2L7Z A;  3HGG A;  5FKO A;  1IGN A;  2JJ7 A;  4XIC A;  1GV5 A;  1JUP A;  4XRS G;  4C3H J;  4BY1 J;  2TRT A;  3SDG A;  1FJL A;  4FIS A;  3S14 J;  2K9Q A;  4MO7 A;  2Y2Z A;  3CQZ J;  5M5Y J;  2EZL A;  3Q0U A;  1OCP A;  5DS9 A;  2CQX A;  1MBH A;  1RR7 A;  2ME6 A;  2FD5 A;  3A01 A;  2HOS A;  3A03 A;  1ZGW A;  1QPI A;  1A6I A;  2X9D A;  2L9R A;  4IHW A;  3S16 J;  3JR9 A;  3RZO J;  3E7L A;  4GFB A;  3I4M J;  3L1P A;  2R5Y B;  3PO2 J;  1IDZ A;  1WGX A;  3OSG A;  2XGE A;  3LSR A;  2O8K A;  4W97 A;  2IBD A;  2XB5 A;  1GVD A;  2JA6 J;  5E3L A;  4QIW N;  2DA3 A;  4X6A J;  3WHB A;  2Y0S N;  3JRD A;  3BTL A;  3HOZ J;  3LOC A;  1F43 A;  1T56 A;  3HOW J;  1LFB A;  4QSH A;  4C2M J;  1WI3 A;  5M3M J;  3NAR A;  4J19 A;  5GPA A;  4BXX J;  1MBK A;  5FKM A;  1GDT A;  2G0E A;  4UUT A;  2E2H J;  2KT0 A;  2NVY J;  2B63 J;  2GLO A;  1IV6 A;  1ETX A;  3HEF A;  2R5Z B;  4FE7 A;  2HXI A;  5IP7 J;  3W6V A;  2NOG A;  2DMQ A;  2DMU A;  1MSF C;  3OOU A;  1TC3 C;  4A3F J;  2ID3 A;  3HOY J;  3HB9 A;  2E19 A;  3HOX J;  1DU0 A;  4A93 J;  2KDZ A;  2ME0 A;  4RBO A;  2DN0 A;  1RES A;  5BNG A;  4M3E A;  2Y9Y A;  3WHC A;  3OSF A;  1RKW A;  1H88 C;  2XRL A;  3ZQG A;  3QPS A;  4XRM A;  2ECB A;  4UUS A;  1YRN B;  4QTR A;  1POG A;  2DA4 A;  2AO9 A;  2JMW A;  3TW6 A;  4A69 C;  4JX6 A;  5J1Y A;  3B6C A;  3BG9 A;  1HF0 A;  3BG5 A;  3NAU A;  3BQZ A;  1IDY A;  2VI6 A;  5E3N A;  2COB A;  4FTH A;  3M4O J;  3RZD J;  4D7N A;  1QVT A;  3GTK J;  4EEF G;  4AC0 A;  5EG0 B;  3TP3 A;  2DMT A;  3CMY A;  3TED A;  4A3E J;  2R0Q C;  1JKQ C;  3GTJ J;  3DCF A;  3ZQH A;  1RKT A;  2X6O A;  2WAQ N;  2VKE A;  3M3Y J;  4AYB N;  1ETQ A;  2FQ4 A;  4W1U A;  2FJ1 A;  4MFE A;  1BJZ A;  4AUX A;  5EGO B;  1T33 A;  2EBI A;  4JP0 A;  3JRB A;  2W48 A;  2EQR A;  3K7A J;  5F0F A;  4D7M A;  1AKH A;  3JRE A;  2VPR A;  1TWH J;  2HXO A;  4B4C A;  3LSP A;  2M8G X;  2P81 A;  1GUU A;  1FIA A;  1P7J A;  5J3L A;  1OFC X;  1PUF B;  2TCT A;  1LE8 A;  3HGY A;  1MBF A;  1W0U A;  3B6A A;  2CQQ A;  1ETW A;  4A3L J;  5DTD A;  1UHS A;  2OPT A;  3BR5 A;  3JRC A;  4D5C A;  2NS7 A;  2IAI A;  2N8G A;  3C2B A;  1W0T A;  1RPW A;  3SJM A;  1Y1V J;  3IH4 A;  3D1N I;  4LOC A;  2E2J J;  2Y30 A;  2HDD A;  1ZQ3 P;  2NVQ J;  1JTX A;  2ECC A;  1OJL A;  4X1E A;  1MBG A;  5EZG A;  5F27 A;  2CUE A;  3S2H J;  1HDD C;  5F0C A;  2NVT J;  3ZOB A;  3PM1 A;  5EYR A;  2LLK A;  4XRS A;  3S2D J;  2LP0 A;  2JA8 J;  5EDN A;  3HOV J;  2K40 A;  2IEK A;  4DYQ A;  2L0K A;  5IOZ A;  1ORK A;  3S1N J;  4B1R A;  1RET A;  4ABZ A;  2R93 J;  4CYC B;  1WCM J;  2LKX A;  4Y7N J;  1JJ6 C;  4C3I J;  3JRA A;  3ZQI A;  1PUF A;  1IJW C;  3GBG A;  2XB0 X;  3BR0 A;  3HBL A;  5F1J A;  5JLW A;  2MGQ A;  3IH2 A;  5F04 A;  2CUF A;  3FKI J;  4FE4 A;  5FLM J;  5GP9 A;  2EZK A;  1U9N A;  3G1L A;  1I50 J;  1FTZ A;  2O9L A;  3BTC A;  1ZR4 A;  2OF7 A;  1B8I B;  2YS9 A;  5IPA A;  3TW7 A;  3BTI A;  2GM4 A;  3BTJ A;  1CQT A;  1JKP C;  2D5V A;  3S15 J;  1NTC A;  4G12 A;  1XG1 A;  3LSG A;  4XK4 A;  1TWA J;  5E3M A;  1JTY A;  2VKV A;  3MVP A;  5M5W J;  3JRH A;  2YU9 J;  2JN6 A;  4L5E A;  4RDU A;  1ETY A;  1IRZ A;  1B72 A;  3TP0 A;  3O8H A;  1ITY A;  1MH3 A;  3GTL J;  5E3O A;  1K83 J;  5IYB J;  4DYR A;  1ZKG A;  2EZI A;  1MSE C;  3IV5 A;  5C4J J;  1ZK8 A;  1G2H A;  1X58 A;  5HOD A;  4DZP A;  1UG2 A;  2NVX J;  5K7Z A;  1WPK A;  3G1O A;  5J1R A;  4CYC A;  5IYD J;  1FIP A;  1MNM C;  2EH3 A;  1F36 A;  1NK2 P;  4DZJ A;  4MIM A;  3Q0V A;  1EF4 A;  9ANT A;  1GV2 A;  3GTP J;  2M9H A;  2NS8 A;  1JJ8 C;  3FIW A;  2E1O A;  5JLX A;  1U9O A;  3SFI A;  4I6Z A;  5FKN A;  1LFU P;  2L7M P;  1E3O C;  5M5X J;  3ZQC A;  4I76 A;  1BL0 A;  5IP9 J;  1IUF A;  1AU7 A;  2MSY A;  4JX5 A;  1S7E A;  2JA7 J;  1FEX A;  3Q0W A;  3OIO A;  3FK6 A;  1JGG A;  1FTT A;  5EZH A;  2H8R A;  2QCO A;  4A3D J;  3JRG A;  1IG7 A;  5F0H A;  1QRY A;  1X2M A;  1A5J A;  2K9N A;  2FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...