2LFDA

Solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
115
structure length
115
Chain Sequence
b'MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQHLQDEQRHVEEIEKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diiron protein
publication title Solution NMR structure of Diiron protein in presence of 2 eq Zn2+
rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 54
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2lfdA00
3U8VA 2HZ8A 2LFFA 2LFDA 1Y4CA
chains in the Genus database with same CATH superfamily
4CIPA 3DM5A 3VF0A 3LLIA 1KU2A 2CNWA 4JCHA 1YYXA 5BQGA 1LM3B 4WGYA 3B0UX 4C7OB 1T6QA 4MVOA 1HMDA 2OJQA 4CDYA 1H6GA 1T5OA 2YVKA 3AGTA 3W8IA 2R7WA 2OCCC 4UDVA 3S0XA 2NSFA 2EINC 1GS9A 2A69F 2P1AA 1JRAA 4EWCA 1Q0KA 1MNDA 5COMA 2CDQA 4DVZA 2WZLA 3J06A 3GODA 4PJLA 1NG1A 3ZQVA 4G7ZF 2PP4A 1YARO 4IGGA 1M6TA 3C8GB 1FAPB 2HMZA 1ZVZA 2WVOA 2XM0A 4I1OB 4OIRF 2R7UA 4R32A 2HMQA 1HMOA 1ZYRF 2OU6A 3F47A 1E83A 3C8ZA 2XXAA 2A6HF 4LLEA 1LVKA 2J8WA 3NYLA 1T6IA 3U2LA 3MX3A 1Z3IX 2XL8A 4NC3A 4FESA 5L3QA 1VB5A 4IB4A 3LS1A 5A6KA 3NKEA 2VCBA 3C8GA 2OOCA 1GGQA 5KYYB 3TK0A 1DOWA 4KNWA 4W8PA 4XEKA 3K1IA 4MVRA 3KL4A 2JPUA 3C8GD 4J32B 4RBNA 3PHF2 4GYTA 2Q9CA 3MLGA 2L6FA 3RQFA 3NG1A 2O9XA 5B3IA 5KYWB 3M15A 4H4KC 3E9VA 2XLWA 3G4XA 3H2VA 1I5NA 3EFOB 2XLVA 3IQCA 1CGNA 1YJGA 1U89A 4OINF 5JLIA 2L6GA 3BEHA 5FCLA 3U2MA 1WGWA 2MYSA 3S27A 3WHNA 3TULA 3K66A 3M1CB 3HKKA 3FMSA 5E3CA 5T3WA 1E2XA 4MTFA 5KYXA 4G78A 5E33A 4CDVA 2I8BA 3WODF 3T6GB 1C03A 4GQHA 2IXMA 5KYWA 5JUAA 1IZMA 3AG3C 4IAQA 3Q7GA 2LFDA 5A6BA 3B9QA 4AX2A 1OCRC 3RYLA 2R9RB 4U5BE 3RQGA 4EKWA 1U6HA 2OEVA 2PX0A 1R5ID 3O55A 3QTHA 3S28A 1PV3A 2IOQA 3EG9B 5JVEA 5L0HA 4LACB 2ZXWC 4LLCA 1MMAA 4JKVA 3UMHA 3V5ZA 3VM6A 2YL0A 3SXMA 2YQYA 2XLOA 3MYFA 1OXKA 5HV9A 2Q7RA 5A69A 3EZHA 3FDQA 1NZEA 5TJ5E 3U8VA 1CGOA 3LNMB 5L0CA 4P9TA 1T01A 2HS5A 2Y3GA 5AC5A 1J8YF 2XL6A 1YZCA 3DXJF 3UMKA 1W2WA 1FTSA 2WZFA 3EHMA 2OJED 1G4WR 3FOOA 2X0CA 3U9JA 1JPJA 3M79A 1RMVA 1D0ZA 2DGJA 4J7TA 2W9YA 2F22A 4A2NB 1XZQA 1QQ3A 3W2WA 4ZLDA 3ASOC 1Q0DA 4BJ6C 1QSPA 3Q6MA 1O87A 1C17M 1MMGA 4QDLA 4MVQA 3VAYA 5B3SC 3E70C 1H7IA 4LERA 3QVYA 3B0PA 5L0GA 2XRHA 3K1HA 3EGXA 1A7EA 1Z23A 2AWYA 2KGOA 4JRZA 4JVSA 3DAGA 2J7PA 3U5SA 3UR3C 3U0CA 1I4YA 2DI3A 1H9GA 2XSEA 2LIGA 2VC9A 4G0HA 4OD5A 3TQOA 4CS9A 1VYIA 2G3KA 3POVA 1NU7D 2M64A 2Q9BA 5JSLA 1Y4CA 3S29A 2RSEB 3OA1A 4K7BA 2A0BA 3RIPA 1HE9A 3DAFA 2HZ8A 1H9TA 4KC9A 2DYRC 5CI9A 3N0TA 2YHSA 1RXQA 2KNHA 1VK5A 3KPHA 5E3AA 3NRHA 2H8AA 4NY3A 2MWQA 2R05A 4OIOF 4U5GA 1QPUA 5DQTA 4BJ5C 1LS1A 4YT5A 2ZXOA 3LUTB 2P0NA 3IEEA 4Z9JA 4JTAB 3HNLA 2R7SA 2L6HA 4FX5A 5DVWA 1KTMA 2Q00A 3H2UA 3VYWA 1WATA 4AL0A 4MVUA 2Q9AA 4HFKB 2OKUA 2Y3DA 4GEHA 4U5EE 5K0IA 3RW0A 4WJ0A 1BR2A 1ZW2A 3ABLC 4KNVA 5E2QA 3RH3A 4MTOA 5CIVA 2ZXRA 1WOLA 1O3UA 2XS1A 3R7CA 2IXNA 2R7TA 3KH2A 4QI2A 1JR8A 1V74B 4PJNA 4D4NA 4CSAA 2J9UA 4PACA 5DS5A 3M4BA 4YN0B 2XM4A 4QI0A 5EK0A 1T6UA 2KC3A 3GEHA 2HJMA 2CNWD 2IM8A 2LSEA 4MTGA 2Z15A 4O6YA 4U5FE 1IW7F 3EH2A 3HNKA 4JCZA 4CX9A 4IRUA 2EIKC 2YWAA 3ITFA 3OEOA 1YYJA 4Z9IA 2LP4A 4C3EA 2DYSC 2XXAB 2ETSA 2EPLX 5DLJA 1APCA 2CW0F 1AUEA 4JURI 4RD9A 4EBKA 5EHHA 3GEIA 2L81A 3SP1A 3LNRA 4JTDB 4MVMA 1E86A 3JZ0A 4PJMA 4W8KA 2L7AA 1A0BA 1ZHWA 1D0YA 2HJ3A 3GWNA 1A7VA 3ZC4A 4Q4ZF 3EH1A 3C7JA 2Q3TA 3PCVA 1S05A 2BC5A 1SR2A 4CDAA 3UGPA 3S9OA 3T4RA 2L9JA 1SZIA 4MQ9F 4HE8D 3IQTA 2FGYA 3B71A 4O6MA 2GAQA 4O79A 4CS8C 4FWVA 1G8XA 2CYDA 3RFYA 4E7SA 2LD6A 5BQIA 2XL4A 3DKAA 1OR3A 1K05A 1QLEC 2IXPA 2YL1A 3ZVRA 4JEAA 2R7XA 1TWHA 1LKXA 3MBGA 3WG7C 4XPWA 4BJTA 2C04A 2NUTA 4BJ6A 1XZPA 4CS7A 4E17A 5KYXB 3T6BA 1QKRA 3NMKA 3UNGC 4NTFA 1MMNA 1ZHXA 3EGDB 4JW1A 1Y6DA 4N4WA 3QW1A 3GORA 4E18A 5DS6A 1EKYA 4IJJA 1OW7A 2LK4A 5B1AC 2QLAA 3RQEA 4JJFA 1WTYA 3QVZA 4LDQA 4G7HF 2KYHA 3U3BA 2WVNA 3A9CA 4MW3A 5JT4A 3JTLO 4PFOA 4OIQF 2HUJA 3JYYA 1EI7A 2YRFA 2GDCA 4YWQA 4ONSA 4EUKB 4B6IA 3EJNA 2XS8A 3EGDA 3S84A 3SXKA 1M2OA 2R02A 3ECSA 3LLKA 3TOMA 3ZG1A 4CBEA 2X51A 2IYLD 3X1OA 2P6VA 1HE1A 5B1BC 3FOPA 2J9BA 1R4TA 2Y3BA 1U0BB 3MYIA 2WB7A 3IQ5A 1RKCA 1LE4A 1C02A 2V26A 2RD9A 3FAJA 2ICWG 2KW3C 5A6BD 4MVSA 1VMAA 1ZHYA 3HLZA 3ZTZA 2TMVP 3MFNA 2W45A 3W4YA 1Z63A 1RKEB 1RCPA 2WL8A 1ZHZA 2IBFA 3JYHA 3CAXA 1YAUO 2NSGA 2YLDA 5D92A 1YA7O 1LI5A 3ASNC 2PF4E 2CGEA 1K40A 2EPMX 4Q5SF 4XPYA 2G62A 1QVXA 2HSQA 3EGXB 1ST6A 5EGYA 3KMIA 2BE5F 1BDJB 1BZ4A 3PDMP 4O6NA 2KQ9A 1RKEA 2FFHA 4YT8A 5DS4A 3L0IA 1Q0MA 3RKOF 3AQCA 2QE9A 3L8IA 3R2PA 5L3VA 2PBEA 3DI5A 4JTCB 4Z9HA 1GQAA 3I5PA 3V5YA 4C3DA 1TFOB 4FAPB 1YA9A 5L0IA 3IQ6A 4BEMJ 4MNDA 1OKKA 3HNIA 3N2ZB 3DJNB 1FFTC 1SF8A 1NSGB 3QMKA 2J0XA 3ZIBA 3U8PA 2NG1A 5KYUA 3HTKC 4I3MA 2VASA 1ZZPA 3AJMA 3DJUB 2R7QA 2B0HA 3JSZA 3L1MA 4WGZA 2YLGA 4X0RA 3SZRA 5F5FA 1UFBA 2M4EA 4U5HA 2EPKX 2J7PD 1OQCA 1BBHA 4AE4B 5HSWA 3AG2C 3H65A 1OXBA 1EQ1A 4XLPF 1JOGA 4IAOA 1TWAA 3FAPB 3TJ5A 3M4CA 2XLDA 3A11A 3K1IC 3EHNA 5DQZA 1GM5A 4E0HA 3L8JA 4DRJB 2A68F 3SEOA 1HW1A 2HV6A 1ORJA 1SYQA 4NCQA 2AVKA 1UG7A 4LDKA 5JRAA 3CZ6A 3CEXA 4EIYA 1VLTA 4AE4A 4E7ZA 2DB4A 3FXHA 2ZXPA 4RDAA 5CI8A 1OCZC 3DE9A 1S7ZA 2HKVA 3JRMO 4ER9A 5KYNA 4YT2A 2PFDA 4JJGA 5GPGB 4BJ1A 5JP7A 4MVZA 5L0JA 1YVIA 3SXZA 2YEVA 1E84A 3CSKA 2KJGA 3T9OA 4E0IA 1F1MA 1V54C 5L0DA 1B68A 3JRTA 3B29A 1QZXA 1ZU4A 5T1DB 2PX3A 1Q0FA 2EPOA 4P6IC 1Z6AA 3AG1C 3AOUA 4ULWA 2CCYA 4D4XA 4I1MA 4PR9A 2XLEA 1VTMP 4YJWA 2HFIA 2XLHA 3ZQYA 3NDBB 1D1BA 1WWPA 2XLMA 3QW0A 3RVYA 4WABA 5A6AA 3ATPA 2KK1A 256BA 1J8MF 2NPUA 4JE9A 2QTVA 3RF3A 4ULVA 4DOZA 3JSEO 3K7DA 1Z5ZA 3DWWA 1TKNA 4DVYP 3US6A 3DMDA 4ZLCA 4CJOA 2NUTB 3I4UA 3U3FA 2H7VC 1KNYA 2WZGA 1FFHA 3W2VA 1PCXA 4XEVA 3O10A 2AU5A 1CPQA 2LCHA 2LQGA 2E87A 3GM2A 3V7OA 3SXYA 2ZD9A 2GWWA 3L34A 2GFHA 4AL1A 1N1CA 1YLMA 2P7VA 3EQLF 3LJBA 1TQGA 2YL7A 2Y69C 3K33A 1CGME 3SYNA 2BL2A 4C7OA 1MQVA 5FZTA 2R25A 5AGFA 4BG0A 4O7GA 1JPNA 4CS9C 4U9DA 3ZTMA 2ASRA 3GM3A 3DD7A 4NTAA 4EHPA 1FMWA 4EBBA 1PD1A 2R7OA 1LIHA 4XQ1A 4PK4A 1NFNA 2A6EF 5L0FA 3DZAA 4YL0A 4IWBA 2H7OA 3X2QC 4DJ9A 2VB6A 2J0WA 3F46A 3UMIA 1Q0GA 4DRHB 3ZSUA 4F4BA 4JEBA 1AEPA 3B0VC 3N24A 2HSBA 4YL3A 4U5DE 3AG4C 3SNHA 1OW6A 3TJ6A 5IY5C 3WAQA 2ZPAA 2D4UA 2EIMC 3LEOA 2QNLA 5AC4A 3I5QA 3VRCA 3C18A 4H54A 1OR2A 2V3CC 3AGUA 1NU9C 3Q7LA 2J46A 4DBQA 2HV7A 2VCAA 1AVOB 4BJ5A 3NYMA 4U9EA 2Y39A 3QZCA 5COGA 4IARA 2UUHA 1D0XA 2AP3A 1NFOA 1G5ZA 1VLSA 3JCUQ 1MMDA 1LPEA 2FAPB 1L7CA 2UUIA 4XWJA 2G3VA 4YK5A 4AK9A 1LE2A 4YT4A 1CPRA 2OEXA 5KYYA 4CSAC 4P9FA 4HFFB 3O6XA 4DXWA 1E85A 4CJGA 4G7OF 5COFA 3GM1A 4K0DA 4L6RA 3KKBA 1I4ZA 3ZDLA 1M56C 1ZW3A 1M2VB 3U9MA 1FNTc 3FVYA 4PFPA 3GEEA 3LAYA 5BQHA 5F5HA 4OD4A 5KYUB 1YDIA 1VOMA 3NMJA 2A1DD 3EFOA 4HEAJ 1TWCA 4JIOA 3LEVA 4I44A 4XTKA 3LESA 2A0UA 4C3BA 3TOLA 2Q4FA 4PJJA 5F28E 3ZWIA 4DBRA 3G4ZA 4NTBA 3C62A 1TR2A 1WN0A 3Q6NA 1SMYF 2C03A 2J45A 1M2VA 2NUPB 2AWCA 3GWLA 1TFKB 3EPVA 1BR4A 1EA8A 1K04A 2J9VA 1V4AA 1L3PA 1TWGA 5T3TA 1OKKD 1XWJA 1ORYA 2R03A 2Y3HA 3JT1A 2GA0A 2LFFA 1FR0A 2EPNA 1FMVA 4JC7A 5D91A 2P61A 4DRIB 2H7BA 4LDRA 1ORSC 3DM9B 3EG9A 4K1OA 3DE8A 4KBLA 3UGOA 1LS4A 2QY9A 4NQFA 3GANA 2VCCA 2NUPA 3KYIA 3FHDA 1OCOC 2YLIA 3EZIA 2JD3A 1YZAA 3AQBA 4N06A 3RVZA 3W8HA 1VYKA 1D1AA 4U5CE 4CS8A 3T6JA 2W4MA 1G4US 2WVQA 2B0JA 2EIJC 4M63A 1A41A 4XPXA 1HW2A 1BR1A 5A6JA 1ZU5A 2D5RB 1NLXA 1HY5A 1RJ9B 1OCCC 2EILC 2VH3A 3ABMC 4MW8A 1JMWA 2IXOA 4BPMA 3IHUA 3G50A 4J30B 1ZHTA 2YZSA 4J7YA 2I15A 4EBJA 1WASA 4A4AA 1M57C 4N6CA 2MHRA 3C63A 3NYJA 4JZAA 1Z7Qc 1NBBA 1PD0A 4ANJA 1T9KA 3CQZA 2OG2A 5BUOA 4OIPF 4CIHA 1RJ9A 4Q7CA 1DOVA 1O5HA 3NMIA 4XEFA 4KI2A 1MNEA 3OWTA 1D1CA 3IPMO 3S90A 1OW8A 2YL3A 2J9WA 2W4BA 4BEJA 5JS5A 3O39A 3LS0A 3PMRA 3TD7A 4MS2A 2OQMA 1JAFA 1V55C 2YKZA 4N6HA 4XLNF 2JX0A 3NKDA 1LI7A 2PNOA 3BRJA 3V5XA 2R7RA 3KYJA 3HJCA 3K6BA 2QUPA 4YL1A 2R7VA 2KSFA 3ABKC 1A7DA 3HNJA
chains in the Genus database with same CATH topology
3U8VA 2HZ8A 2LFFA 2LFDA 1Y4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8V A;  2HZ8 A;  2LFF A;  2LFD A;  1Y4C A; 
#chains in the Genus database with same CATH topology
 4CIP A;  3DM5 A;  3VF0 A;  3LLI A;  1KU2 A;  2CNW A;  4JCH A;  1YYX A;  5BQG A;  1LM3 B;  4WGY A;  3B0U X;  4C7O B;  1T6Q A;  4MVO A;  1HMD A;  2OJQ A;  4CDY A;  1H6G A;  1T5O A;  2YVK A;  3AGT A;  3W8I A;  2R7W A;  2OCC C;  4UDV A;  3S0X A;  2NSF A;  2EIN C;  1GS9 A;  2A69 F;  2P1A A;  1JRA A;  4EWC A;  1Q0K A;  1MND A;  5COM A;  2CDQ A;  4DVZ A;  2WZL A;  3J06 A;  3GOD A;  4PJL A;  1NG1 A;  3ZQV A;  4G7Z F;  2PP4 A;  1YAR O;  4IGG A;  1M6T A;  3C8G B;  1FAP B;  2HMZ A;  1ZVZ A;  2WVO A;  2XM0 A;  4I1O B;  4OIR F;  2R7U A;  4R32 A;  2HMQ A;  1HMO A;  1ZYR F;  2OU6 A;  3F47 A;  1E83 A;  3C8Z A;  2XXA A;  2A6H F;  4LLE A;  1LVK A;  2J8W A;  3NYL A;  1T6I A;  3U2L A;  3MX3 A;  1Z3I X;  2XL8 A;  4NC3 A;  4FES A;  5L3Q A;  1VB5 A;  4IB4 A;  3LS1 A;  5A6K A;  3NKE A;  2VCB A;  3C8G A;  2OOC A;  1GGQ A;  5KYY B;  3TK0 A;  1DOW A;  4KNW A;  4W8P A;  4XEK A;  3K1I A;  4MVR A;  3KL4 A;  2JPU A;  3C8G D;  4J32 B;  4RBN A;  3PHF 2;  4GYT A;  2Q9C A;  3MLG A;  2L6F A;  3RQF A;  3NG1 A;  2O9X A;  5B3I A;  5KYW B;  3M15 A;  4H4K C;  3E9V A;  2XLW A;  3G4X A;  3H2V A;  1I5N A;  3EFO B;  2XLV A;  3IQC A;  1CGN A;  1YJG A;  1U89 A;  4OIN F;  5JLI A;  2L6G A;  3BEH A;  5FCL A;  3U2M A;  1WGW A;  2MYS A;  3S27 A;  3WHN A;  3TUL A;  3K66 A;  3M1C B;  3HKK A;  3FMS A;  5E3C A;  5T3W A;  1E2X A;  4MTF A;  5KYX A;  4G78 A;  5E33 A;  4CDV A;  2I8B A;  3WOD F;  3T6G B;  1C03 A;  4GQH A;  2IXM A;  5KYW A;  5JUA A;  1IZM A;  3AG3 C;  4IAQ A;  3Q7G A;  2LFD A;  5A6B A;  3B9Q A;  4AX2 A;  1OCR C;  3RYL A;  2R9R B;  4U5B E;  3RQG A;  4EKW A;  1U6H A;  2OEV A;  2PX0 A;  1R5I D;  3O55 A;  3QTH A;  3S28 A;  1PV3 A;  2IOQ A;  3EG9 B;  5JVE A;  5L0H A;  4LAC B;  2ZXW C;  4LLC A;  1MMA A;  4JKV A;  3UMH A;  3V5Z A;  3VM6 A;  2YL0 A;  3SXM A;  2YQY A;  2XLO A;  3MYF A;  1OXK A;  5HV9 A;  2Q7R A;  5A69 A;  3EZH A;  3FDQ A;  1NZE A;  5TJ5 E;  3U8V A;  1CGO A;  3LNM B;  5L0C A;  4P9T A;  1T01 A;  2HS5 A;  2Y3G A;  5AC5 A;  1J8Y F;  2XL6 A;  1YZC A;  3DXJ F;  3UMK A;  1W2W A;  1FTS A;  2WZF A;  3EHM A;  2OJE D;  1G4W R;  3FOO A;  2X0C A;  3U9J A;  1JPJ A;  3M79 A;  1RMV A;  1D0Z A;  2DGJ A;  4J7T A;  2W9Y A;  2F22 A;  4A2N B;  1XZQ A;  1QQ3 A;  3W2W A;  4ZLD A;  3ASO C;  1Q0D A;  4BJ6 C;  1QSP A;  3Q6M A;  1O87 A;  1C17 M;  1MMG A;  4QDL A;  4MVQ A;  3VAY A;  5B3S C;  3E70 C;  1H7I A;  4LER A;  3QVY A;  3B0P A;  5L0G A;  2XRH A;  3K1H A;  3EGX A;  1A7E A;  1Z23 A;  2AWY A;  2KGO A;  4JRZ A;  4JVS A;  3DAG A;  2J7P A;  3U5S A;  3UR3 C;  3U0C A;  1I4Y A;  2DI3 A;  1H9G A;  2XSE A;  2LIG A;  2VC9 A;  4G0H A;  4OD5 A;  3TQO A;  4CS9 A;  1VYI A;  2G3K A;  3POV A;  1NU7 D;  2M64 A;  2Q9B A;  5JSL A;  1Y4C A;  3S29 A;  2RSE B;  3OA1 A;  4K7B A;  2A0B A;  3RIP A;  1HE9 A;  3DAF A;  2HZ8 A;  1H9T A;  4KC9 A;  2DYR C;  5CI9 A;  3N0T A;  2YHS A;  1RXQ A;  2KNH A;  1VK5 A;  3KPH A;  5E3A A;  3NRH A;  2H8A A;  4NY3 A;  2MWQ A;  2R05 A;  4OIO F;  4U5G A;  1QPU A;  5DQT A;  4BJ5 C;  1LS1 A;  4YT5 A;  2ZXO A;  3LUT B;  2P0N A;  3IEE A;  4Z9J A;  4JTA B;  3HNL A;  2R7S A;  2L6H A;  4FX5 A;  5DVW A;  1KTM A;  2Q00 A;  3H2U A;  3VYW A;  1WAT A;  4AL0 A;  4MVU A;  2Q9A A;  4HFK B;  2OKU A;  2Y3D A;  4GEH A;  4U5E E;  5K0I A;  3RW0 A;  4WJ0 A;  1BR2 A;  1ZW2 A;  3ABL C;  4KNV A;  5E2Q A;  3RH3 A;  4MTO A;  5CIV A;  2ZXR A;  1WOL A;  1O3U A;  2XS1 A;  3R7C A;  2IXN A;  2R7T A;  3KH2 A;  4QI2 A;  1JR8 A;  1V74 B;  4PJN A;  4D4N A;  4CSA A;  2J9U A;  4PAC A;  5DS5 A;  3M4B A;  4YN0 B;  2XM4 A;  4QI0 A;  5EK0 A;  1T6U A;  2KC3 A;  3GEH A;  2HJM A;  2CNW D;  2IM8 A;  2LSE A;  4MTG A;  2Z15 A;  4O6Y A;  4U5F E;  1IW7 F;  3EH2 A;  3HNK A;  4JCZ A;  4CX9 A;  4IRU A;  2EIK C;  2YWA A;  3ITF A;  3OEO A;  1YYJ A;  4Z9I A;  2LP4 A;  4C3E A;  2DYS C;  2XXA B;  2ETS A;  2EPL X;  5DLJ A;  1APC A;  2CW0 F;  1AUE A;  4JUR I;  4RD9 A;  4EBK A;  5EHH A;  3GEI A;  2L81 A;  3SP1 A;  3LNR A;  4JTD B;  4MVM A;  1E86 A;  3JZ0 A;  4PJM A;  4W8K A;  2L7A A;  1A0B A;  1ZHW A;  1D0Y A;  2HJ3 A;  3GWN A;  1A7V A;  3ZC4 A;  4Q4Z F;  3EH1 A;  3C7J A;  2Q3T A;  3PCV A;  1S05 A;  2BC5 A;  1SR2 A;  4CDA A;  3UGP A;  3S9O A;  3T4R A;  2L9J A;  1SZI A;  4MQ9 F;  4HE8 D;  3IQT A;  2FGY A;  3B71 A;  4O6M A;  2GAQ A;  4O79 A;  4CS8 C;  4FWV A;  1G8X A;  2CYD A;  3RFY A;  4E7S A;  2LD6 A;  5BQI A;  2XL4 A;  3DKA A;  1OR3 A;  1K05 A;  1QLE C;  2IXP A;  2YL1 A;  3ZVR A;  4JEA A;  2R7X A;  1TWH A;  1LKX A;  3MBG A;  3WG7 C;  4XPW A;  4BJT A;  2C04 A;  2NUT A;  4BJ6 A;  1XZP A;  4CS7 A;  4E17 A;  5KYX B;  3T6B A;  1QKR A;  3NMK A;  3UNG C;  4NTF A;  1MMN A;  1ZHX A;  3EGD B;  4JW1 A;  1Y6D A;  4N4W A;  3QW1 A;  3GOR A;  4E18 A;  5DS6 A;  1EKY A;  4IJJ A;  1OW7 A;  2LK4 A;  5B1A C;  2QLA A;  3RQE A;  4JJF A;  1WTY A;  3QVZ A;  4LDQ A;  4G7H F;  2KYH A;  3U3B A;  2WVN A;  3A9C A;  4MW3 A;  5JT4 A;  3JTL O;  4PFO A;  4OIQ F;  2HUJ A;  3JYY A;  1EI7 A;  2YRF A;  2GDC A;  4YWQ A;  4ONS A;  4EUK B;  4B6I A;  3EJN A;  2XS8 A;  3EGD A;  3S84 A;  3SXK A;  1M2O A;  2R02 A;  3ECS A;  3LLK A;  3TOM A;  3ZG1 A;  4CBE A;  2X51 A;  2IYL D;  3X1O A;  2P6V A;  1HE1 A;  5B1B C;  3FOP A;  2J9B A;  1R4T A;  2Y3B A;  1U0B B;  3MYI A;  2WB7 A;  3IQ5 A;  1RKC A;  1LE4 A;  1C02 A;  2V26 A;  2RD9 A;  3FAJ A;  2ICW G;  2KW3 C;  5A6B D;  4MVS A;  1VMA A;  1ZHY A;  3HLZ A;  3ZTZ A;  2TMV P;  3MFN A;  2W45 A;  3W4Y A;  1Z63 A;  1RKE B;  1RCP A;  2WL8 A;  1ZHZ A;  2IBF A;  3JYH A;  3CAX A;  1YAU O;  2NSG A;  2YLD A;  5D92 A;  1YA7 O;  1LI5 A;  3ASN C;  2PF4 E;  2CGE A;  1K40 A;  2EPM X;  4Q5S F;  4XPY A;  2G62 A;  1QVX A;  2HSQ A;  3EGX B;  1ST6 A;  5EGY A;  3KMI A;  2BE5 F;  1BDJ B;  1BZ4 A;  3PDM P;  4O6N A;  2KQ9 A;  1RKE A;  2FFH A;  4YT8 A;  5DS4 A;  3L0I A;  1Q0M A;  3RKO F;  3AQC A;  2QE9 A;  3L8I A;  3R2P A;  5L3V A;  2PBE A;  3DI5 A;  4JTC B;  4Z9H A;  1GQA A;  3I5P A;  3V5Y A;  4C3D A;  1TFO B;  4FAP B;  1YA9 A;  5L0I A;  3IQ6 A;  4BEM J;  4MND A;  1OKK A;  3HNI A;  3N2Z B;  3DJN B;  1FFT C;  1SF8 A;  1NSG B;  3QMK A;  2J0X A;  3ZIB A;  3U8P A;  2NG1 A;  5KYU A;  3HTK C;  4I3M A;  2VAS A;  1ZZP A;  3AJM A;  3DJU B;  2R7Q A;  2B0H A;  3JSZ A;  3L1M A;  4WGZ A;  2YLG A;  4X0R A;  3SZR A;  5F5F A;  1UFB A;  2M4E A;  4U5H A;  2EPK X;  2J7P D;  1OQC A;  1BBH A;  4AE4 B;  5HSW A;  3AG2 C;  3H65 A;  1OXB A;  1EQ1 A;  4XLP F;  1JOG A;  4IAO A;  1TWA A;  3FAP B;  3TJ5 A;  3M4C A;  2XLD A;  3A11 A;  3K1I C;  3EHN A;  5DQZ A;  1GM5 A;  4E0H A;  3L8J A;  4DRJ B;  2A68 F;  3SEO A;  1HW1 A;  2HV6 A;  1ORJ A;  1SYQ A;  4NCQ A;  2AVK A;  1UG7 A;  4LDK A;  5JRA A;  3CZ6 A;  3CEX A;  4EIY A;  1VLT A;  4AE4 A;  4E7Z A;  2DB4 A;  3FXH A;  2ZXP A;  4RDA A;  5CI8 A;  1OCZ C;  3DE9 A;  1S7Z A;  2HKV A;  3JRM O;  4ER9 A;  5KYN A;  4YT2 A;  2PFD A;  4JJG A;  5GPG B;  4BJ1 A;  5JP7 A;  4MVZ A;  5L0J A;  1YVI A;  3SXZ A;  2YEV A;  1E84 A;  3CSK A;  2KJG A;  3T9O A;  4E0I A;  1F1M A;  1V54 C;  5L0D A;  1B68 A;  3JRT A;  3B29 A;  1QZX A;  1ZU4 A;  5T1D B;  2PX3 A;  1Q0F A;  2EPO A;  4P6I C;  1Z6A A;  3AG1 C;  3AOU A;  4ULW A;  2CCY A;  4D4X A;  4I1M A;  4PR9 A;  2XLE A;  1VTM P;  4YJW A;  2HFI A;  2XLH A;  3ZQY A;  3NDB B;  1D1B A;  1WWP A;  2XLM A;  3QW0 A;  3RVY A;  4WAB A;  5A6A A;  3ATP A;  2KK1 A;  256B A;  1J8M F;  2NPU A;  4JE9 A;  2QTV A;  3RF3 A;  4ULV A;  4DOZ A;  3JSE O;  3K7D A;  1Z5Z A;  3DWW A;  1TKN A;  4DVY P;  3US6 A;  3DMD A;  4ZLC A;  4CJO A;  2NUT B;  3I4U A;  3U3F A;  2H7V C;  1KNY A;  2WZG A;  1FFH A;  3W2V A;  1PCX A;  4XEV A;  3O10 A;  2AU5 A;  1CPQ A;  2LCH A;  2LQG A;  2E87 A;  3GM2 A;  3V7O A;  3SXY A;  2ZD9 A;  2GWW A;  3L34 A;  2GFH A;  4AL1 A;  1N1C A;  1YLM A;  2P7V A;  3EQL F;  3LJB A;  1TQG A;  2YL7 A;  2Y69 C;  3K33 A;  1CGM E;  3SYN A;  2BL2 A;  4C7O A;  1MQV A;  5FZT A;  2R25 A;  5AGF A;  4BG0 A;  4O7G A;  1JPN A;  4CS9 C;  4U9D A;  3ZTM A;  2ASR A;  3GM3 A;  3DD7 A;  4NTA A;  4EHP A;  1FMW A;  4EBB A;  1PD1 A;  2R7O A;  1LIH A;  4XQ1 A;  4PK4 A;  1NFN A;  2A6E F;  5L0F A;  3DZA A;  4YL0 A;  4IWB A;  2H7O A;  3X2Q C;  4DJ9 A;  2VB6 A;  2J0W A;  3F46 A;  3UMI A;  1Q0G A;  4DRH B;  3ZSU A;  4F4B A;  4JEB A;  1AEP A;  3B0V C;  3N24 A;  2HSB A;  4YL3 A;  4U5D E;  3AG4 C;  3SNH A;  1OW6 A;  3TJ6 A;  5IY5 C;  3WAQ A;  2ZPA A;  2D4U A;  2EIM C;  3LEO A;  2QNL A;  5AC4 A;  3I5Q A;  3VRC A;  3C18 A;  4H54 A;  1OR2 A;  2V3C C;  3AGU A;  1NU9 C;  3Q7L A;  2J46 A;  4DBQ A;  2HV7 A;  2VCA A;  1AVO B;  4BJ5 A;  3NYM A;  4U9E A;  2Y39 A;  3QZC A;  5COG A;  4IAR A;  2UUH A;  1D0X A;  2AP3 A;  1NFO A;  1G5Z A;  1VLS A;  3JCU Q;  1MMD A;  1LPE A;  2FAP B;  1L7C A;  2UUI A;  4XWJ A;  2G3V A;  4YK5 A;  4AK9 A;  1LE2 A;  4YT4 A;  1CPR A;  2OEX A;  5KYY A;  4CSA C;  4P9F A;  4HFF B;  3O6X A;  4DXW A;  1E85 A;  4CJG A;  4G7O F;  5COF A;  3GM1 A;  4K0D A;  4L6R A;  3KKB A;  1I4Z A;  3ZDL A;  1M56 C;  1ZW3 A;  1M2V B;  3U9M A;  1FNT c;  3FVY A;  4PFP A;  3GEE A;  3LAY A;  5BQH A;  5F5H A;  4OD4 A;  5KYU B;  1YDI A;  1VOM A;  3NMJ A;  2A1D D;  3EFO A;  4HEA J;  1TWC A;  4JIO A;  3LEV A;  4I44 A;  4XTK A;  3LES A;  2A0U A;  4C3B A;  3TOL A;  2Q4F A;  4PJJ A;  5F28 E;  3ZWI A;  4DBR A;  3G4Z A;  4NTB A;  3C62 A;  1TR2 A;  1WN0 A;  3Q6N A;  1SMY F;  2C03 A;  2J45 A;  1M2V A;  2NUP B;  2AWC A;  3GWL A;  1TFK B;  3EPV A;  1BR4 A;  1EA8 A;  1K04 A;  2J9V A;  1V4A A;  1L3P A;  1TWG A;  5T3T A;  1OKK D;  1XWJ A;  1ORY A;  2R03 A;  2Y3H A;  3JT1 A;  2GA0 A;  2LFF A;  1FR0 A;  2EPN A;  1FMV A;  4JC7 A;  5D91 A;  2P61 A;  4DRI B;  2H7B A;  4LDR A;  1ORS C;  3DM9 B;  3EG9 A;  4K1O A;  3DE8 A;  4KBL A;  3UGO A;  1LS4 A;  2QY9 A;  4NQF A;  3GAN A;  2VCC A;  2NUP A;  3KYI A;  3FHD A;  1OCO C;  2YLI A;  3EZI A;  2JD3 A;  1YZA A;  3AQB A;  4N06 A;  3RVZ A;  3W8H A;  1VYK A;  1D1A A;  4U5C E;  4CS8 A;  3T6J A;  2W4M A;  1G4U S;  2WVQ A;  2B0J A;  2EIJ C;  4M63 A;  1A41 A;  4XPX A;  1HW2 A;  1BR1 A;  5A6J A;  1ZU5 A;  2D5R B;  1NLX A;  1HY5 A;  1RJ9 B;  1OCC C;  2EIL C;  2VH3 A;  3ABM C;  4MW8 A;  1JMW A;  2IXO A;  4BPM A;  3IHU A;  3G50 A;  4J30 B;  1ZHT A;  2YZS A;  4J7Y A;  2I15 A;  4EBJ A;  1WAS A;  4A4A A;  1M57 C;  4N6C A;  2MHR A;  3C63 A;  3NYJ A;  4JZA A;  1Z7Q c;  1NBB A;  1PD0 A;  4ANJ A;  1T9K A;  3CQZ A;  2OG2 A;  5BUO A;  4OIP F;  4CIH A;  1RJ9 A;  4Q7C A;  1DOV A;  1O5H A;  3NMI A;  4XEF A;  4KI2 A;  1MNE A;  3OWT A;  1D1C A;  3IPM O;  3S90 A;  1OW8 A;  2YL3 A;  2J9W A;  2W4B A;  4BEJ A;  5JS5 A;  3O39 A;  3LS0 A;  3PMR A;  3TD7 A;  4MS2 A;  2OQM A;  1JAF A;  1V55 C;  2YKZ A;  4N6H A;  4XLN F;  2JX0 A;  3NKD A;  1LI7 A;  2PNO A;  3BRJ A;  3V5X A;  2R7R A;  3KYJ A;  3HJC A;  3K6B A;  2QUP A;  4YL1 A;  2R7V A;  2KSF A;  3ABK C;  1A7D A;  3HNJ A; 
#chains in the Genus database with same CATH homology
 3U8V A;  2HZ8 A;  2LFF A;  2LFD A;  1Y4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...