2LFDA

Solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
115
structure length
115
Chain Sequence
MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQHLQDEQRHVEEIEKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diiron protein
publication title Solution NMR structure of Diiron protein in presence of 2 eq Zn2+
rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 54
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2lfdA00
2LFDA 2LFFA 2HZ8A 3U8VA 1Y4CA
chains in the Genus database with same CATH superfamily
1I5NA 4HFFB 3RW0A 2XLEA 1J8YF 4OD4A 5L0GA 2HZ8A 1RXQA 3UGOA 3ZTMA 5BQHA 5COMA 1Z63A 2JX0A 3RYLA 1PD1A 3AQBA 4U5GA 3ZTZA 1IZMA 3W2WA 4U5DE 2DGJA 5E3AA 3GWLA 2VASA 4PR9A 4RDAA 2Y3DA 4MTOA 1CGNA 2J9VA 4DBRA 1M6TA 2XLDA 1O87A 2BC5A 4MVSA 4NY3A 2OOCA 1OW7A 2GDCA 3GANA 2H7BA 4OIQF 1OW6A 2IXMA 3ZWIA 1TWHA 2HV7A 1AVOB 4HFKB 4NQFA 1HW1A 2LK4A 4IAQA 3GWNA 3GM3A 4YN0B 4PFOA 2LCHA 3EHMA 3J06A 2IM8A 1O5HA 1M2VA 2LSEA 4R32A 1HMDA 3LNRA 4I3MA 2GFHA 3AG3C 2YLDA 3JRMO 4IGGA 3US6A 4Q5SF 1Q0GA 2EPKX 2NPUA 3RFYA 5DQZA 3DD7A 2IYLD 4E7ZA 2M64A 4AE4A 3RQGA 1XZPA 3VM6A 4XLNF 1S05A 4I1MA 4D4XA 4YWQA 4CSAA 1LE4A 1YLMA 4IARA 4JW1A 3ZC4A 3S90A 1HMOA 1GM5A 3FAJA 3IQ6A 3S9OA 1SR2A 3LLKA 5DS4A 2EIJC 3L1MA 1NU7D 1A0BA 1ZHTA 4LDKA 4E0IA 5L0DA 3FXHA 3V5XA 1LE2A 3O39A 2BE5F 4JRZA 2I15A 3AJMA 1K04A 1GQAA 1LVKA 4EIYA 5F5HA 3AQCA 3TK0A 2D5RB 2XS8A 1NLXA 2YHSA 4ULVA 5AC4A 1VLSA 3AG4C 4DRJB 4JTDB 2OQMA 2HKVA 2J9BA 3K1HA 2HMQA 3QVYA 1VLTA 4IJJA 4MVOA 4BJ5C 4QDLA 3DE8A 4CBEA 4JCHA 2R7RA 4U5HA 5B1AC 3JYHA 5AC5A 3RH3A 1D1BA 2OJQA 3FOOA 2R02A 4BEMJ 1TWCA 5A6BA 3NG1A 1G8XA 1FAPB 2XLMA 3EG9B 4JURI 1BR4A 3FAPB 4C3EA 5GPGB 5KYNA 3DAGA 1HW2A 4CDAA 4J7YA 1WTYA 3G4ZA 3TULA 4G0HA 3JCUQ 2FFHA 3O55A 2QY9A 2Y39A 1M57C 1QLEC 3AOUA 2DYRC 2OEVA 3AG1C 2Y3GA 1YZCA 3RF3A 1BDJB 3B29A 3U3BA 3LESA 1D1CA 4X0RA 3L0IA 2WVOA 3IHUA 2BL2A 2WZFA 4C7OB 2L6GA 3MLGA 5A69A 1RKEB 1TR2A 4N4WA 5F5FA 2XXAB 3S28A 1SYQA 4EBBA 1GS9A 1APCA 4HE8D 3ECSA 4IB4A 3DM9B 3HKKA 4DVZA 1OR3A 2VCAA 1OXBA 2ASRA 4NC3A 5JLIA 1E83A 2XM4A 3G50A 2NUPA 2Q3TA 1NZEA 2IBFA 4WABA 2AP3A 2W9YA 3M79A 3WHNA 2MYSA 2VCCA 2WB7A 4U5EE 5COGA 3UMHA 2AWYA 3IQ5A 2KW3C 1ZYRF 4LDQA 1RJ9A 4ZLCA 3GEEA 4E0HA 4DOZA 2PP4A 2B0HA 4MW8A 4CS8C 2EPOA 2M4EA 1TWAA 3JYYA 1RCPA 2OG2A 3U5SA 1YYXA 2EILC 2GA0A 2A68F 3CAXA 4MVUA 1GGQA 1ZHZA 2KK1A 4ZLDA 1NU9C 3OWTA 3EJNA 4O6MA 4ER9A 2R7UA 1MMNA 2DYSC 4LACB 2WZLA 5L3QA 4CJGA 1OKKA 3OA1A 5L0FA 5HV9A 4C7OA 3B9QA 3WAQA 1KTMA 5BQGA 2EINC 3QW1A 1RKEA 4GQHA 1VYIA 3C62A 4WGYA 1G4WR 3EH2A 2A0UA 4L6RA 5T3TA 1JOGA 1MQVA 2MWQA 4OIOF 1SF8A 3KMIA 2R7OA 2XL4A 2ZXPA 4BJ5A 2XS1A 3T9OA 1JMWA 2AWCA 2P0NA 1TKNA 4W8KA 4EUKB 2L6HA 3KH2A 4JZAA 3UMIA 4BG0A 3JRTA 4DJ9A 1HY5A 5KYWA 4FWVA 3U8VA 2CDQA 2CYDA 1YVIA 3KPHA 4P9TA 4W8PA 4E17A 3EFOA 2QE9A 4YT2A 1CPRA 2R7SA 2QLAA 4KBLA 3L8JA 5KYXB 3SXMA 4EBJA 4DBQA 5KYUB 1D1AA 1QKRA 3ABKC 3N2ZB 3C63A 3NDBB 3HNLA 3LEVA 3NMJA 2ZD9A 4M63A 1H9TA 3HNKA 4Q7CA 5F28E 3GORA 3C8GD 3Q7LA 3E70C 1E85A 1T9KA 1TFOB 1FMWA 2P61A 1Q0KA 2HSQA 3EGXA 3EZHA 3RVYA 4E7SA 3EHNA 2EPNA 3A11A 3V5ZA 4U5FE 2D4UA 4A2NB 3HNJA 1VMAA 2CCYA 1VK5A 2CNWA 5D91A 2ZXRA 4H4KC 2EIKC 2R7XA 4MVMA 1JRAA 3NYJA 2VH3A 3O10A 3JTLO 4XPXA 3ZVRA 1T6IA 2OU6A 2KNHA 2PF4E 4EBKA 5DS5A 2W4MA 3M4CA 3M15A 3NYMA 4O6YA 4QI0A 3C8GB 3DE9A 4BJ6C 3C7JA 1L3PA 5A6BD 1HE9A 5JVEA 1EQ1A 2J8WA 1XZQA 3NMIA 2WL8A 4JKVA 3SXYA 1JR8A 1A7VA 1YJGA 2AVKA 2F22A 4AL0A 2YL1A 3DJNB 2J0XA 3QTHA 3ITFA 4U5CE 3T6BA 1K40A 2YQYA 4KI2A 3Q6MA 1VB5A 3FHDA 4BJTA 5KYXA 2ZPAA 2OKUA 5B1BC 1U89A 4XEKA 1AUEA 1C17M 2R03A 3JZ0A 2B0JA 4MNDA 3ZSUA 1FNTc 2Q9CA 2YZSA 2XLWA 1NG1A 5FCLA 2R9RB 3WODF 1LS1A 2XL6A 1FFTC 2J9UA 3CEXA 3IQTA 1HE1A 4BPMA 5FZTA 1A41A 1V54C 4PJMA 3V5YA 5E3CA 1A7EA 1I4YA 2YL3A 3DMDA 5A6JA 3Q6NA 5AGFA 4J32B 3H65A 3CZ6A 4BJ1A 1SZIA 4DRHB 1PV3A 1V4AA 4CS9C 3R2PA 4Z9IA 3ABMC 2Y69C 3IPMO 3T6JA 5KYYB 4DXWA 4I44A 1Q0FA 2H7VC 2FAPB 3RQEA 4XPWA 1ZHYA 2W45A 1EKYA 2LIGA 1EI7A 3DWWA 4YT5A 2GWWA 2NUTA 1T6QA 4QI2A 4K1OA 2EPLX 4OIPF 4G78A 4A4AA 1EA8A 2OEXA 3EH1A 1JAFA 2L7AA 1DOWA 3K1IC 4LLEA 3SYNA 1LM3B 5B3SC 2YLIA 4FESA 1BBHA 1B68A 2PX3A 3DXJF 2HJ3A 1JPJA 1YARO 3ATPA 3LLIA 4JEBA 4XWJA 3W8IA 1M56C 2G3VA 2XLHA 3WG7C 3SP1A 2R7VA 2QUPA 5T1DB 3FOPA 4MS2A 1XWJA 3EGDB 1TQGA 4HEAJ 4XPYA 5BQIA 2WVQA 3LNMB 4U9DA 3UGPA 3TOMA 1Z5ZA 4DVYP 1YA7O 1OCOC 3FMSA 1T01A 3KYJA 4CX9A 3JSZA 3BEHA 1YDIA 2AU5A 3MYFA 5L0IA 4JCZA 1QPUA 3X1OA 5COFA 2HV6A 1FTSA 1YZAA 4K0DA 3FVYA 4O79A 1WASA 3FDQA 4MVQA 2L81A 1NFNA 4G7OF 3ZQVA 4LERA 1ZU5A 2OCCC 3UMKA 3VF0A 4BJ6A 3EG9A 2A6EF 4N6HA 1LKXA 3DKAA 4I1OB 3S27A 5EGYA 3W8HA 3ABLC 1MMAA 4GEHA 3ZQYA 3N0TA 3RQFA 3PCVA 1BR1A 1ZU4A 3M4BA 5TJ5E 3UR3C 1Z6AA 3HTKC 2G62A 1D0XA 2XM0A 3H2VA 5CI8A 3T6GB 1SMYF 5BUOA 2LQGA 4EWCA 3TJ5A 4MQ9F 2VC9A 1MMDA 5DS6A 1LPEA 4MW3A 4MTFA 2NSGA 2JPUA 4CIHA 3EGDA 4JJGA 2G3KA 2XXAA 2UUHA 3C8ZA 3N24A 3U2LA 2A69F 3CQZA 5JUAA 2CNWD 1ZW3A 3AGTA 4DRIB 1Z3IX 1D0YA 1ZZPA 3PMRA 1ORJA 4JC7A 4NTBA 1VOMA 3TOLA 4CJOA 4G7HF 4XEFA 2DI3A 1TFKB 3A9CA 1E84A 4OIRF 4ANJA 2PFDA 3CSKA 4IAOA 3VYWA 4PFPA 1T6UA 2TMVP 3HJCA 1QQ3A 2HUJA 2JD3A 4J7TA 3H2UA 1Q0MA 4K7BA 3HLZA 4XEVA 1CGME 3MBGA 4JEAA 1J8MF 1YAUO 1OCCC 3LUTB 3RKOF 3DZAA 1R5ID 4WGZA 2H8AA 2VCBA 3TJ6A 4XQ1A 5L3VA 1OCRC 2HFIA 2WZGA 1ZHWA 1LI7A 2Q9BA 1IW7F 2Q00A 5JS5A 3GEIA 2OJED 3QW0A 3B0UX 1VTMP 1M2VB 4FAPB 2HSBA 3KL4A 4Z9JA 5L0CA 2CW0F 4XLPF 2H7OA 4KC9A 2V26A 3E9VA 2J45A 1TWGA 2C04A 4U5BE 5A6KA 3B0VC 4PACA 2UUIA 1WGWA 5JRAA 1OW8A 4OD5A 3S29A 4AE4B 3SEOA 2X51A 3EZIA 3LEOA 3L8IA 4CDVA 3AGUA 2YVKA 4N06A 1YA9A 2J7PA 3C18A 1OCZC 1R4TA 2FGYA 3S84A 4RD9A 1DOVA 2X0CA 1CPQA 4J30B 1MNDA 2P7VA 5JSLA 4CS7A 2IXOA 1D0ZA 2P1AA 5B3IA 2Y3BA 3OEOA 1A7DA 4WJ0A 1I4ZA 3LAYA 1Z23A 3MX3A 5KYUA 3SXKA 4CS8A 3L34A 4NTAA 2R25A 1NSGB 4PJJA 4OINF 4AX2A 4JTAB 5CIVA 2L6FA 2GAQA 4C3BA 1G5ZA 1U0BB 2Y3HA 3DJUB 3LJBA 1QZXA 1Q0DA 1S7ZA 2ZXWC 2P6VA 3K66A 3BRJA 2YWAA 3O6XA 1ST6A 3HNIA 3GEHA 3QVZA 2XLVA 2NSFA 1OXKA 4P9FA 2XLOA 2PNOA 3IQCA 4O6NA 5JP7A 2HJMA 1Y4CA 2YLGA 4GYTA 4YT8A 3B0PA 4ONSA 2KC3A 3U0CA 2LFDA 4Q4ZF 3K6BA 5A6AA 4O7GA 2EPMX 1OQCA 5DQTA 4B6IA 3C8GA 4MVRA 1BZ4A 1N1CA 3ZDLA 2HMZA 2XSEA 1PCXA 4IRUA 4PJLA 4ULWA 1RKCA 2MHRA 3W4YA 1VYKA 1G4US 1UFBA 3NKDA 1FMVA 1V55C 3I5QA 3U3FA 2O9XA 5CI9A 3QZCA 4NCQA 1T5OA 3W2VA 3DM5A 3SZRA 4PK4A 3M1CB 2NUPB 2KSFA 2YL7A 2Z15A 4YT4A 2J0WA 1Y6DA 1OKKD 2EIMC 2KQ9A 5DLJA 1M2OA 3MYIA 3V7OA 4BEJA 1RJ9B 1QSPA 3KKBA 3EQLF 2Q4FA 4YL1A 3RVZA 1L7CA 256BA 1FFHA 4Z9HA 3JT1A 1LI5A 2QNLA 4H54A 4F4BA 1ZVZA 3U8PA 3DAFA 1E2XA 3X2QC 4EHPA 4JIOA 4N6CA 4NTFA 1K05A 1H6GA 1AEPA 2I8BA 1LIHA 2RSEB 3GM1A 4JJFA 4YL3A 4C3DA 5HSWA 1WN0A 3F46A 1WATA 1LS4A 1YYJA 3LS0A 1U6HA 4FX5A 2L9JA 3U2MA 5KYYA 2CGEA 2R7TA 4G7ZF 2ICWG 4RBNA 3JSEO 4CDYA 3MFNA 3PDMP 2LFFA 3S0XA 3QMKA 1O3UA 2XRHA 2J46A 1F1MA 2VB6A 4JTCB 1ORSC 1UG7A 1QVXA 2ZXOA 3TD7A 2KYHA 4YL0A 2KJGA 3U9MA 5L0HA 3AG2C 2ETSA 5D92A 2IOQA 5T3WA 3KYIA 1KNYA 1NBBA 2PBEA 3R7CA 5KYWB 4PJNA 3VAYA 1Z7Qc 3NYLA 5IY5C 1MMGA 2KGOA 3G4XA 3EFOB 3K7DA 4KNWA 2A0BA 3SXZA 1JPNA 2NUTB 2YL0A 4YK5A 3ZIBA 1KU2A 3ASOC 3K33A 3NRHA 4JVSA 5L0JA 1MNEA 4IWBA 3UNGC 2R05A 1ZW2A 4CSAC 4MTGA 3PHF2 4P6IC 2A6HF 4CS9A 2J7PD 2YEVA 4D4NA 4CIPA 1C02A 4U9EA 1E86A 2LP4A 2IXNA 1ZHXA 1H7IA 4E18A 2RD9A 3POVA 1WWPA 3F47A 3I4UA 2R7WA 3EGXB 3GODA 1CGOA 1ORYA 2NG1A 3DI5A 4LLCA 4MVZA 3U9JA 3RIPA 1V74B 2PX0A 4JE9A 5E2QA 1FR0A 3EPVA 5E33A 3NMKA 3TQOA 2LD6A 5JT4A 2E87A 5DVWA 3ASNC 3ZG1A 2HS5A 3GM2A 3K1IA 4YJWA 4EKWA 1PD0A 2Q9AA 2C03A 2WVNA 2YKZA 3IEEA 4AL1A 1RMVA 3I5PA 2XL8A 2J9WA 5EHHA 1WOLA 2YRFA 2Q7RA 3VRCA 3Q7GA 4LDRA 5EK0A 2DB4A 3LS1A 4XTKA 3T4RA 3SNHA 2R7QA 2W4BA 1BR2A 2QTVA 4UDVA 4KNVA 1H9GA 1W2WA 1NFOA 1OR2A 3B71A 4AK9A 2V3CC 3NKEA 1C03A 5K0IA 2IXPA 2A1DD
chains in the Genus database with same CATH topology
2LFDA 2LFFA 2HZ8A 3U8VA 1Y4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFD A;  2LFF A;  2HZ8 A;  3U8V A;  1Y4C A; 
#chains in the Genus database with same CATH topology
 1I5N A;  4HFF B;  3RW0 A;  2XLE A;  1J8Y F;  4OD4 A;  5L0G A;  2HZ8 A;  1RXQ A;  3UGO A;  3ZTM A;  5BQH A;  5COM A;  1Z63 A;  2JX0 A;  3RYL A;  1PD1 A;  3AQB A;  4U5G A;  3ZTZ A;  1IZM A;  3W2W A;  4U5D E;  2DGJ A;  5E3A A;  3GWL A;  2VAS A;  4PR9 A;  4RDA A;  2Y3D A;  4MTO A;  1CGN A;  2J9V A;  4DBR A;  1M6T A;  2XLD A;  1O87 A;  2BC5 A;  4MVS A;  4NY3 A;  2OOC A;  1OW7 A;  2GDC A;  3GAN A;  2H7B A;  4OIQ F;  1OW6 A;  2IXM A;  3ZWI A;  1TWH A;  2HV7 A;  1AVO B;  4HFK B;  4NQF A;  1HW1 A;  2LK4 A;  4IAQ A;  3GWN A;  3GM3 A;  4YN0 B;  4PFO A;  2LCH A;  3EHM A;  3J06 A;  2IM8 A;  1O5H A;  1M2V A;  2LSE A;  4R32 A;  1HMD A;  3LNR A;  4I3M A;  2GFH A;  3AG3 C;  2YLD A;  3JRM O;  4IGG A;  3US6 A;  4Q5S F;  1Q0G A;  2EPK X;  2NPU A;  3RFY A;  5DQZ A;  3DD7 A;  2IYL D;  4E7Z A;  2M64 A;  4AE4 A;  3RQG A;  1XZP A;  3VM6 A;  4XLN F;  1S05 A;  4I1M A;  4D4X A;  4YWQ A;  4CSA A;  1LE4 A;  1YLM A;  4IAR A;  4JW1 A;  3ZC4 A;  3S90 A;  1HMO A;  1GM5 A;  3FAJ A;  3IQ6 A;  3S9O A;  1SR2 A;  3LLK A;  5DS4 A;  2EIJ C;  3L1M A;  1NU7 D;  1A0B A;  1ZHT A;  4LDK A;  4E0I A;  5L0D A;  3FXH A;  3V5X A;  1LE2 A;  3O39 A;  2BE5 F;  4JRZ A;  2I15 A;  3AJM A;  1K04 A;  1GQA A;  1LVK A;  4EIY A;  5F5H A;  3AQC A;  3TK0 A;  2D5R B;  2XS8 A;  1NLX A;  2YHS A;  4ULV A;  5AC4 A;  1VLS A;  3AG4 C;  4DRJ B;  4JTD B;  2OQM A;  2HKV A;  2J9B A;  3K1H A;  2HMQ A;  3QVY A;  1VLT A;  4IJJ A;  4MVO A;  4BJ5 C;  4QDL A;  3DE8 A;  4CBE A;  4JCH A;  2R7R A;  4U5H A;  5B1A C;  3JYH A;  5AC5 A;  3RH3 A;  1D1B A;  2OJQ A;  3FOO A;  2R02 A;  4BEM J;  1TWC A;  5A6B A;  3NG1 A;  1G8X A;  1FAP B;  2XLM A;  3EG9 B;  4JUR I;  1BR4 A;  3FAP B;  4C3E A;  5GPG B;  5KYN A;  3DAG A;  1HW2 A;  4CDA A;  4J7Y A;  1WTY A;  3G4Z A;  3TUL A;  4G0H A;  3JCU Q;  2FFH A;  3O55 A;  2QY9 A;  2Y39 A;  1M57 C;  1QLE C;  3AOU A;  2DYR C;  2OEV A;  3AG1 C;  2Y3G A;  1YZC A;  3RF3 A;  1BDJ B;  3B29 A;  3U3B A;  3LES A;  1D1C A;  4X0R A;  3L0I A;  2WVO A;  3IHU A;  2BL2 A;  2WZF A;  4C7O B;  2L6G A;  3MLG A;  5A69 A;  1RKE B;  1TR2 A;  4N4W A;  5F5F A;  2XXA B;  3S28 A;  1SYQ A;  4EBB A;  1GS9 A;  1APC A;  4HE8 D;  3ECS A;  4IB4 A;  3DM9 B;  3HKK A;  4DVZ A;  1OR3 A;  2VCA A;  1OXB A;  2ASR A;  4NC3 A;  5JLI A;  1E83 A;  2XM4 A;  3G50 A;  2NUP A;  2Q3T A;  1NZE A;  2IBF A;  4WAB A;  2AP3 A;  2W9Y A;  3M79 A;  3WHN A;  2MYS A;  2VCC A;  2WB7 A;  4U5E E;  5COG A;  3UMH A;  2AWY A;  3IQ5 A;  2KW3 C;  1ZYR F;  4LDQ A;  1RJ9 A;  4ZLC A;  3GEE A;  4E0H A;  4DOZ A;  2PP4 A;  2B0H A;  4MW8 A;  4CS8 C;  2EPO A;  2M4E A;  1TWA A;  3JYY A;  1RCP A;  2OG2 A;  3U5S A;  1YYX A;  2EIL C;  2GA0 A;  2A68 F;  3CAX A;  4MVU A;  1GGQ A;  1ZHZ A;  2KK1 A;  4ZLD A;  1NU9 C;  3OWT A;  3EJN A;  4O6M A;  4ER9 A;  2R7U A;  1MMN A;  2DYS C;  4LAC B;  2WZL A;  5L3Q A;  4CJG A;  1OKK A;  3OA1 A;  5L0F A;  5HV9 A;  4C7O A;  3B9Q A;  3WAQ A;  1KTM A;  5BQG A;  2EIN C;  3QW1 A;  1RKE A;  4GQH A;  1VYI A;  3C62 A;  4WGY A;  1G4W R;  3EH2 A;  2A0U A;  4L6R A;  5T3T A;  1JOG A;  1MQV A;  2MWQ A;  4OIO F;  1SF8 A;  3KMI A;  2R7O A;  2XL4 A;  2ZXP A;  4BJ5 A;  2XS1 A;  3T9O A;  1JMW A;  2AWC A;  2P0N A;  1TKN A;  4W8K A;  4EUK B;  2L6H A;  3KH2 A;  4JZA A;  3UMI A;  4BG0 A;  3JRT A;  4DJ9 A;  1HY5 A;  5KYW A;  4FWV A;  3U8V A;  2CDQ A;  2CYD A;  1YVI A;  3KPH A;  4P9T A;  4W8P A;  4E17 A;  3EFO A;  2QE9 A;  4YT2 A;  1CPR A;  2R7S A;  2QLA A;  4KBL A;  3L8J A;  5KYX B;  3SXM A;  4EBJ A;  4DBQ A;  5KYU B;  1D1A A;  1QKR A;  3ABK C;  3N2Z B;  3C63 A;  3NDB B;  3HNL A;  3LEV A;  3NMJ A;  2ZD9 A;  4M63 A;  1H9T A;  3HNK A;  4Q7C A;  5F28 E;  3GOR A;  3C8G D;  3Q7L A;  3E70 C;  1E85 A;  1T9K A;  1TFO B;  1FMW A;  2P61 A;  1Q0K A;  2HSQ A;  3EGX A;  3EZH A;  3RVY A;  4E7S A;  3EHN A;  2EPN A;  3A11 A;  3V5Z A;  4U5F E;  2D4U A;  4A2N B;  3HNJ A;  1VMA A;  2CCY A;  1VK5 A;  2CNW A;  5D91 A;  2ZXR A;  4H4K C;  2EIK C;  2R7X A;  4MVM A;  1JRA A;  3NYJ A;  2VH3 A;  3O10 A;  3JTL O;  4XPX A;  3ZVR A;  1T6I A;  2OU6 A;  2KNH A;  2PF4 E;  4EBK A;  5DS5 A;  2W4M A;  3M4C A;  3M15 A;  3NYM A;  4O6Y A;  4QI0 A;  3C8G B;  3DE9 A;  4BJ6 C;  3C7J A;  1L3P A;  5A6B D;  1HE9 A;  5JVE A;  1EQ1 A;  2J8W A;  1XZQ A;  3NMI A;  2WL8 A;  4JKV A;  3SXY A;  1JR8 A;  1A7V A;  1YJG A;  2AVK A;  2F22 A;  4AL0 A;  2YL1 A;  3DJN B;  2J0X A;  3QTH A;  3ITF A;  4U5C E;  3T6B A;  1K40 A;  2YQY A;  4KI2 A;  3Q6M A;  1VB5 A;  3FHD A;  4BJT A;  5KYX A;  2ZPA A;  2OKU A;  5B1B C;  1U89 A;  4XEK A;  1AUE A;  1C17 M;  2R03 A;  3JZ0 A;  2B0J A;  4MND A;  3ZSU A;  1FNT c;  2Q9C A;  2YZS A;  2XLW A;  1NG1 A;  5FCL A;  2R9R B;  3WOD F;  1LS1 A;  2XL6 A;  1FFT C;  2J9U A;  3CEX A;  3IQT A;  1HE1 A;  4BPM A;  5FZT A;  1A41 A;  1V54 C;  4PJM A;  3V5Y A;  5E3C A;  1A7E A;  1I4Y A;  2YL3 A;  3DMD A;  5A6J A;  3Q6N A;  5AGF A;  4J32 B;  3H65 A;  3CZ6 A;  4BJ1 A;  1SZI A;  4DRH B;  1PV3 A;  1V4A A;  4CS9 C;  3R2P A;  4Z9I A;  3ABM C;  2Y69 C;  3IPM O;  3T6J A;  5KYY B;  4DXW A;  4I44 A;  1Q0F A;  2H7V C;  2FAP B;  3RQE A;  4XPW A;  1ZHY A;  2W45 A;  1EKY A;  2LIG A;  1EI7 A;  3DWW A;  4YT5 A;  2GWW A;  2NUT A;  1T6Q A;  4QI2 A;  4K1O A;  2EPL X;  4OIP F;  4G78 A;  4A4A A;  1EA8 A;  2OEX A;  3EH1 A;  1JAF A;  2L7A A;  1DOW A;  3K1I C;  4LLE A;  3SYN A;  1LM3 B;  5B3S C;  2YLI A;  4FES A;  1BBH A;  1B68 A;  2PX3 A;  3DXJ F;  2HJ3 A;  1JPJ A;  1YAR O;  3ATP A;  3LLI A;  4JEB A;  4XWJ A;  3W8I A;  1M56 C;  2G3V A;  2XLH A;  3WG7 C;  3SP1 A;  2R7V A;  2QUP A;  5T1D B;  3FOP A;  4MS2 A;  1XWJ A;  3EGD B;  1TQG A;  4HEA J;  4XPY A;  5BQI A;  2WVQ A;  3LNM B;  4U9D A;  3UGP A;  3TOM A;  1Z5Z A;  4DVY P;  1YA7 O;  1OCO C;  3FMS A;  1T01 A;  3KYJ A;  4CX9 A;  3JSZ A;  3BEH A;  1YDI A;  2AU5 A;  3MYF A;  5L0I A;  4JCZ A;  1QPU A;  3X1O A;  5COF A;  2HV6 A;  1FTS A;  1YZA A;  4K0D A;  3FVY A;  4O79 A;  1WAS A;  3FDQ A;  4MVQ A;  2L81 A;  1NFN A;  4G7O F;  3ZQV A;  4LER A;  1ZU5 A;  2OCC C;  3UMK A;  3VF0 A;  4BJ6 A;  3EG9 A;  2A6E F;  4N6H A;  1LKX A;  3DKA A;  4I1O B;  3S27 A;  5EGY A;  3W8H A;  3ABL C;  1MMA A;  4GEH A;  3ZQY A;  3N0T A;  3RQF A;  3PCV A;  1BR1 A;  1ZU4 A;  3M4B A;  5TJ5 E;  3UR3 C;  1Z6A A;  3HTK C;  2G62 A;  1D0X A;  2XM0 A;  3H2V A;  5CI8 A;  3T6G B;  1SMY F;  5BUO A;  2LQG A;  4EWC A;  3TJ5 A;  4MQ9 F;  2VC9 A;  1MMD A;  5DS6 A;  1LPE A;  4MW3 A;  4MTF A;  2NSG A;  2JPU A;  4CIH A;  3EGD A;  4JJG A;  2G3K A;  2XXA A;  2UUH A;  3C8Z A;  3N24 A;  3U2L A;  2A69 F;  3CQZ A;  5JUA A;  2CNW D;  1ZW3 A;  3AGT A;  4DRI B;  1Z3I X;  1D0Y A;  1ZZP A;  3PMR A;  1ORJ A;  4JC7 A;  4NTB A;  1VOM A;  3TOL A;  4CJO A;  4G7H F;  4XEF A;  2DI3 A;  1TFK B;  3A9C A;  1E84 A;  4OIR F;  4ANJ A;  2PFD A;  3CSK A;  4IAO A;  3VYW A;  4PFP A;  1T6U A;  2TMV P;  3HJC A;  1QQ3 A;  2HUJ A;  2JD3 A;  4J7T A;  3H2U A;  1Q0M A;  4K7B A;  3HLZ A;  4XEV A;  1CGM E;  3MBG A;  4JEA A;  1J8M F;  1YAU O;  1OCC C;  3LUT B;  3RKO F;  3DZA A;  1R5I D;  4WGZ A;  2H8A A;  2VCB A;  3TJ6 A;  4XQ1 A;  5L3V A;  1OCR C;  2HFI A;  2WZG A;  1ZHW A;  1LI7 A;  2Q9B A;  1IW7 F;  2Q00 A;  5JS5 A;  3GEI A;  2OJE D;  3QW0 A;  3B0U X;  1VTM P;  1M2V B;  4FAP B;  2HSB A;  3KL4 A;  4Z9J A;  5L0C A;  2CW0 F;  4XLP F;  2H7O A;  4KC9 A;  2V26 A;  3E9V A;  2J45 A;  1TWG A;  2C04 A;  4U5B E;  5A6K A;  3B0V C;  4PAC A;  2UUI A;  1WGW A;  5JRA A;  1OW8 A;  4OD5 A;  3S29 A;  4AE4 B;  3SEO A;  2X51 A;  3EZI A;  3LEO A;  3L8I A;  4CDV A;  3AGU A;  2YVK A;  4N06 A;  1YA9 A;  2J7P A;  3C18 A;  1OCZ C;  1R4T A;  2FGY A;  3S84 A;  4RD9 A;  1DOV A;  2X0C A;  1CPQ A;  4J30 B;  1MND A;  2P7V A;  5JSL A;  4CS7 A;  2IXO A;  1D0Z A;  2P1A A;  5B3I A;  2Y3B A;  3OEO A;  1A7D A;  4WJ0 A;  1I4Z A;  3LAY A;  1Z23 A;  3MX3 A;  5KYU A;  3SXK A;  4CS8 A;  3L34 A;  4NTA A;  2R25 A;  1NSG B;  4PJJ A;  4OIN F;  4AX2 A;  4JTA B;  5CIV A;  2L6F A;  2GAQ A;  4C3B A;  1G5Z A;  1U0B B;  2Y3H A;  3DJU B;  3LJB A;  1QZX A;  1Q0D A;  1S7Z A;  2ZXW C;  2P6V A;  3K66 A;  3BRJ A;  2YWA A;  3O6X A;  1ST6 A;  3HNI A;  3GEH A;  3QVZ A;  2XLV A;  2NSF A;  1OXK A;  4P9F A;  2XLO A;  2PNO A;  3IQC A;  4O6N A;  5JP7 A;  2HJM A;  1Y4C A;  2YLG A;  4GYT A;  4YT8 A;  3B0P A;  4ONS A;  2KC3 A;  3U0C A;  2LFD A;  4Q4Z F;  3K6B A;  5A6A A;  4O7G A;  2EPM X;  1OQC A;  5DQT A;  4B6I A;  3C8G A;  4MVR A;  1BZ4 A;  1N1C A;  3ZDL A;  2HMZ A;  2XSE A;  1PCX A;  4IRU A;  4PJL A;  4ULW A;  1RKC A;  2MHR A;  3W4Y A;  1VYK A;  1G4U S;  1UFB A;  3NKD A;  1FMV A;  1V55 C;  3I5Q A;  3U3F A;  2O9X A;  5CI9 A;  3QZC A;  4NCQ A;  1T5O A;  3W2V A;  3DM5 A;  3SZR A;  4PK4 A;  3M1C B;  2NUP B;  2KSF A;  2YL7 A;  2Z15 A;  4YT4 A;  2J0W A;  1Y6D A;  1OKK D;  2EIM C;  2KQ9 A;  5DLJ A;  1M2O A;  3MYI A;  3V7O A;  4BEJ A;  1RJ9 B;  1QSP A;  3KKB A;  3EQL F;  2Q4F A;  4YL1 A;  3RVZ A;  1L7C A;  256B A;  1FFH A;  4Z9H A;  3JT1 A;  1LI5 A;  2QNL A;  4H54 A;  4F4B A;  1ZVZ A;  3U8P A;  3DAF A;  1E2X A;  3X2Q C;  4EHP A;  4JIO A;  4N6C A;  4NTF A;  1K05 A;  1H6G A;  1AEP A;  2I8B A;  1LIH A;  2RSE B;  3GM1 A;  4JJF A;  4YL3 A;  4C3D A;  5HSW A;  1WN0 A;  3F46 A;  1WAT A;  1LS4 A;  1YYJ A;  3LS0 A;  1U6H A;  4FX5 A;  2L9J A;  3U2M A;  5KYY A;  2CGE A;  2R7T A;  4G7Z F;  2ICW G;  4RBN A;  3JSE O;  4CDY A;  3MFN A;  3PDM P;  2LFF A;  3S0X A;  3QMK A;  1O3U A;  2XRH A;  2J46 A;  1F1M A;  2VB6 A;  4JTC B;  1ORS C;  1UG7 A;  1QVX A;  2ZXO A;  3TD7 A;  2KYH A;  4YL0 A;  2KJG A;  3U9M A;  5L0H A;  3AG2 C;  2ETS A;  5D92 A;  2IOQ A;  5T3W A;  3KYI A;  1KNY A;  1NBB A;  2PBE A;  3R7C A;  5KYW B;  4PJN A;  3VAY A;  1Z7Q c;  3NYL A;  5IY5 C;  1MMG A;  2KGO A;  3G4X A;  3EFO B;  3K7D A;  4KNW A;  2A0B A;  3SXZ A;  1JPN A;  2NUT B;  2YL0 A;  4YK5 A;  3ZIB A;  1KU2 A;  3ASO C;  3K33 A;  3NRH A;  4JVS A;  5L0J A;  1MNE A;  4IWB A;  3UNG C;  2R05 A;  1ZW2 A;  4CSA C;  4MTG A;  3PHF 2;  4P6I C;  2A6H F;  4CS9 A;  2J7P D;  2YEV A;  4D4N A;  4CIP A;  1C02 A;  4U9E A;  1E86 A;  2LP4 A;  2IXN A;  1ZHX A;  1H7I A;  4E18 A;  2RD9 A;  3POV A;  1WWP A;  3F47 A;  3I4U A;  2R7W A;  3EGX B;  3GOD A;  1CGO A;  1ORY A;  2NG1 A;  3DI5 A;  4LLC A;  4MVZ A;  3U9J A;  3RIP A;  1V74 B;  2PX0 A;  4JE9 A;  5E2Q A;  1FR0 A;  3EPV A;  5E33 A;  3NMK A;  3TQO A;  2LD6 A;  5JT4 A;  2E87 A;  5DVW A;  3ASN C;  3ZG1 A;  2HS5 A;  3GM2 A;  3K1I A;  4YJW A;  4EKW A;  1PD0 A;  2Q9A A;  2C03 A;  2WVN A;  2YKZ A;  3IEE A;  4AL1 A;  1RMV A;  3I5P A;  2XL8 A;  2J9W A;  5EHH A;  1WOL A;  2YRF A;  2Q7R A;  3VRC A;  3Q7G A;  4LDR A;  5EK0 A;  2DB4 A;  3LS1 A;  4XTK A;  3T4R A;  3SNH A;  2R7Q A;  2W4B A;  1BR2 A;  2QTV A;  4UDV A;  4KNV A;  1H9G A;  1W2W A;  1NFO A;  1OR2 A;  3B71 A;  4AK9 A;  2V3C C;  3NKE A;  1C03 A;  5K0I A;  2IXP A;  2A1D D; 
#chains in the Genus database with same CATH homology
 2LFD A;  2LFF A;  2HZ8 A;  3U8V A;  1Y4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...