2LFDA

Solution nmr structure of diiron protein in presence of 2 eq zn2+, northeast structural genomics consortium target or21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
115
structure length
115
Chain Sequence
MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQHLQDEQRHVEEIEKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diiron protein
publication title Solution NMR structure of Diiron protein in presence of 2 eq Zn2+
rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 54
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2lfdA00
2LFFA 2HZ8A 1Y4CA 2LFDA 3U8VA
chains in the Genus database with same CATH superfamily
4EIYA 4CIPA 1TR2A 5KYYB 5D92A 3EH2A 4MVSA 3RVZA 3SZRA 3B0PA 1Q0FA 3S90A 3JT1A 3JYHA 1VMAA 3M4BA 3PHF2 4JEBA 1NU7D 3NMJA 4BJ5A 2H7OA 1D0XA 4O7GA 2YVKA 3EGXB 4E0IA 4XLPF 2R03A 3K1IC 3QZCA 1OXKA 3ZTMA 4CJOA 4YL0A 1RKEA 4J7TA 3TJ5A 1VLSA 2MWQA 3JZ0A 2XL8A 3CZ6A 4JC7A 4L6RA 4NTBA 3NRHA 4A4AA 3JRTA 4C7OB 3CQZA 3HTKC 3Q7LA 4C3DA 1C03A 5KYUB 2FGYA 4CS9A 2LCHA 3W8HA 2EILC 3DAGA 2Q7RA 4A2NB 1JPNA 4EHPA 1AVOB 1M2VB 4GQHA 4MW8A 3VAYA 3DXJF 2R7VA 3HKKA 2IXPA 3L8JA 2EIMC 3C8GA 3DKAA 2R7OA 2DGJA 1LS1A 3C8GD 4PK4A 2NSGA 2PF4E 3U3BA 5DLJA 1K04A 4P9TA 3O10A 5HSWA 2ASRA 4U5BE 1LI5A 2Y69C 3JYYA 4Z9HA 2JD3A 3O39A 2DB4A 5JLIA 1T6IA 4OD4A 2XS1A 4EBKA 4CS8A 1NFOA 3N0TA 4HE8D 2ZXRA 5HV9A 4AL0A 4RDAA 1YDIA 4E17A 5E3AA 5A6KA 2W4MA 2WVQA 4MW3A 2WVNA 4K1OA 3NMIA 4XTKA 4JTAB 1WATA 1VK5A 3RKOF 1QLEC 1HMOA 2L81A 4O6NA 3ABKC 3EZIA 1YYJA 3B71A 3RQFA 1L3PA 4JCZA 2Q9CA 5KYWB 3I4UA 1HE9A 3ZTZA 5T3WA 1QSPA 2VCAA 4C3EA 1J8MF 4MS2A 1YYXA 1PD1A 4WGYA 3ZVRA 3K7DA 3GM3A 2IYLD 2HV7A 1O5HA 2YRFA 1HE1A 3ZG1A 2J46A 3ABLC 4BJ5C 1ORYA 1QPUA 4PJNA 2NUTB 4U5HA 4G78A 4OIRF 2NUPA 2BE5F 4EWCA 1NFNA 3EG9B 2C04A 3CSKA 2ZXPA 3FMSA 4BJTA 2J9WA 5TJ5E 1N1CA 4NTAA 5JSLA 1FFTC 1OQCA 2OOCA 4ZLDA 2GA0A 2KW3C 3N2ZB 3SP1A 3RH3A 5KYXB 3B0VC 1L7CA 2GWWA 3CEXA 2Q4FA 3HNKA 2KNHA 2CW0F 2HMQA 5FCLA 3JCUQ 1FR0A 3GEIA 3IQCA 3OWTA 4RBNA 3HJCA 4IARA 4NTFA 4KNVA 1O87A 4YL1A 4U9DA 3G50A 2WZFA 3U2MA 4N6CA 2Y3DA 1Y6DA 2Y3GA 1YVIA 5L3QA 3S27A 4JCHA 1APCA 4MVRA 3S29A 1R5ID 3GWLA 1S7ZA 1PV3A 4KNWA 1FAPB 4K0DA 4MVZA 3B0UX 2CNWA 4QDLA 4BJ6C 4PJJA 3W8IA 3W2VA 2E87A 3LAYA 2EIJC 2ZPAA 4NCQA 4MVOA 4CDYA 1VTMP 1RKEB 2LSEA 4I44A 1SYQA 4ULWA 1TWCA 3EFOA 2CCYA 3ZC4A 2YL0A 1WOLA 2YHSA 3KPHA 4NY3A 4D4XA 4IWBA 4DOZA 1PCXA 2J9BA 3O55A 1E86A 3V7OA 5A69A 3ITFA 1UFBA 1MMGA 1Z7Qc 4Q5SF 1MNDA 4X0RA 2Y3BA 5FZTA 3S28A 1LKXA 3Q7GA 4YT5A 2AVKA 1XZPA 2IBFA 4N6HA 2ZXWC 1EKYA 2YLIA 3A9CA 1WN0A 1Q0KA 2EIKC 4IAOA 3AG3C 3ECSA 1ZYRF 3NYLA 5JUAA 3GEEA 3QMKA 3G4XA 3KL4A 4YN0B 1Q0DA 2J45A 3K6BA 1JOGA 4FAPB 1M57C 4RD9A 5AC4A 1HMDA 3NYMA 5B3IA 3W4YA 4W8PA 4DBQA 2PP4A 3RW0A 2A1DD 1CPRA 5BQGA 2XL4A 2B0HA 3DJUB 3FOOA 2YZSA 4DXWA 3FXHA 2VCCA 2BC5A 2XLMA 4JRZA 2QE9A 2FFHA 4J7YA 4N4WA 2OEXA 1SZIA 4JTCB 5AC5A 3T9OA 4CSAA 4PR9A 3AQBA 1F1MA 1NU9C 2XLHA 3OA1A 2HJ3A 1Z3IX 2L7AA 3IQTA 4ONSA 2FAPB 3GODA 1YA7O 1WGWA 1PD0A 3KYJA 1IZMA 4ZLCA 1A0BA 1QQ3A 4W8KA 1JRAA 1ZHWA 3LEOA 5K0IA 3KYIA 5A6AA 2BL2A 1WWPA 2R25A 3HNJA 1ZU5A 4QI0A 3IPMO 4JZAA 1E84A 3ZSUA 3JSEO 4I1MA 3ZWIA 1G4US 3F46A 1JMWA 2ETSA 4YT2A 2Q9BA 4JKVA 3EHNA 3V5YA 4E7SA 1TQGA 2PNOA 5B3SC 1LE4A 3VM6A 2HS5A 4H54A 2NUPB 4XEFA 4XPWA 4G0HA 4C3BA 3IQ6A 4ANJA 2R7RA 3KMIA 2CGEA 4BG0A 4MVQA 1OCCC 1T9KA 3MBGA 3LNRA 3FOPA 4ER9A 1GM5A 5E33A 4HEAJ 256BA 2XL6A 3RF3A 4I1OB 2AWCA 4G7OF 1E2XA 1M56C 2OCCC 2YL7A 3DAFA 3DE8A 2EPNA 2OKUA 3CAXA 5L0JA 3NKDA 1I4YA 4P6IC 3MYFA 1K05A 4IRUA 2LIGA 3KKBA 2OEVA 4FX5A 4DJ9A 4F4BA 2NG1A 5JRAA 1D1CA 2HUJA 3E9VA 2D5RB 2ZD9A 1TFKB 1UG7A 2A69F 2YLGA 2M4EA 2W9YA 4U5DE 5BUOA 5EGYA 2R02A 1K40A 3FHDA 3EZHA 3LS1A 1ORJA 2MYSA 1OW8A 2KGOA 2YEVA 1BR1A 1D0ZA 1OCOC 1YLMA 2XRHA 3MX3A 4MNDA 3L8IA 3RFYA 5JS5A 5L3VA 4JJGA 4E7ZA 4MTFA 3BRJA 1U6HA 2L6HA 1Y4CA 2KJGA 1C17M 2LFDA 3ZDLA 1SF8A 1YZAA 1M2OA 1NBBA 3O6XA 3EFOB 3MFNA 4JVSA 5KYYA 3ZQVA 4ULVA 2Y3HA 3PMRA 1JR8A 4AX2A 2XLWA 4DRIB 2LD6A 4LDQA 4JW1A 1U89A 3PDMP 2P0NA 3TQOA 3UGPA 2PFDA 3LLIA 2XLEA 1B68A 4YT4A 4EBJA 1SR2A 1LPEA 1TFOB 4CS9C 2R7UA 1JPJA 3HNLA 5DS4A 3K1HA 5L0DA 2LP4A 2KK1A 4OIOF 2ICWG 1V54C 3QTHA 2R9RB 1XWJA 2H7BA 4WJ0A 3WAQA 4EUKB 1ZU4A 3DM5A 3LESA 1A7VA 4N06A 3RVYA 4BEMJ 5JVEA 2C03A 2Q00A 1YZCA 3T4RA 4AL1A 2IXOA 3C7JA 3S9OA 1M2VA 1MMAA 3DD7A 5L0FA 4UDVA 4XPXA 3NDBB 3DE9A 5L0HA 2IOQA 1DOWA 3W2WA 1OCRC 1XZQA 5IY5C 1ZHTA 4GEHA 2HKVA 5CI9A 4CS8C 1VYIA 2F22A 1HW1A 1A7DA 2RD9A 5CIVA 4U5GA 1YA9A 4CDAA 4LERA 1YJGA 1ZVZA 2CDQA 3AG2C 4XEVA 3B29A 2YWAA 1HY5A 2WZGA 4H4KC 1BR4A 3AG1C 2A0BA 3H2VA 1EI7A 2M64A 3H2UA 3UMIA 4E18A 4XWJA 2WVOA 2YKZA 1I5NA 3DM9B 4FWVA 3IEEA 3LUTB 4AE4A 1G4WR 2A6EF 2EPLX 2ZXOA 3AG4C 3I5PA 2UUHA 2XXAA 4FESA 3Q6MA 4PFPA 1TWHA 4WGZA 2R7SA 1LI7A 3AOUA 3L0IA 3OEOA 3TULA 4PACA 5B1BC 3U3FA 3NYJA 3T6BA 5D91A 2PX0A 4U5CE 1VOMA 1I4ZA 1KTMA 3G4ZA 3C8GB 3WG7C 1LS4A 4LDKA 1BBHA 1H9GA 4JURI 5B1AC 4BJ1A 3TK0A 1MMNA 1LM3B 2OJED 2JX0A 2A6HF 3L1MA 3M1CB 3HLZA 1BR2A 3U8PA 4CX9A 5JP7A 1D1AA 4I3MA 3MYIA 2NUTA 3QW0A 5E2QA 1T6UA 2HFIA 2J9VA 2XM0A 4IB4A 3EG9A 1DOVA 5CI8A 1IW7F 1D0YA 3DJNB 4LLEA 4CBEA 4YT8A 4P9FA 3EGDA 3IQ5A 3IHUA 4O79A 3SYNA 3SXZA 5COFA 4CS7A 3U5SA 4YWQA 3RQGA 2EPOA 5KYXA 1C02A 2XLDA 2XS8A 4J30B 4JTDB 1OR3A 2YL3A 2V3CC 1OCZC 1Q0MA 1QVXA 2G3KA 3SXYA 3ATPA 1FMWA 2LK4A 2WL8A 4PJLA 3POVA 4PJMA 2AU5A 3C8ZA 3EHMA 5L0IA 3JSZA 2A68F 2IM8A 5F5FA 4U9EA 3NG1A 2OQMA 3N24A 1OXBA 2IXNA 2IXMA 2Y39A 3T6JA 2W4BA 3LJBA 5COGA 1AUEA 1CGME 1TKNA 3Q6NA 3ASNC 2HZ8A 1NLXA 2JPUA 4HFFB 2HJMA 1V55C 1A7EA 2H7VC 3DI5A 3E70C 1YAUO 1ZHXA 2EINC 4M63A 4IGGA 3EPVA 2OG2A 3LLKA 3U9JA 1RJ9A 1ZW2A 1CPQA 3UR3C 2XLVA 3K66A 4DVYP 3UGOA 2GDCA 4U5EE 2TMVP 2LQGA 3BEHA 2OU6A 3SNHA 3UMHA 4EKWA 5A6JA 3U0CA 3ZQYA 4O6YA 2QTVA 3A11A 1WASA 3M4CA 4LDRA 1R4TA 1V74B 3EH1A 1E85A 3GWNA 4O6MA 2UUIA 3FDQA 4KI2A 1JAFA 1M6TA 2QLAA 2HSQA 2L6FA 2PBEA 1VLTA 3QVYA 3V5ZA 4KBLA 2P7VA 5A6BA 3GM2A 3T6GB 1CGOA 1VB5A 5BQIA 5A6BD 3DWWA 1A41A 2O9XA 2P6VA 2J8WA 5GPGB 2W45A 5COMA 2GAQA 1FNTc 3K33A 1NSGB 1Z63A 2DYSC 2EPKX 4MTOA 1WTYA 1GS9A 2I15A 1Z23A 2I8BA 2J9UA 2L6GA 4OIPF 3QVZA 4IJJA 4Z9JA 2CYDA 2VH3A 4CDVA 2KQ9A 2G62A 2LFFA 3X2QC 4J32B 3RIPA 4MTGA 2YLDA 1V4AA 4CSAC 3SEOA 3ABMC 3NMKA 4CJGA 3R7CA 4AE4B 1O3UA 4MQ9F 2QUPA 3SXKA 5KYNA 2AP3A 4QI2A 1FMVA 2XXAB 4BJ6A 1NZEA 1T6QA 4G7HF 5DQZA 1VYKA 1OW7A 1T5OA 1GQAA 2GFHA 3F47A 1TWAA 1KNYA 4XQ1A 3AJMA 2VCBA 4K7BA 2J7PA 2NPUA 4MVUA 3TOLA 2KYHA 3ZIBA 5L0GA 2DYRC 2EPMX 2J7PD 3EGXA 3RQEA 3GANA 4AK9A 1T01A 1EA8A 3LS0A 1LIHA 5JT4A 3VF0A 2D4UA 3X1OA 3HNIA 1QKRA 5DQTA 1LE2A 1ZW3A 3R2PA 3RYLA 4C7OA 1FTSA 1RKCA 2L9JA 4LACB 5DS6A 2XM4A 3UMKA 2VASA 1Z5ZA 2AWYA 4HFKB 2B0JA 5KYUA 4DVZA 1U0BB 1HW2A 2PX3A 4OD5A 4Q7CA 1W2WA 1Z6AA 4B6IA 3QW1A 4JIOA 2XLOA 5F5HA 3TOMA 2J0XA 2R05A 3FAJA 2KC3A 1ST6A 2QY9A 2VB6A 2QNLA 1AEPA 3ASOC 3EGDB 5T3TA 1NG1A 2YL1A 4CIHA 3L34A 2VC9A 1BDJB 1J8YF 2WZLA 1MNEA 1SMYF 3GM1A 1EQ1A 5F28E 3PCVA 3TD7A 2Z15A 4G7ZF 5T1DB 3J06A 1Q0GA 3DMDA 3M79A 1LVKA 4E0HA 2HSBA 2NSFA 1TWGA 3U2LA 4BEJA 2R7XA 2R7WA 1FFHA 4R32A 3C63A 3LEVA 1D1BA 1RMVA 5EK0A 4JJFA 4DBRA 3S0XA 3WODF 2A0UA 4LLCA 1RCPA 2H8AA 2OJQA 4NC3A 1MQVA 1S05A 3K1IA 4IAQA 1MMDA 3SXMA 2J0WA 4EBBA 2MHRA 2X0CA 2V26A 1OR2A 2WB7A 5KYWA 2HV6A 3B9QA 2XSEA 1RXQA 4WABA 1ZHYA 1G5ZA 3I5QA 2CNWD 2P61A 4GYTA 1RJ9B 3C18A 1ZHZA 2DI3A 4D4NA 3M15A 1H9TA 1ORSC 3EQLF 1OKKA 2P1AA 4NQFA 1YARO 3AQCA 1ZZPA 1OKKD 3U9MA 2R7TA 3JTLO 3JRMO 1CGNA 4YK5A 1GGQA 5DS5A 4JE9A 3H65A 3VRCA 4DRHB 5DVWA 3KH2A 4Z9IA 3VYWA 5EHHA 2X51A 4XLNF 3S84A 3GORA 3AGUA 4XEKA 4XPYA 1KU2A 1H7IA 5BQHA 1G8XA 3C62A 3DZAA 5E3CA 3GEHA 3MLGA 4YL3A 3U8VA 4OIQF 1H6GA 3LNMB 4PFOA 2YQYA 1QZXA 3US6A 4BPMA 2Q9AA 5L0CA 3TJ6A 2R7QA 3AGTA 4DRJB 2KSFA 2G3VA 3FVYA 4JEAA 4Q4ZF 3FAPB 3UNGC 3EJNA 4KC9A 2HMZA 3NKEA 2Q3TA 5AGFA 3WHNA 1OW6A 2RSEB 4MVMA 1E83A 1BZ4A 4OINF 3V5XA 4YJWA 4U5FE
chains in the Genus database with same CATH topology
2LFFA 2HZ8A 1Y4CA 2LFDA 3U8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFF A;  2HZ8 A;  1Y4C A;  2LFD A;  3U8V A; 
#chains in the Genus database with same CATH topology
 4EIY A;  4CIP A;  1TR2 A;  5KYY B;  5D92 A;  3EH2 A;  4MVS A;  3RVZ A;  3SZR A;  3B0P A;  1Q0F A;  3S90 A;  3JT1 A;  3JYH A;  1VMA A;  3M4B A;  3PHF 2;  4JEB A;  1NU7 D;  3NMJ A;  4BJ5 A;  2H7O A;  1D0X A;  4O7G A;  2YVK A;  3EGX B;  4E0I A;  4XLP F;  2R03 A;  3K1I C;  3QZC A;  1OXK A;  3ZTM A;  4CJO A;  4YL0 A;  1RKE A;  4J7T A;  3TJ5 A;  1VLS A;  2MWQ A;  3JZ0 A;  2XL8 A;  3CZ6 A;  4JC7 A;  4L6R A;  4NTB A;  3NRH A;  4A4A A;  3JRT A;  4C7O B;  3CQZ A;  3HTK C;  3Q7L A;  4C3D A;  1C03 A;  5KYU B;  2FGY A;  4CS9 A;  2LCH A;  3W8H A;  2EIL C;  3DAG A;  2Q7R A;  4A2N B;  1JPN A;  4EHP A;  1AVO B;  1M2V B;  4GQH A;  4MW8 A;  3VAY A;  3DXJ F;  2R7V A;  3HKK A;  2IXP A;  3L8J A;  2EIM C;  3C8G A;  3DKA A;  2R7O A;  2DGJ A;  1LS1 A;  3C8G D;  4PK4 A;  2NSG A;  2PF4 E;  3U3B A;  5DLJ A;  1K04 A;  4P9T A;  3O10 A;  5HSW A;  2ASR A;  4U5B E;  1LI5 A;  2Y69 C;  3JYY A;  4Z9H A;  2JD3 A;  3O39 A;  2DB4 A;  5JLI A;  1T6I A;  4OD4 A;  2XS1 A;  4EBK A;  4CS8 A;  1NFO A;  3N0T A;  4HE8 D;  2ZXR A;  5HV9 A;  4AL0 A;  4RDA A;  1YDI A;  4E17 A;  5E3A A;  5A6K A;  2W4M A;  2WVQ A;  4MW3 A;  2WVN A;  4K1O A;  3NMI A;  4XTK A;  4JTA B;  1WAT A;  1VK5 A;  3RKO F;  1QLE C;  1HMO A;  2L81 A;  4O6N A;  3ABK C;  3EZI A;  1YYJ A;  3B71 A;  3RQF A;  1L3P A;  4JCZ A;  2Q9C A;  5KYW B;  3I4U A;  1HE9 A;  3ZTZ A;  5T3W A;  1QSP A;  2VCA A;  4C3E A;  1J8M F;  4MS2 A;  1YYX A;  1PD1 A;  4WGY A;  3ZVR A;  3K7D A;  3GM3 A;  2IYL D;  2HV7 A;  1O5H A;  2YRF A;  1HE1 A;  3ZG1 A;  2J46 A;  3ABL C;  4BJ5 C;  1ORY A;  1QPU A;  4PJN A;  2NUT B;  4U5H A;  4G78 A;  4OIR F;  2NUP A;  2BE5 F;  4EWC A;  1NFN A;  3EG9 B;  2C04 A;  3CSK A;  2ZXP A;  3FMS A;  4BJT A;  2J9W A;  5TJ5 E;  1N1C A;  4NTA A;  5JSL A;  1FFT C;  1OQC A;  2OOC A;  4ZLD A;  2GA0 A;  2KW3 C;  3N2Z B;  3SP1 A;  3RH3 A;  5KYX B;  3B0V C;  1L7C A;  2GWW A;  3CEX A;  2Q4F A;  3HNK A;  2KNH A;  2CW0 F;  2HMQ A;  5FCL A;  3JCU Q;  1FR0 A;  3GEI A;  3IQC A;  3OWT A;  4RBN A;  3HJC A;  4IAR A;  4NTF A;  4KNV A;  1O87 A;  4YL1 A;  4U9D A;  3G50 A;  2WZF A;  3U2M A;  4N6C A;  2Y3D A;  1Y6D A;  2Y3G A;  1YVI A;  5L3Q A;  3S27 A;  4JCH A;  1APC A;  4MVR A;  3S29 A;  1R5I D;  3GWL A;  1S7Z A;  1PV3 A;  4KNW A;  1FAP B;  4K0D A;  4MVZ A;  3B0U X;  2CNW A;  4QDL A;  4BJ6 C;  4PJJ A;  3W8I A;  3W2V A;  2E87 A;  3LAY A;  2EIJ C;  2ZPA A;  4NCQ A;  4MVO A;  4CDY A;  1VTM P;  1RKE B;  2LSE A;  4I44 A;  1SYQ A;  4ULW A;  1TWC A;  3EFO A;  2CCY A;  3ZC4 A;  2YL0 A;  1WOL A;  2YHS A;  3KPH A;  4NY3 A;  4D4X A;  4IWB A;  4DOZ A;  1PCX A;  2J9B A;  3O55 A;  1E86 A;  3V7O A;  5A69 A;  3ITF A;  1UFB A;  1MMG A;  1Z7Q c;  4Q5S F;  1MND A;  4X0R A;  2Y3B A;  5FZT A;  3S28 A;  1LKX A;  3Q7G A;  4YT5 A;  2AVK A;  1XZP A;  2IBF A;  4N6H A;  2ZXW C;  1EKY A;  2YLI A;  3A9C A;  1WN0 A;  1Q0K A;  2EIK C;  4IAO A;  3AG3 C;  3ECS A;  1ZYR F;  3NYL A;  5JUA A;  3GEE A;  3QMK A;  3G4X A;  3KL4 A;  4YN0 B;  1Q0D A;  2J45 A;  3K6B A;  1JOG A;  4FAP B;  1M57 C;  4RD9 A;  5AC4 A;  1HMD A;  3NYM A;  5B3I A;  3W4Y A;  4W8P A;  4DBQ A;  2PP4 A;  3RW0 A;  2A1D D;  1CPR A;  5BQG A;  2XL4 A;  2B0H A;  3DJU B;  3FOO A;  2YZS A;  4DXW A;  3FXH A;  2VCC A;  2BC5 A;  2XLM A;  4JRZ A;  2QE9 A;  2FFH A;  4J7Y A;  4N4W A;  2OEX A;  1SZI A;  4JTC B;  5AC5 A;  3T9O A;  4CSA A;  4PR9 A;  3AQB A;  1F1M A;  1NU9 C;  2XLH A;  3OA1 A;  2HJ3 A;  1Z3I X;  2L7A A;  3IQT A;  4ONS A;  2FAP B;  3GOD A;  1YA7 O;  1WGW A;  1PD0 A;  3KYJ A;  1IZM A;  4ZLC A;  1A0B A;  1QQ3 A;  4W8K A;  1JRA A;  1ZHW A;  3LEO A;  5K0I A;  3KYI A;  5A6A A;  2BL2 A;  1WWP A;  2R25 A;  3HNJ A;  1ZU5 A;  4QI0 A;  3IPM O;  4JZA A;  1E84 A;  3ZSU A;  3JSE O;  4I1M A;  3ZWI A;  1G4U S;  3F46 A;  1JMW A;  2ETS A;  4YT2 A;  2Q9B A;  4JKV A;  3EHN A;  3V5Y A;  4E7S A;  1TQG A;  2PNO A;  5B3S C;  1LE4 A;  3VM6 A;  2HS5 A;  4H54 A;  2NUP B;  4XEF A;  4XPW A;  4G0H A;  4C3B A;  3IQ6 A;  4ANJ A;  2R7R A;  3KMI A;  2CGE A;  4BG0 A;  4MVQ A;  1OCC C;  1T9K A;  3MBG A;  3LNR A;  3FOP A;  4ER9 A;  1GM5 A;  5E33 A;  4HEA J;  256B A;  2XL6 A;  3RF3 A;  4I1O B;  2AWC A;  4G7O F;  1E2X A;  1M56 C;  2OCC C;  2YL7 A;  3DAF A;  3DE8 A;  2EPN A;  2OKU A;  3CAX A;  5L0J A;  3NKD A;  1I4Y A;  4P6I C;  3MYF A;  1K05 A;  4IRU A;  2LIG A;  3KKB A;  2OEV A;  4FX5 A;  4DJ9 A;  4F4B A;  2NG1 A;  5JRA A;  1D1C A;  2HUJ A;  3E9V A;  2D5R B;  2ZD9 A;  1TFK B;  1UG7 A;  2A69 F;  2YLG A;  2M4E A;  2W9Y A;  4U5D E;  5BUO A;  5EGY A;  2R02 A;  1K40 A;  3FHD A;  3EZH A;  3LS1 A;  1ORJ A;  2MYS A;  1OW8 A;  2KGO A;  2YEV A;  1BR1 A;  1D0Z A;  1OCO C;  1YLM A;  2XRH A;  3MX3 A;  4MND A;  3L8I A;  3RFY A;  5JS5 A;  5L3V A;  4JJG A;  4E7Z A;  4MTF A;  3BRJ A;  1U6H A;  2L6H A;  1Y4C A;  2KJG A;  1C17 M;  2LFD A;  3ZDL A;  1SF8 A;  1YZA A;  1M2O A;  1NBB A;  3O6X A;  3EFO B;  3MFN A;  4JVS A;  5KYY A;  3ZQV A;  4ULV A;  2Y3H A;  3PMR A;  1JR8 A;  4AX2 A;  2XLW A;  4DRI B;  2LD6 A;  4LDQ A;  4JW1 A;  1U89 A;  3PDM P;  2P0N A;  3TQO A;  3UGP A;  2PFD A;  3LLI A;  2XLE A;  1B68 A;  4YT4 A;  4EBJ A;  1SR2 A;  1LPE A;  1TFO B;  4CS9 C;  2R7U A;  1JPJ A;  3HNL A;  5DS4 A;  3K1H A;  5L0D A;  2LP4 A;  2KK1 A;  4OIO F;  2ICW G;  1V54 C;  3QTH A;  2R9R B;  1XWJ A;  2H7B A;  4WJ0 A;  3WAQ A;  4EUK B;  1ZU4 A;  3DM5 A;  3LES A;  1A7V A;  4N06 A;  3RVY A;  4BEM J;  5JVE A;  2C03 A;  2Q00 A;  1YZC A;  3T4R A;  4AL1 A;  2IXO A;  3C7J A;  3S9O A;  1M2V A;  1MMA A;  3DD7 A;  5L0F A;  4UDV A;  4XPX A;  3NDB B;  3DE9 A;  5L0H A;  2IOQ A;  1DOW A;  3W2W A;  1OCR C;  1XZQ A;  5IY5 C;  1ZHT A;  4GEH A;  2HKV A;  5CI9 A;  4CS8 C;  1VYI A;  2F22 A;  1HW1 A;  1A7D A;  2RD9 A;  5CIV A;  4U5G A;  1YA9 A;  4CDA A;  4LER A;  1YJG A;  1ZVZ A;  2CDQ A;  3AG2 C;  4XEV A;  3B29 A;  2YWA A;  1HY5 A;  2WZG A;  4H4K C;  1BR4 A;  3AG1 C;  2A0B A;  3H2V A;  1EI7 A;  2M64 A;  3H2U A;  3UMI A;  4E18 A;  4XWJ A;  2WVO A;  2YKZ A;  1I5N A;  3DM9 B;  4FWV A;  3IEE A;  3LUT B;  4AE4 A;  1G4W R;  2A6E F;  2EPL X;  2ZXO A;  3AG4 C;  3I5P A;  2UUH A;  2XXA A;  4FES A;  3Q6M A;  4PFP A;  1TWH A;  4WGZ A;  2R7S A;  1LI7 A;  3AOU A;  3L0I A;  3OEO A;  3TUL A;  4PAC A;  5B1B C;  3U3F A;  3NYJ A;  3T6B A;  5D91 A;  2PX0 A;  4U5C E;  1VOM A;  1I4Z A;  1KTM A;  3G4Z A;  3C8G B;  3WG7 C;  1LS4 A;  4LDK A;  1BBH A;  1H9G A;  4JUR I;  5B1A C;  4BJ1 A;  3TK0 A;  1MMN A;  1LM3 B;  2OJE D;  2JX0 A;  2A6H F;  3L1M A;  3M1C B;  3HLZ A;  1BR2 A;  3U8P A;  4CX9 A;  5JP7 A;  1D1A A;  4I3M A;  3MYI A;  2NUT A;  3QW0 A;  5E2Q A;  1T6U A;  2HFI A;  2J9V A;  2XM0 A;  4IB4 A;  3EG9 A;  1DOV A;  5CI8 A;  1IW7 F;  1D0Y A;  3DJN B;  4LLE A;  4CBE A;  4YT8 A;  4P9F A;  3EGD A;  3IQ5 A;  3IHU A;  4O79 A;  3SYN A;  3SXZ A;  5COF A;  4CS7 A;  3U5S A;  4YWQ A;  3RQG A;  2EPO A;  5KYX A;  1C02 A;  2XLD A;  2XS8 A;  4J30 B;  4JTD B;  1OR3 A;  2YL3 A;  2V3C C;  1OCZ C;  1Q0M A;  1QVX A;  2G3K A;  3SXY A;  3ATP A;  1FMW A;  2LK4 A;  2WL8 A;  4PJL A;  3POV A;  4PJM A;  2AU5 A;  3C8Z A;  3EHM A;  5L0I A;  3JSZ A;  2A68 F;  2IM8 A;  5F5F A;  4U9E A;  3NG1 A;  2OQM A;  3N24 A;  1OXB A;  2IXN A;  2IXM A;  2Y39 A;  3T6J A;  2W4B A;  3LJB A;  5COG A;  1AUE A;  1CGM E;  1TKN A;  3Q6N A;  3ASN C;  2HZ8 A;  1NLX A;  2JPU A;  4HFF B;  2HJM A;  1V55 C;  1A7E A;  2H7V C;  3DI5 A;  3E70 C;  1YAU O;  1ZHX A;  2EIN C;  4M63 A;  4IGG A;  3EPV A;  2OG2 A;  3LLK A;  3U9J A;  1RJ9 A;  1ZW2 A;  1CPQ A;  3UR3 C;  2XLV A;  3K66 A;  4DVY P;  3UGO A;  2GDC A;  4U5E E;  2TMV P;  2LQG A;  3BEH A;  2OU6 A;  3SNH A;  3UMH A;  4EKW A;  5A6J A;  3U0C A;  3ZQY A;  4O6Y A;  2QTV A;  3A11 A;  1WAS A;  3M4C A;  4LDR A;  1R4T A;  1V74 B;  3EH1 A;  1E85 A;  3GWN A;  4O6M A;  2UUI A;  3FDQ A;  4KI2 A;  1JAF A;  1M6T A;  2QLA A;  2HSQ A;  2L6F A;  2PBE A;  1VLT A;  3QVY A;  3V5Z A;  4KBL A;  2P7V A;  5A6B A;  3GM2 A;  3T6G B;  1CGO A;  1VB5 A;  5BQI A;  5A6B D;  3DWW A;  1A41 A;  2O9X A;  2P6V A;  2J8W A;  5GPG B;  2W45 A;  5COM A;  2GAQ A;  1FNT c;  3K33 A;  1NSG B;  1Z63 A;  2DYS C;  2EPK X;  4MTO A;  1WTY A;  1GS9 A;  2I15 A;  1Z23 A;  2I8B A;  2J9U A;  2L6G A;  4OIP F;  3QVZ A;  4IJJ A;  4Z9J A;  2CYD A;  2VH3 A;  4CDV A;  2KQ9 A;  2G62 A;  2LFF A;  3X2Q C;  4J32 B;  3RIP A;  4MTG A;  2YLD A;  1V4A A;  4CSA C;  3SEO A;  3ABM C;  3NMK A;  4CJG A;  3R7C A;  4AE4 B;  1O3U A;  4MQ9 F;  2QUP A;  3SXK A;  5KYN A;  2AP3 A;  4QI2 A;  1FMV A;  2XXA B;  4BJ6 A;  1NZE A;  1T6Q A;  4G7H F;  5DQZ A;  1VYK A;  1OW7 A;  1T5O A;  1GQA A;  2GFH A;  3F47 A;  1TWA A;  1KNY A;  4XQ1 A;  3AJM A;  2VCB A;  4K7B A;  2J7P A;  2NPU A;  4MVU A;  3TOL A;  2KYH A;  3ZIB A;  5L0G A;  2DYR C;  2EPM X;  2J7P D;  3EGX A;  3RQE A;  3GAN A;  4AK9 A;  1T01 A;  1EA8 A;  3LS0 A;  1LIH A;  5JT4 A;  3VF0 A;  2D4U A;  3X1O A;  3HNI A;  1QKR A;  5DQT A;  1LE2 A;  1ZW3 A;  3R2P A;  3RYL A;  4C7O A;  1FTS A;  1RKC A;  2L9J A;  4LAC B;  5DS6 A;  2XM4 A;  3UMK A;  2VAS A;  1Z5Z A;  2AWY A;  4HFK B;  2B0J A;  5KYU A;  4DVZ A;  1U0B B;  1HW2 A;  2PX3 A;  4OD5 A;  4Q7C A;  1W2W A;  1Z6A A;  4B6I A;  3QW1 A;  4JIO A;  2XLO A;  5F5H A;  3TOM A;  2J0X A;  2R05 A;  3FAJ A;  2KC3 A;  1ST6 A;  2QY9 A;  2VB6 A;  2QNL A;  1AEP A;  3ASO C;  3EGD B;  5T3T A;  1NG1 A;  2YL1 A;  4CIH A;  3L34 A;  2VC9 A;  1BDJ B;  1J8Y F;  2WZL A;  1MNE A;  1SMY F;  3GM1 A;  1EQ1 A;  5F28 E;  3PCV A;  3TD7 A;  2Z15 A;  4G7Z F;  5T1D B;  3J06 A;  1Q0G A;  3DMD A;  3M79 A;  1LVK A;  4E0H A;  2HSB A;  2NSF A;  1TWG A;  3U2L A;  4BEJ A;  2R7X A;  2R7W A;  1FFH A;  4R32 A;  3C63 A;  3LEV A;  1D1B A;  1RMV A;  5EK0 A;  4JJF A;  4DBR A;  3S0X A;  3WOD F;  2A0U A;  4LLC A;  1RCP A;  2H8A A;  2OJQ A;  4NC3 A;  1MQV A;  1S05 A;  3K1I A;  4IAQ A;  1MMD A;  3SXM A;  2J0W A;  4EBB A;  2MHR A;  2X0C A;  2V26 A;  1OR2 A;  2WB7 A;  5KYW A;  2HV6 A;  3B9Q A;  2XSE A;  1RXQ A;  4WAB A;  1ZHY A;  1G5Z A;  3I5Q A;  2CNW D;  2P61 A;  4GYT A;  1RJ9 B;  3C18 A;  1ZHZ A;  2DI3 A;  4D4N A;  3M15 A;  1H9T A;  1ORS C;  3EQL F;  1OKK A;  2P1A A;  4NQF A;  1YAR O;  3AQC A;  1ZZP A;  1OKK D;  3U9M A;  2R7T A;  3JTL O;  3JRM O;  1CGN A;  4YK5 A;  1GGQ A;  5DS5 A;  4JE9 A;  3H65 A;  3VRC A;  4DRH B;  5DVW A;  3KH2 A;  4Z9I A;  3VYW A;  5EHH A;  2X51 A;  4XLN F;  3S84 A;  3GOR A;  3AGU A;  4XEK A;  4XPY A;  1KU2 A;  1H7I A;  5BQH A;  1G8X A;  3C62 A;  3DZA A;  5E3C A;  3GEH A;  3MLG A;  4YL3 A;  3U8V A;  4OIQ F;  1H6G A;  3LNM B;  4PFO A;  2YQY A;  1QZX A;  3US6 A;  4BPM A;  2Q9A A;  5L0C A;  3TJ6 A;  2R7Q A;  3AGT A;  4DRJ B;  2KSF A;  2G3V A;  3FVY A;  4JEA A;  4Q4Z F;  3FAP B;  3UNG C;  3EJN A;  4KC9 A;  2HMZ A;  3NKE A;  2Q3T A;  5AGF A;  3WHN A;  1OW6 A;  2RSE B;  4MVM A;  1E83 A;  1BZ4 A;  4OIN F;  3V5X A;  4YJW A;  4U5F E; 
#chains in the Genus database with same CATH homology
 2LFF A;  2HZ8 A;  1Y4C A;  2LFD A;  3U8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...