2LFNA

Identification of the key regions that drive functional amyloid formation by the fungal hydrophobin eas
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
SATTIGPNTCSIDDYKPYCCQSMSGSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSGLIINAANCVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-assembly of functional, amphipathic amyloid monolayers by the fungal hydrophobin EAS
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
molecule keywords Hydrophobin
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.520 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lfnA00
2LFNA 2FMCA 2K6AA
chains in the Genus database with same CATH superfamily
5C4HA 1XMOQ 2NVYB 4LF4L 2L55A 1JJCB 3RZDH 3AFQA 4DNIA 3E6ZX 3URYA 4DNRB 4DV4L 3H3VH 1UE7A 1PLFA 1ESRA 2UUCL 2HD3A 1EYDA 1D5XC 4K5VA 3VR3A 3GDEA 3SHLA 3PF5A 3W1BA 2OF1A 3NELA 3J80i 4C3IG 1AE2A 2ATWA 3NSWA 3UDXA 2JA5H 1MJEA 3RD4A 2B2UC 2I5HA 5I9PA 3DWAA 2CH4W 4KY5A 2CW0C 1SFOB 3H09A 1TY0A 2OT2A 5FJ8G 2DJFC 4YHHL 1TS3A 3CQZB 2FXQA 3PUVA 2UUBL 5ELEA 1N36L 3MVVA 2WAQG 1TT2A 4IZ8A 3V2TA 1VQ8A 4KJNA 1VQDA 4MZ9A 3E3XA 1HR0W 1DD2A 3J80L 2Z9HA 4DV2Q 1GO3E 5ELFA 3J81i 1FVIA 2NTTA 1I3QB 3ICEA 3M4OB 3PF4A 1CQVA 1DGSA 4OWTB 4CJ1B 4P71A 2X6GA 2DY7A 3I8ZA 1EY4A 3HOZB 4JV5L 2YU9H 4B3TQ 3L7ZC 1XNRL 2BOSA 2UUAQ 1EOVA 3RLNA 4HJ5A 3WOEA 2I46A 3MA2B 4IFDH 3IL8A 1IZ6A 1D5ZC 2K1BA 3CD6A 2VZAA 3FRPB 4C2MB 2K52A 5I4DA 1AZPA 1C0AA 4KV6A 2QKIC 4L6TB 3PIOA 4JI8Q 1QCBD 4JC0A 1U4MA 2R6GA 1GUOA 1TWFH 3DWQA 1U4PA 1HA6A 3VYTA 1JMCA 3A5UA 3T53B 2GVAA 2K5NA 1WTQA 1SNPA 1NNXA 1PZJD 1UEAB 2ZTCA 4A3MG 3R2TA 4UPAA 2TMPA 4G7OC 1SMXA 3K5OA 3L0OA 4A3KG 1IBKL 4P75A 1TVXA 2L4NA 3CRKC 5EKKA 3VR6A 4DV5Q 2RQXA 1EY9A 4C1NK 2HCCA 1EL0A 2RCFA 3K57A 3R93A 2E74C 3PIO3 2XGTA 5C4JB 3KF8A 4KD4A 4DV3L 1TU2B 3M4YA 5FLXL 4JYAQ 3FP9A 3C46A 1TWAB 3DHQA 2IX3A 1LYLA 2NB0A 5EAYA 1TS4A 4DR3L 1AEXA 1RKNA 2F0VA 1PFSA 2P5ZX 1IKLA 3HOUG 2M00A 5FLMG 4HJAA 3K58A 4A3DH 1NSNS 2E2IB 1NE3A 1B70B 1PXUA 5J22A 2E2IH 3J80c 5KRUA 1BKBA 1Q82C 4LUZA 3ULJA 4HIOA 4NXNL 1HJPA 3SK4A 3W1GA 4EVOA 3I4OA 2EJGC 1LTGD 2G9DA 2R93H 5JVG3 3WDNA 5EPLA 5IYCG 2OEOA 2B2VA 4YCUA 1YHBA 1J5EL 4JYAL 2L11A 1YIJA 5C4JH 2E2HB 4ZK9B 2KECA 2F4IA 3GTPB 4KN7C 2E5LL 2E8GA 1VQKA 4DA2A 3MC0B 1E1OA 4BXXH 2L5TA 1G291 3K80C 3NK9A 3QIAA 1LV9A 4A3FG 2HT1A 1EQVA 3FHWA 3CXCA 1WFQA 1FNVA 3TP5A 2K01A 4GN3B 1HH2P 4DKAC 1FJGL 5KNDA 5EQ0A 4MTNA 4WORA 5E4XA 3FKIG 4CDEC 5D3IB 4K8JA 3J81c 3BVZA 1FR3A 1Z7TA 3S1QB 1DOMA 3EFXD 5M3MG 3TMEA 1RCVD 2F0HA 4DV0Q 1YVCA 1K28A 5KIXA 1Q1EA 4Y52H 1ICFB 1K3RA 3GO5A 3I4NH 2I5LX 2L0CA 5JEAG 1F9QA 1PHJA 4QJFA 3GTQH 3X3NA 1WTVA 1EY7A 1XX8A 2EOTA 1SYCA 1BOSA 1PH7A 3OSOA 2RBMA 4UP9A 3VR5A 1XPUA 4TKOB 3TZUA 1STNA 3TSSA 3I73A 1KDBA 1KHIA 1TWCB 4TQUS 2QEXA 3HOWH 1DOLA 1K83B 1N36Q 4JBWA 3RLOA 2B2UA 3W3AA 1X32A 3K81C 4ILWA 3NBHA 3W2DA 4BBSH 1N33Q 3ERSX 5GADC 4K8IA 4BBRH 2DY8A 2WIIB 1CT1D 1Y8PB 1D6EC 2MGSA 3KK7A 3RR5A 4DK3C 3UDFA 5EKIA 1N33L 3C1EA 4DUYQ 5IP7G 1S5CD 4LF5L 5K5PA 3HKSA 4JI7Q 4C3HB 4Z9CB 2CQOA 4ZYSA 5IGFA 1XPRA 4A3JH 1TWGB 1EIFA 4ULLA 4JI6L 1SJED 1F9PA 4IO9A 3RLFA 3OWFA 1X3GA 4POGA 1BO0A 2XRSD 4LW1A 3ND8A 3GTLH 3HOWG 2LFNA 4IFDI 3BVGA 2SEBD 3RZOH 1UAPA 2JA5B 5IGCA 5C0XH 2F0DA 5LMNQ 2ICIA 1E24A 4UAIA 1HXYD 4S3SA 2UXDQ 1X55A 1NTGA 1PZID 3PSIA 5M9OA 2EXDA 1X3EA 2KCNA 4LF9Q 1CA6A 1BXTA 3IFDA 2IWHA 4YCWA 4DAYB 4ZUIA 2M2LA 3I4NG 1YNXA 4QL5A 3D3RA 2IY5B 1EWHA 4AYBG 3IKJA 2XVSA 3Q6SA 4OWWB 4OONA 3A0JA 4OGQC 3U4ZA 1A3VA 1Q3LA 3CAMA 3HOUB 1B8AA 2JE6I 3I4MG 1K73C 2ZJRA 4O2DA 1KAWA 1WTXA 2YYZA 3I72A 1GUNA 5CV7A 4IURA 4X3TA 2YTXA 1HFNA 3KOJA 3BVMA 2PW7A 1BVSA 4H7BA 3CQZH 1EY6A 1WTPA 1OXSC 5IGBA 1HR0L 1LTSD 1VS0A 4DR7Q 2EIFA 2CKZB 2LKVA 1XNQL 2DNEA 2OTJA 4R4CA 4ME5A 3SGIA 3BU2A 1U4LA 4RKLA 4LUVA 2UXCL 3M3YB 2B63H 2O5IC 4K0KL 4H0LC 1S3OA 3J81L 3DEPA 2VXWA 1NUCA 2F0UA 1S40A 2JK8A 1TS2A 2R61A 4B08A 1S5ED 1YNNC 2JA9A 1G2SA 2KCMA 4GKJQ 1AZQA 3PO3G 4KHZA 4DR3Q 1VQIA 4NMZA 3A8JE 1OXTA 5M3MB 4GNXA 5LL6S 3OW2A 1R9TH 4FO2A 1L1OA 3H0GG 1GUGA 1VF5C 1GOZA 3AYHB 5C44B 3HKZE 2AUKA 2RCNA 1HNZQ 2CQAA 2XN9C 1XWEA 3G7LA 4HAEA 4A3EH 2XIWA 1PTOD 1LTLA 4C3JB 1GM5A 1K8GA 4DR1Q 2NVTB 4G7HC 1STBA 1PFBA 1IBMQ 2VUMG 1WCMG 3GTMH 1VQEA 3HEJA 3I55A 3MZ5A 2K4KA 3KF8B 5JJLA 2NN6G 3T1YL 2VNUD 4DPGA 1EYGA 1LACA 4P2CB 1N8RC 3S14B 1Y1WB 2ZJPA 2J7ZA 4ODGA 2SNMA 4P72A 4BBRB 1QZGA 1SN8A 1SYEA 2OTLA 1GXDC 1OXXK 1DXMA 2HQEA 5C44H 1V1QA 5JVH3 1D1KA 1PV4A 4JI0L 1BF4A 3KDFA 4C3HG 3A56A 3BYTB 4KI0A 4R9WA 4RHSA 5BN3A 4JV5Q 1KXLA 3T1HQ 2A1AA 4N9PA 2YTVA 2B3GA 5C0XI 3PQIA 4KHPQ 3DUZA 1JJ2A 5I2XA 2BE5D 1Q7YC 1VQ9A 1O80A 3GTOB 2RHQB 3C2PA 4RFBA 4CKBA 2F0EA 4MIUA 2BDOA 3CW2C 1PYWD 5IYBH 1F2MA 4DV7Q 1Q12A 3K5NA 1ASYA 1E2VA 1LT5D 2V4DA 1E22A 2NN6H 1GJXA 2I0QA 1P8LA 1Q90A 1NMFA 4PZ8A 2F1MA 5LMNW 5CV8A 1A8VA 4DV1Q 1WCMH 3M4PA 4X65Q 1MSGA 5A2QE 2PQAB 2Z6BA 1RTOA 4HSVA 4A3FB 3J80E 2FMCA 2F0PA 3S1MB 1B4OA 1VQBA 4JG2A 1GD7A 5L37A 2AQ3B 2Q2UA 1TXYA 1EU4A 4YHHQ 2F0LA 4WJ3M 1EEFD 1KRTA 4A3EG 3TP6A 3FKIB 1K8AC 3KJOA 1EY8A 2EY1A 3O13A 3F2UA 1A62A 3K0YA 4YY3L 1A2TA 4EX5A 3I4MH 3JAMi 3IFTA 1B50A 2K14A 1JJGA 3HKZG 1LO5D 3GTPH 2B2WC 1E3PA 3K0XA 1CZWA 4APVA 1UUPA 2E76C 1DCZA 3TEHB 2JYOA 1HCZA 3S15H 2IHFA 4HIMA 4A3IB 4JI2L 2F0KA 4OIJA 2WB1B 1MKHA 3S2DH 1N34L 1HZBA 1I6HB 2MO0A 4F7XA 3TREA 4WFN3 4GNXC 2Y0SB 1NBWA 3HOYH 4OO1G 2B63G 2F52A 2O4XA 4OWXB 2K7VA 3GTJH 1I94L 1C4QA 2KCTA 4Y7NB 4LF9L 1L0YB 1YNJD 3OMGA 2D0PA 1JWMD 4GN5A 4U68A 4B9WA 2FMMA 2MJ8A 4IPGA 2BA0A 4N8X1 2IL8A 3NWSA 4LF7Q 4X66L 5CV6A 1FNWA 2VQFL 4A3BG 4B3RQ 1LTBD 1W6KA 2NVYH 4C3HH 2ALYB 1A63A 4FVMA 1Y8NB 3OOCA 4FF1A 5M3FG 5JOBA 2UUCQ 1CSQA 1PYBA 1WD0A 2K5DA 2WAQB 1PH8A 2F0NA 5EKLA 5C44G 1S72A 4CDFC 1HZCA 4ID6A 2PQAA 2KA7A 3EROA 1ET9A 3HP3A 1O7IA 1VQ7A 4JPBW 5CV9A 5K36H 3ND9A 2RSOA 2EY6A 2SOBA 3EVQA 1Y69U 4JI6Q 4AYBE 5ISRA 1F2LA 3GTKH 5COYA 2MPMA 1LTAD 2JP1A 1IL2A 1EQQA 4KMUC 2B2VC 2EYHA 1HR0Q 4JOIC 1L0WA 3BZCA 1B44D 3KLSX 4JCVE 4HMJA 2HDLA 3K5LA 4DV3Q 3K7AB 3ZYYX 4GLXA 3J7A5 3NQTA 4AQYQ 1B2TA 1XPOA 3NTIA 3R2IA 4NW2A 1I6HH 3D4DA 3PUYA 3S9WA 2PI2E 5CV5A 1YI2A 3T1YQ 3QO2A 1CQFA 2IX0A 3CU7A 3A5ZB 5TSSA 1LLRD 4I7AA 4X64Q 1D1IA 2CHBD 3S24A 3OTOQ 3CCLA 3K7AH 5C0XG 4GKJL 3KDFB 4ZAIA 2F0QA 1X54A 3S17H 1PYSB 3H0GH 4DGZA 4GNXB 4DR1L 3HOZH 3TRZA 2PNRC 4KN4C 4LFBL 4J6HA 1N32L 4DK1A 4J1MA 5IP9H 1B3QA 2WP8J 1EQTA 3LGJA 4KTAA 4EQOA 4A3JG 3CCEA 3G71A 1I4HA 1UE6A 3LWEA 5M3MH 3UDIA 3BS1A 2MUYA 1CSPA 2MHVA 1W3SA 2KOLA 3HGBA 5HY6A 4A3MB 1CK1A 1HTLD 4DR2Q 5K36G 5EJWA 5CBEE 2JA6H 4QF4A 3I7FA 3D6CA 1PRTD 1X56A 5CMDA 2ENBA 1JCKB 4BBSG 3OYYA 2JA7B 3PGZA 5M3FH 4NXNQ 4IPDA 1GUSA 3JAMc 4OHJA 3D8GA 2HQLA 4N9TA 3A54A 4IJHA 3H3VI 1V9PA 3H15A 2R93G 1QNUA 1HA5A 4H44C 2MNAA 3QOJA 4M1UB 3E9HA 1SAPA 3T4AC 3Q23A 3WWVA 2BE5C 1B53A 3ITPA 1SXTA 1WD1A 2QDLA 2I07B 4DV7L 1QE6A 2A6EC 1SE2A 4KHVA 1CZGA 1XMOL 3KF6B 2RDFA 3I70A 1SJHD 3I4LA 3H94A 4BS9A 2F03A 1A2UA 2CWPA 4XQNA 3M7GA 1R9TB 2R92H 2PPBC 2F3IA 4ZCKA 2A68C 2AMCB 1JB3A 4B3ML 1H9RA 1E1TA 3FKIH 2A74C 1FNUA 3E5SA 1I6VC 2CH4A 4AH6A 3HG9A 4JI0Q 4IUTA 3STBC 2PZUA 3S1MH 1SSOA 4A3FH 5ELBA 2EYLA 2ZTEA 3S14H 1I4XA 4JI5L 5JJIA 4DXFA 2G5DA 1VQCA 3MXUA 4WJWA 2DNCA 2BA1A 2Y0SG 4UP7A 4YWMA 1LTRD 3NEMA 3BZKA 1IL8A 2PW5A 3W5OA 1QZHA 5CYUA 2QEJC 1GHJA 3RUZA 5GAHC 4XXEA 4K5WA 5LMNL 1SYBA 2XTIA 1ZEQX 1VQMA 1O7YA 2K04A 1ZYRD 1C7YA 2JA6G 5C4XB 1BQQT 3SK8A 3MEHA 1PRTC 5IYBG 4C1NI 5HGTA 1G6ZA 4RCOA 3PUZA 3EBEA 1PDQA 1KLGD 1NR4A 3CCUA 1BDOA 4EQNA 4EQPA 2L1BA 1W6JA 5IWAQ 5C0XJ 2V1CC 2BDNA 4QUCA 1PRTB 4LAAA 2TSSA 3UE1A 3BDLA 3D31A 1XNQQ 1PFMA 4K5XA 4IFDG 1RHPA 2JEAI 4DUYL 5A2QL 1EOTA 4IFDJ 2Z8LA 4L5RC 1KDAA 2C5CA 4CDCC 3T13A 1CKNB 5C5LA 5BR8Q 4FF2A 2R7ZB 1I4RA 3IAYA 2I5MX 2R7FA 3NTKA 2VQFQ 1WYDA 2JJQA 2ZXRA 4OO1H 5J3BA 3HOYG 4FDBA 4U673 4HN7A 3MAQA 3S17B 2D2CC 4DN4M 1LM0A 1PH2A 3VYUA 5CORA 3KFUA 5EBDA 1ZXTA 2F0FA 4IUNA 1G2TA 3NP8A 2KQ3A 1LTID 2ZTDA 3NXWA 2HHHL 1TY2A 3DEOA 1QUQA 1VQOA 1J8IA 5M5XH 1OXUA 1EU3A 4JI7L 4X66Q 1KDCA 3E9IA 4B3RL 4I65A 4JVZA 3VA7A 4LWCA 3E0EA 4XT3B 2CCZA 1C48A 1DOKA 1HUNA 2QDBA 4A3EB 5JJKA 2C35B 2VQEL 1KNEA 4BY7G 2PCFB 2JEBI 5C6AA 2L15A 2QF7A 2B2YC 1F9SA 1PTOB 2VS1A 3I56A 3AQQA 2GVBA 4DV4Q 3LWUA 4GN4B 5IGEA 1U9RA 1EZ6A 3CCMA 2CVRA 1IKMA 2JA5G 1YJWA 5JPNC 1SMYC 3GD7A 3F2DA 5IWAL 3HKZB 5EGTA 4ZKBB 1CA5A 1MJCA 4ME3A 3CMEA 4BBSB 3ERQA 3HFZB 4NP5A 5I6YA 3TS0A 2EYMA 1X65A 1QNKA 4G4KA 1L1OB 1HNXL 2CFMA 2XWJB 1G6PA 1K83H 2EE1A 1GKHA 1R4QB 3PO3H 2E2DC 1CM9A 2JA8H 3DM3A 1SYGA 4AYBB 5CGKA 4LFAL 3U58A 1QG7A 2K32A 4QUFA 3TP8A 1Q46A 4PNYA 3M3YH 2H4OA 5AFWA 3S2HH 3HRZC 4G7ZC 5H1SE 3GTGH 3RZOB 2Q2TA 2WAQE 1IW7C 2WACA 1B3AA 2OQ0A 1Z47A 1QVFA 4JI3Q 4L8JA 1BCPD 1KNAA 1HQRD 5FLMH 2G9HD 1N32Q 4WJ4A 4JBMA 1TWGH 1S5FD 1YJNA 3F8TA 3KLRA 3MXGA 5M5XB 4QCLA 4O0AA 3S1QH 1CHPD 3P7JA 2AQ2B 1EY0A 3CCJA 3D4WA 3AFPA 1YBYA 2RF4A 2Z4IA 1FJGQ 4PG3A 2Z4HA 1RODA 2EPBA 2LS01 4CKEA 4LF7L 3AU7A 4A3KH 2D0OA 5F2DA 1WTOA 5I6WA 2A5HA 4BY7H 2IJ0A 5NUCA 1HNZL 3J7AF 3TP7A 1JR0D 2B29A 1K0RA 4QB4A 1A0IA 1TS5A 3QB3A 1UE5A 2K5QA 2NYZD 2KCCA 1K8MA 1V1PB 2BH2A 3U4VA 1V1OA 3J7YW 3R3OA 1UWVA 4RWSC 1L1OC 1XYIA 1SE4A 4DU9A 1QB5D 1ILPA 4RKBA 4MTKA 4A75A 3DM1A 1BCPC 4XDXA 1IBLQ 4PZ6A 4B3SL 2HDMA 2K28A 4IQZA 2K6AA 5JJZA 3MFGA 1BCPB 3GV3A 3H0GB 1CFMA 2A68D 3MEFA 2F0TA 5IYDG 2NZHA 1VQNA 4ZKCB 3BJUA 2PZWA 5IT9E 5IODA 2QCPX 4OIKA 4YWLA 2MP1A 4DXGA 1PMRA 2AWOA 1EUJA 5BN5A 4UHVA 4X3UA 2FHTA 1FYCA 4A3JB 3AB9A 4C3JG 2EY5A 5GAGC 2N49A 4L63B 4HSPA 4ZQ3A 1I50B 3M85A 2QA4A 5FLXc 2HHHQ 2ID0A 2ES2A 3V05A 1P16A 1ASZA 3NQIA 1HTPA 1YHQA 5KGUA 1PVOA 3BDCA 3K7UC 1E0BA 3SK5A 2LMCB 3Q0AA 1Y8OB 1KL9A 2ZT9C 4R1JA 2K05A 1I3QH 3H6MA 3DMUA 4BBRG 1O7ZA 2VB3X 5J39A 3I2ZA 3A74A 4LMQD 3HZXA 2ZJQA 1C9OA 1SNCA 1BBXC 4PQXA 1MGSA 1WTWA 1TWHB 4FXDA 5C3EH 2VUMH 2R93B 1SNOA 4HIKA 3CPFA 2NZ1D 3SDZA 4DR7L 3GQBA 2D9UA 2Z0SA 1HFGA 1T5EA 4HCEA 3OW7A 5JPMC 1BR9A 1RL2A 5AJ3L 4JI5Q 4FYDA 1HZAA 3I3CA 4UP8A 1EWCA 1STAA 2B2TA 1L0XB 1XNRQ 4X62Q 1HHVA 4CGYB 3WOFA 2IT1A 4X3SA 4GOPA 4J15A 4A3DB 3S2DB 2J0TD 1U4RA 4XTCS 2R92G 2EYPA 1D5MC 1M1KC 3R8BA 5C3EB 1PH1A 1T5XD 4JK1C 2HCIA 4R8IA 4YY3Q 2IPKD 1I94Q 5C3WA 4DV6Q 5LL6X 4RGNA 1N9WA 1SE8A 3OHXC 3CCSA 4IOCA 4K2KA 4O1NA 1TQOA 2QGQA 5GROA 3J81E 1JWUD 3C3LA 3K59A 4NDXA 4NXMQ 2XNAC 3QG1A 2NN6I 3M4OH 1HRJA 2D5DA 2WFWA 4NKLA 1IYVA 1OTCA 4HTHA 3RMHA 4JI4L 1NMGA 4A93G 3MXNA 3PV0A 4RHRA 1Q8KA 1EIYB 2LXKA 2E2HH 3HOXG 4IN3A 4YIJA 1PH6A 4PZ7A 4KKTA 1JE5A 3BYYB 2NTSA 1HZ9A 4B9XA 1IXRA 1CKOA 4Q0FA 3TS2A 4DNTB 5ELCA 5LMUL 3NHHA 4I7ZC 4B3TL 2ICEC 2UXCQ 4DR2L 2NUCA 1PZKD 2E2JB 5KNBA 1J9OA 3A7AB 5IGGA 3EN2A 4BA1I 1STEA 2EQSA 3DLLA 1FGBD 1KAAA 1YHAA 2A6ED 2AUJD 2H1EA 4JBJA 1SROA 1ESFA 4O42A 5EPJA 4A3IG 3NE5B 1G91A 1PH9A 1O7LA 2RA4A 4DFAA 3EJIA 2VUMB 3HOUH 5G3LF 5C3XA 2R7ZG 3QJYA 3N52A 4IPHA 3TDQA 1WTRA 3RZDB 3CC2A 1S5BD 3KF6A 4KKUA 3HOZG 1D2BA 2GN5A 3S16B 2RKSA 1VQAA 2RDHA 5IIFA 3MWYW 4IUQA 1HPCA 1D8LA 3CRLC 3CCRA 4A3BB 1LT3D 3PO2H 5IT9L 1LTTD 4FP5D 4DV2L 1AH9A 5CC4A 4H13C 2N78A 4QIWE 1A3UA 2M9VA 5ELDA 1Z9FA 4QMGA 1PH5A 1RIPA 4IJLA 4P73A 5DEHA 5M5WB 2KHJA 3Q22A 2FFKB 1YNND 4IOAA 2NVQB 1I50H 3HOVB 1NJIC 3PUXA 4PMWA 1GUWA 1LABA 1JOQA 3G6JB 2N3SA 1Y1WH 1L2FA 3LNNA 2DJGC 3A8KE 5D3DA 1KD1C 3KLSA 4LFBQ 1YNJC 1ZYRC 2AKWB 1CI3M 1H9KA 5LMUQ 2F4VL 1SRUA 5IP7H 1IBLL 4B3SQ 2HUGA 3K8AA 1ONLA 3D4RA 3L2PA 3GP7A 2DN8A 3S2HB 1F2ZA 1QWYA 3IRBA 1B1ZA 4R4QA 2OWOA 4EGVA 4CDDC 4QQBX 4A3IH 2WB1E 3EIVA 4FNFA 4RCNA 2ZM6L 4BXXG 4HR7B 2JA8B 4EQ5A 4FXKC 4LJZC 3SVMA 2KUMA 4K14A 3MTSA 3MHBA 4OXPA 4A3BH 3J7ZC 3RN5A 4GZYC 5EBCA 3NPPA 4JW0A 1KQSA 4FF4A 1B9NA 2LXJA 3J81j 1Q81C 2EVBA 2A69C 4C3IB 1FD7D 4PV1C 1EQRA 3MXNB 4X3KA 4LK1C 5T1IA 4V0BA 1GVPA 3P1HA 2LSSA 4NB3A 4H02A 3CP0A 4LFCL 4UY8C 3CPWA 2Y0SE 4A93H 4MNOA 2D62A 1WI5A 2KHIA 1ICWA 1MHWC 3VR4A 5E7NA 5BR8L 4RGMA 4A3DG 4DAVA 1J6QA 1LT4D 1BBUA 3FPPA 1CHQD 5C4XH 3B6YA 4RA8A 1YJ9A 1X9NA 1X6OA 3PIP3 2IX1A 2EZVA 2JA7G 1ENCA 4HIDA 3Q24A 4L5SA 2NVXB 2VL6A 1X3FA 3ER0A 3S1NH 1S4ZA 1VQ5A 3GTGB 2R7DA 2N8NA 4OO1I 2B39A 3L9AX 2WB1G 2WINB 3FDTA 1R4PB 4IALA 4C3IH 5DLQE 1JE4A 4DUZQ 1C8CA 3VR2A 3CC7A 4ABNA 4XYQA 4DF7A 4LNQA 3CKIB 2R3ZA 5IYCH 3T51B 3NTHA 1QJOA 4KLKA 4X65L 3KJPA 2EYOA 4LF5Q 4K0KQ 3MFYA 1YZ6A 1MIUA 4DK0A 2SDFA 3I90A 3LX0A 1G8ZD 1V8QA 2NWGA 1CKMA 5HURA 2F0WA 1Y1VH 1STYA 3KBGA 5KEEA 1YEZA 2Q2HA 2Q8IB 3HS0C 2BCOA 3T16A 3GV6A 5J1ZA 3OPOA 1KC8C 3DXJC 2K5VA 2OXPA 5DM73 4FF3A 1VMPA 4OELB 1WJJA 1F77A 5KNCA 1H9SB 2JQOA 3GTLB 1JORA 3CMAA 1CUKA 1II3A 2PO4A 1VQ4A 1SBBB 3NBIA 2XRQD 2A73B 3G4SA 3VYSA 3STBD 1W2BA 4NXML 1BNZA 2Z6KC 3TZDA 3VA5A 2YTYA 1MBYA 1H9JA 5GQOA 3QR8A 1MD2D 1EEID 1KABA 5FKAC 3Q8DA 1M90C 1TR5A 4DR5Q 4Q5VA 5CV4A 2L12A 2WKCA 1SYFA 4DR6L 5IYDH 1E2WA 3DWPA 3S16H 2EJFC 2MO1A 2PQEA 1U0LA 3C1FA 1ML0D 4TSSA 1JICA 3TN2A 4E6IA 2K5HA 2UUAL 1RDPD 3I91A 4LF8Q 3HOVG 3L3OC 1SEBD 3PIPA 2F0JA 4BY1G 1ILQA 1LUZA 4JI2Q 4BY1H 4G57A 1V43A 4LUOA 2F0IA 1CTMA 4PMBA 5E1FA 4MN3A 2N88A 4IUPA 4DAPA 4HJ7A 3FMCA 2PMZE 1ENFA 3CC4A 4LF6Q 3GTQB 4A3GG 3OIPA 1DYQA 3CCVA 1FGUA 2JN4A 3M7NA 3U50C 1NR2A 3PMFA 4CJ2C 4POFA 1SNQA 5BN4A 2Z6KA 5DAUA 2X69A 1BUVT 3MXPA 4C2MH 1IHZA 4MHEA 4NPSA 4OEMB 2A19A 4TVAB 2KHSA 1YITA 3S1NB 1LT6D 4GLAC 4HCSA 4RMFA 2B8GA 1KRSA 3U9OA 1N34Q 4HEDA 2E2JH 2XWBB 4X62L 4LF8L 5C5MA 1IBKQ 2SNSA 4JBKA 1H9SA 4JI1L 1HNXQ 2DGYA 4XT1B 2VY3A 2Q8RE 1PA6A 4A93B 1Q86C 1EZ8A 2F0SA 2PMZB 1DJRD 3HOXB 1A6XA 4XQJA 2KEEA 3AEVA 4BY7B 4UDUC 5E4WC 4LFAQ 2UXBL 1JT8A 1Y1VG 4R4IA 4DV6L 1DZ1A 2NBFA 5CBAE 1E7ZA 4XQQA 4C56C 3FEWX 4RAUC 1I4QA 1PRTF 1H9MA 5FJ8H 1I4GA 2KBNA 1B7YB 1VQPA 1I5FA 1MI2A 4JOIA 1MSHA 3NBHB 2F0OA 3KUPA 5FO7B 2A6HD 5DNFA 1BCPF 5CR3A 1SFOH 1X3QA 2KENA 4Y7NH 4RGTA 4B3MQ 1X3PA 4CBVA 1WOCA 2ZXOA 3QWNA 3SE0A 4KJOA 4F87A 3CCQA 3RN2A 5JEAJ 3TBIB 5FLXE 1JWSD 3U9SA 4A4IA 2F3VA 4CHTB 1E2ZA 4XYOA 4FXGC 1NCVA 2Z1CA 1H95A 4K2LA 2K50A 1SDFA 1QILA 1K0SA 2EY2A 3PCOB 3UDGA 2NZOA 2JA7H 1FL0A 1NAPA 1EIGA 1QUQB 3QOLA 3HOVH 2EYJA 3F2CA 2NVQH 2PZTA 3GTKB 2JA6B 5C4XG 2K5WA 1M4VA 3M4QA 4CKCA 2F0MA 1S5DD 1TWHH 1OXVA 5M5WH 1VF7A 1EIHA 4BA2I 3NENA 1K8OA 4AIMA 5HGQA 2JSOA 4KHPL 2RDGA 3BG3A 2O5JC 4DV0L 5IGDA 2WV6D 1SNMA 5IY0A 5D14A 3PO2B 3NWTA 1A3TA 2F3WA 2A69D 1XTCD 1A15A 3A7LA 2B2WA 1CKNA 5AJ3Q 2K75A 1WCMB 4BWGB 1TWCH 3HOWB 2E75C 4YCVA 2N55A 4R8NA 2K03A 4RGOS 1WTHA 2VW9A 3HOYB 1RF2D 2PYKA 2FINB 1KLUD 3KLWA 3BDOA 5ELNA 1ET6A 3SR1A 1HQMC 1TWFB 2B2TC 5JAVA 3EA6A 1PFNA 1HUMA 3AMUA 2HIVA 4GKKL 2UXBQ 2EXZA 4A3CG 2IHEA 2CW0D 2RVLA 1SMYD 2H5XA 1IBML 4LF6L 2AQ1B 3I4NB 4GLVB 2X6LA 4ZUJA 3GTOH 4QGUA 4HJ9A 3ULPA 3M9BA 4OL7A 1JC7A 2WKDA 4GKKQ 1JOOA 4ALPA 5FO9B 2BH8A 1SYDA 4JI4Q 2LY7A 3I4MB 2UUBQ 2YV5A 1M8AA 3D0FA 1SNDA 3UE0A 3KYHC 5IE8A 1EFID 2ASBA 4A3LH 3OMCA 4RG1A 1STGA 4KK7A 3JAME 1VQLA 1AE3A 1IYUA 1STHA 3X3MA 5JEAH 1SR3A 4DR6Q 4GOPB 3P75A 4DR5L 3NUCA 1RJTA 1IW7D 4V190 4XIGS 1EYCA 4A3KB 1VQ6A 1UEBA 5FOBB 4GOPC 4QY7A 3PUWA 1BBWA 4N8FA 4F8MA 4HJ8A 3GTJB 3A8IE 1QVGA 1XTDA 3ONAB 2NVXH 1VQHA 4K6LA 2RHSB 3H3VC 1VQJA 2OQKA 2JXMB 1XMQQ 3S15B 1V1PA 1VQGA 2KEDA 4F88A 3PO3B 1EWIA 2CWAA 5M5YH 1VCIA 1NY4A 2MQHA 1VDZA 1UNSA 4JI8L 1XJVA 5FO8B 4K6DA 3UI2A 1XMQL 1U5KA 2J4XA 2EJMA 1PH4A 1PTOC 4IPCA 1TWAH 1ENAA 1JOKA 1Q1BA 1QVCA 5C3EG 1EYAA 2DUDA 2QW7A 3VYRA 1B9MA 5I9OA 1DONA 4X6AH 5LHY1 4ZRZA 1T9HA 1O78A 1PTOH 4PMCA 3HOXH 1TIID 5E3FA 2Q8TA 5M5YB 1TKWB 4KY6A 4KD3A 1Z6HA 3OWEB 4JI3L 4TRDA 4KKSA 3BZDB 3A55A 4IUVA 1K3BC 2MFIA 2B63B 2A8VA 1QOHA 4YWKA 1HNWL 2UXDL 5ELOA 1AW7A 3S1RH 5KYIA 1PTOF 3D6WA 1Y1WG 4DR4L 1XXGA 5IP9G 1SE3A 2PI2A 4LFCQ 3F2BA 2O2LD 5M3FB 4WRDA 3SEBA 3JAML 2XSCA 2FJ2A 4CJ0B 3EQLC 3CHBD 4DV5L 2A6HC 5I2YA 4A76A 1K9MC 4A3LG 4DK6C 1F9RA 1VMCA 5IT9c 1GUTA 1D7QA 3JC66 1F2YA 1KIXA 5KYLA 4A3GH 3PO2G 4A3MH 3ZJYC 2VQEQ 3V96A 4X64L 3OTOL 4BY1B 2Q2IA 3CF5A 3E0JA 2YU9B 5GAEC 2K33A 2IW3A 2VB2X 4IUUA 3SXHA 3G48A 1Y14B 1EFWA 1VQFA 3RNUA 4KY7A 3K5MA 5D65A 2ZM6Q 3TQYA 2R7ZH 5DM63 4AQYL 4A3GB 3FPUB 1HNWQ 4HMIA 1J5EQ 4A3CH 5G3LD 1AN8A 4R4TA 3T56B 1UE1A 4DUZL 1PH3A 1IYJB 1RTNA 1AP0A 1WVLA 3G6EA 3J7AV 4OX9L 2F4VQ 3OIQA 4L5TA 3T1HL 5C4ZA 1RD9D 2B2YA 4R4OA 3F1ZA 2QILA 2KJXA 3ULLA 4OX9Q 3GTMB 2KVMA 3H91A 1DM0B 1SLJA 4QIWB 4P74A 3N6RA 2OCEA 2UU9Q 1Q8IA 1KTKA 2NVTH 2EYFA 1JQYD 1G51A 5T1GA 2GA4B 1ZKOA 2C9OA 3VDYA 2HIXA 3P20A 4C3JH 1JB7A 4M8AA 2E5LQ 4DR4Q 5A35A 5IOCA 3S1RB 2ZXPA 3KBXA 2B8FA 3K6OA 3SK6A 1Y1VB 2EDGA 2UU9L 2PNHA 2F0GA 4DAMA 2AWNA 2RSNA 4LF4Q 4DAYA 5FK9C 1GHKA 4JI1Q 1I4PA 1EY5A 4L5QA 4RH6A 4DV1L 2R92B 1OO9B 3FVQA 2AHOB 1AFPA 4ZLTF 2L9HA 4J8QA 2JA8G 5EPKA 4GS3A
chains in the Genus database with same CATH topology
5C4HA 2NVYB 2L55A 3E6ZX 3URYA 4DNRB 1PLFA 1ESRA 1EYDA 1D5XC 4K5VA 3VR3A 3SHLA 2OF1A 4C3IG 3NSWA 3RD4A 2B2UC 5I9PA 3DWAA 4KY5A 2CW0C 1SFOB 3H09A 1TY0A 2OT2A 1TS3A 3CQZB 3PUVA 5ELEA 3MVVA 1TT2A 4IZ8A 3V2TA 4KJNA 1DD2A 3J80L 5ELFA 2NTTA 1I3QB 3M4OB 1CQVA 4CJ1B 2X6GA 2DY7A 3I8ZA 1EY4A 3HOZB 3L7ZC 2BOSA 3WOEA 2I46A 3MA2B 4IFDH 3IL8A 1D5ZC 2K1BA 3FRPB 4C2MB 1AZPA 5I4DA 4KV6A 2QKIC 4L6TB 1QCBD 1U4MA 2R6GA 1GUOA 3DWQA 1U4PA 1HA6A 3VYTA 3T53B 1WTQA 1SNPA 1PZJD 1UEAB 3R2TA 2TMPA 4G7OC 3K5OA 1TVXA 2L4NA 3CRKC 5EKKA 3VR6A 2RQXA 1EY9A 4C1NK 2HCCA 1EL0A 3K57A 3R93A 2E74C 3PIO3 5C4JB 3KF8A 4KD4A 1TU2B 3M4YA 5FLXL 3C46A 1TWAB 3DHQA 2IX3A 2NB0A 1TS4A 1AEXA 1RKNA 2F0VA 1IKLA 2M00A 3K58A 1NSNS 2E2IB 1PXUA 5J22A 5KRUA 3SK4A 4EVOA 2EJGC 1LTGD 2G9DA 5JVG3 3WDNA 5EPLA 2OEOA 2B2VA 2L11A 2E2HB 4ZK9B 2KECA 2F4IA 3GTPB 4KN7C 4DA2A 3MC0B 2L5TA 1G291 3NK9A 3QIAA 1LV9A 1EQVA 1FNVA 3TP5A 2K01A 5KNDA 5EQ0A 4WORA 5E4XA 5D3IB 4K8JA 3BVZA 1FR3A 1Z7TA 3S1QB 1DOMA 3EFXD 3TMEA 1RCVD 2F0HA 5KIXA 1Q1EA 3GO5A 2L0CA 5JEAG 1F9QA 3X3NA 1WTVA 1EY7A 1XX8A 2EOTA 1SYCA 1BOSA 3OSOA 2RBMA 3VR5A 4TKOB 3TZUA 1STNA 3TSSA 3I73A 1KDBA 1TWCB 4TQUS 1DOLA 1K83B 4JBWA 2B2UA 1X32A 3W3AA 4ILWA 3NBHA 3W2DA 4K8IA 2DY8A 2WIIB 1CT1D 1Y8PB 1D6EC 2MGSA 3KK7A 5EKIA 3C1EA 1S5CD 5K5PA 4C3HB 4Z9CB 4ZYSA 5IGFA 1TWGB 4ULLA 1SJED 1F9PA 3RLFA 3OWFA 1BO0A 2XRSD 3ND8A 2LFNA 4IFDI 3BVGA 2SEBD 1UAPA 2JA5B 5IGCA 5C0XH 2F0DA 2ICIA 4UAIA 1HXYD 4S3SA 1PZID 5M9OA 2KCNA 1CA6A 1BXTA 3IFDA 2IWHA 4ZUIA 2M2LA 3D3RA 1EWHA 3IKJA 2XVSA 3Q6SA 4OGQC 1A3VA 1Q3LA 3HOUB 2JE6I 1WTXA 2YYZA 3I72A 1GUNA 5CV7A 4IURA 4X3TA 1HFNA 3BVMA 2PW7A 4H7BA 1EY6A 1WTPA 1OXSC 5IGBA 1LTSD 2LKVA 2DNEA 4ME5A 1U4LA 4RKLA 3M3YB 2O5IC 4H0LC 3J81L 3DEPA 2VXWA 1NUCA 2F0UA 1TS2A 2R61A 4B08A 1S5ED 1YNNC 1G2SA 1AZQA 4KHZA 3A8JE 4NMZA 1OXTA 5M3MB 5LL6S 4FO2A 1GUGA 1VF5C 1GOZA 5C44B 2AUKA 2CQAA 2XN9C 1XWEA 3G7LA 4HAEA 2XIWA 1PTOD 4C3JB 2NVTB 4G7HC 1STBA 1PFBA 3HEJA 3MZ5A 2NN6G 2VNUD 1LACA 4P2CB 3S14B 1Y1WB 2J7ZA 4ODGA 2SNMA 4BBRB 1SYEA 1GXDC 1OXXK 1DXMA 2HQEA 5JVH3 1D1KA 1BF4A 4C3HG 3A56A 3BYTB 4KI0A 4R9WA 4RHSA 5BN3A 4N9PA 5C0XI 3DUZA 5I2XA 2BE5D 1O80A 3GTOB 3C2PA 4RFBA 4CKBA 2F0EA 4MIUA 2BDOA 1PYWD 1F2MA 1Q12A 3K5NA 1E2VA 1LT5D 2V4DA 1GJXA 2NN6H 1Q90A 2F1MA 5CV8A 1MSGA 5A2QE 1RTOA 4HSVA 4A3FB 3J80E 2FMCA 2F0PA 3S1MB 1B4OA 2AQ3B 1EU4A 2F0LA 1EEFD 3TP6A 3FKIB 1EY8A 2EY1A 3O13A 3F2UA 3K0YA 1A2TA 3IFTA 1B50A 1LO5D 2B2WC 1CZWA 1UUPA 2E76C 1DCZA 2JYOA 1HCZA 4A3IB 2F0KA 4OIJA 2WB1B 1I6HB 4F7XA 4WFN3 2Y0SB 4OO1G 2O4XA 2K7VA 1C4QA 4Y7NB 1L0YB 1YNJD 3OMGA 1JWMD 4U68A 4B9WA 2FMMA 2MJ8A 2BA0A 2IL8A 3NWSA 5CV6A 1FNWA 1LTBD 1W6KA 4FVMA 1Y8NB 3OOCA 4FF1A 5JOBA 1WD0A 2K5DA 2WAQB 2F0NA 5EKLA 4ID6A 2KA7A 3EROA 1ET9A 3HP3A 5CV9A 5K36H 3ND9A 2RSOA 2EY6A 2SOBA 3EVQA 1Y69U 5ISRA 1F2LA 5COYA 2MPMA 1LTAD 2JP1A 4KMUC 2B2VC 2EYHA 1B44D 3KLSX 4HMJA 2HDLA 3K5LA 3K7AB 3ZYYX 3NQTA 1B2TA 3NTIA 3R2IA 4NW2A 3D4DA 3PUYA 3S9WA 5CV5A 3QO2A 1CQFA 2IX0A 3CU7A 5TSSA 1LLRD 1D1IA 2CHBD 5C0XG 4ZAIA 2F0QA 4DGZA 2PNRC 4KN4C 4J6HA 4DK1A 4J1MA 2WP8J 1EQTA 4KTAA 4EQOA 1I4HA 3LWEA 3BS1A 2MUYA 2MHVA 2KOLA 3HGBA 4A3MB 1CK1A 1HTLD 5K36G 5EJWA 5CBEE 4QF4A 3D6CA 1PRTD 5CMDA 2ENBA 1JCKB 2JA7B 1GUSA 4OHJA 3D8GA 4N9TA 3A54A 1QNUA 1HA5A 4H44C 3QOJA 4M1UB 1SAPA 3T4AC 3Q23A 2BE5C 1B53A 3ITPA 1SXTA 1WD1A 2I07B 1QE6A 2A6EC 1SE2A 4KHVA 1CZGA 2RDFA 3I70A 1SJHD 3I4LA 3H94A 4BS9A 2F03A 1A2UA 4XQNA 3M7GA 1R9TB 2PPBC 2A68C 1JB3A 1H9RA 2A74C 1FNUA 3E5SA 1I6VC 3HG9A 4IUTA 2PZUA 1SSOA 5ELBA 2EYLA 1I4XA 4DXFA 3MXUA 4WJWA 2DNCA 2BA1A 1LTRD 1IL8A 2PW5A 5CYUA 2QEJC 1GHJA 3RUZA 4XXEA 4K5WA 1SYBA 1ZEQX 1O7YA 2K04A 1ZYRD 5C4XB 1BQQT 3SK8A 3MEHA 1PRTC 4C1NI 5HGTA 1G6ZA 4RCOA 3PUZA 1PDQA 1KLGD 1NR4A 1BDOA 4EQNA 4EQPA 2L1BA 1W6JA 5C0XJ 4QUCA 2BDNA 1PRTB 4LAAA 2TSSA 3BDLA 3D31A 1PFMA 4K5XA 4IFDG 1RHPA 2JEAI 5A2QL 1EOTA 4IFDJ 2Z8LA 1KDAA 2C5CA 3T13A 5C5LA 4FF2A 2R7ZB 1I4RA 3IAYA 3NTKA 2ZXRA 4OO1H 4U673 4HN7A 3MAQA 3S17B 2D2CC 4DN4M 3VYUA 5CORA 5EBDA 1ZXTA 2F0FA 4IUNA 1G2TA 3NP8A 2KQ3A 1LTID 3NXWA 1TY2A 3DEOA 1J8IA 1OXUA 1EU3A 1KDCA 4I65A 3VA7A 4XT3B 1C48A 1DOKA 1HUNA 2QDBA 4A3EB 1KNEA 2PCFB 2JEBI 5C6AA 2QF7A 2B2YC 1F9SA 1PTOB 3LWUA 5IGEA 1U9RA 1EZ6A 2CVRA 1IKMA 5JPNC 1SMYC 3GD7A 3HKZB 5EGTA 4ZKBB 1CA5A 4BBSB 3ERQA 4NP5A 5I6YA 2EYMA 1QNKA 4G4KA 2XWJB 2EE1A 1R4QB 2E2DC 1CM9A 1SYGA 4AYBB 5CGKA 1QG7A 2K32A 4QUFA 3TP8A 4PNYA 2H4OA 5AFWA 3HRZC 4G7ZC 3RZOB 2WACA 1IW7C 1B3AA 1Z47A 4L8JA 1BCPD 1KNAA 1HQRD 2G9HD 1S5FD 3KLRA 3MXGA 5M5XB 4QCLA 1CHPD 3P7JA 2AQ2B 1EY0A 3D4WA 2Z4IA 2Z4HA 1RODA 2EPBA 2LS01 4CKEA 3AU7A 5F2DA 1WTOA 5I6WA 2A5HA 2IJ0A 5NUCA 3J7AF 3TP7A 1JR0D 4QB4A 3QB3A 1TS5A 2K5QA 2NYZD 2KCCA 1K8MA 1V1PB 1V1OA 3J7YW 3R3OA 4RWSC 1XYIA 1SE4A 4DU9A 1QB5D 1ILPA 4RKBA 3DM1A 1BCPC 4XDXA 2HDMA 2K28A 4IQZA 2K6AA 5JJZA 3MFGA 1BCPB 3GV3A 3H0GB 1CFMA 2A68D 2F0TA 4ZKCB 2PZWA 5IT9E 5IODA 2QCPX 4OIKA 2MP1A 4DXGA 1PMRA 2AWOA 5BN5A 4X3UA 2FHTA 1FYCA 4A3JB 3AB9A 4C3JG 2EY5A 4L63B 4HSPA 4ZQ3A 1I50B 3M85A 2ID0A 3V05A 3NQIA 1HTPA 5KGUA 3BDCA 1E0BA 3SK5A 2LMCB 3Q0AA 1Y8OB 2ZT9C 2K05A 3H6MA 3DMUA 1O7ZA 2VB3X 5J39A 3HZXA 4LMQD 1SNCA 1BBXC 4PQXA 1MGSA 1WTWA 1TWHB 4FXDA 2R93B 1SNOA 2NZ1D 3SDZA 3GQBA 2D9UA 1HFGA 1T5EA 4HCEA 3OW7A 5JPMC 1BR9A 4FYDA 3I3CA 1EWCA 1STAA 2B2TA 1L0XB 1HHVA 4CGYB 3WOFA 2IT1A 4X3SA 4A3DB 3S2DB 2J0TD 1U4RA 4XTCS 2EYPA 1D5MC 3R8BA 5C3EB 1T5XD 4JK1C 2HCIA 4R8IA 2IPKD 5C3WA 5LL6X 4RGNA 3OHXC 3C3LA 4K2KA 4O1NA 1TQOA 3J81E 1JWUD 3K59A 4NDXA 2XNAC 2NN6I 3QG1A 1HRJA 2D5DA 4NKLA 1IYVA 4HTHA 3RMHA 3MXNA 3PV0A 4RHRA 4IN3A 4YIJA 4KKTA 3BYYB 2NTSA 4B9XA 4Q0FA 4DNTB 5ELCA 3NHHA 4I7ZC 2ICEC 2E2JB 2NUCA 1PZKD 5KNBA 1J9OA 3A7AB 5IGGA 4BA1I 1STEA 1FGBD 1KAAA 2A6ED 2AUJD 2H1EA 1ESFA 4O42A 5EPJA 3NE5B 1G91A 1O7LA 2RA4A 4DFAA 3EJIA 2VUMB 5G3LF 5C3XA 3QJYA 3N52A 3TDQA 1WTRA 3RZDB 1S5BD 4KKUA 1D2BA 3S16B 2RKSA 2RDHA 5IIFA 3MWYW 4IUQA 1HPCA 3CRLC 4A3BB 1LT3D 5IT9L 1LTTD 4FP5D 5CC4A 4H13C 1A3UA 2M9VA 5ELDA 4QMGA 5DEHA 5M5WB 3Q22A 2FFKB 1YNND 2NVQB 3HOVB 3PUXA 4PMWA 1GUWA 1LABA 1JOQA 3G6JB 3LNNA 3A8KE 5D3DA 3KLSA 1YNJC 1ZYRC 1CI3M 1H9KA 2HUGA 1ONLA 3D4RA 3GP7A 2DN8A 3S2HB 1F2ZA 1QWYA 1B1ZA 4EGVA 4FNFA 4RCNA 4HR7B 2JA8B 4FXKC 4LJZC 3SVMA 2KUMA 4K14A 3MTSA 3MHBA 4GZYC 5EBCA 3NPPA 4FF4A 1B9NA 2EVBA 2A69C 4C3IB 1FD7D 4PV1C 4X3KA 4LK1C 5T1IA 4V0BA 3P1HA 2D62A 1ICWA 3VR4A 4RGMA 4DAVA 1LT4D 3FPPA 1CHQD 4RA8A 3PIP3 2IX1A 2EZVA 1ENCA 2NVXB 3Q24A 1S4ZA 3GTGB 2B39A 3L9AX 2WINB 3FDTA 1R4PB 4IALA 1JE4A 1C8CA 3VR2A 4ABNA 4XYQA 4DF7A 3CKIB 2R3ZA 3T51B 3NTHA 1QJOA 2EYOA 3MFYA 4DK0A 2SDFA 3I90A 3LX0A 1G8ZD 1V8QA 2NWGA 5HURA 2F0WA 1STYA 3KBGA 5KEEA 2Q8IB 3HS0C 2BCOA 3T16A 3GV6A 5J1ZA 3OPOA 3DXJC 2OXPA 5DM73 4FF3A 1VMPA 1F77A 5KNCA 1H9SB 3GTLB 1JORA 1II3A 2PO4A 1SBBB 3NBIA 2XRQD 2A73B 3VYSA 1BNZA 3TZDA 3VA5A 1MBYA 1H9JA 1MD2D 1EEID 1KABA 5FKAC 1TR5A 4Q5VA 5CV4A 2L12A 2WKCA 1SYFA 1E2WA 3DWPA 2EJFC 2PQEA 3C1FA 1ML0D 4TSSA 1JICA 3TN2A 4E6IA 1RDPD 3I91A 3L3OC 1SEBD 2F0JA 1ILQA 4G57A 1V43A 2F0IA 1CTMA 4PMBA 5E1FA 4MN3A 2N88A 4IUPA 4DAPA 3FMCA 1ENFA 3GTQB 3OIPA 1DYQA 3M7NA 1NR2A 3PMFA 4CJ2C 1SNQA 5BN4A 5DAUA 2X69A 1BUVT 3MXPA 1IHZA 4MHEA 2KHSA 3S1NB 1LT6D 4HCSA 2B8GA 3U9OA 4HEDA 2XWBB 5C5MA 2SNSA 1H9SA 4XT1B 2Q8RE 4A93B 1EZ8A 2F0SA 2PMZB 1DJRD 3HOXB 1A6XA 4XQJA 2KEEA 4BY7B 4UDUC 5E4WC 1DZ1A 2NBFA 5CBAE 4XQQA 4C56C 3FEWX 4RAUC 1I4QA 1PRTF 1H9MA 1I4GA 1MI2A 1MSHA 2F0OA 3KUPA 5FO7B 2A6HD 5DNFA 1BCPF 5CR3A 1X3QA 4RGTA 1X3PA 4CBVA 2ZXOA 3QWNA 3SE0A 4KJOA 4F87A 5JEAJ 3TBIB 5FLXE 1JWSD 3U9SA 2F3VA 4CHTB 1E2ZA 4XYOA 4FXGC 1NCVA 2Z1CA 4K2LA 1SDFA 1QILA 2EY2A 1NAPA 1EIGA 3QOLA 2EYJA 2PZTA 3GTKB 2JA6B 2K5WA 1M4VA 4CKCA 2F0MA 1S5DD 1OXVA 1VF7A 1EIHA 4BA2I 1K8OA 2O5JC 2JSOA 2RDGA 3BG3A 5IGDA 2WV6D 1SNMA 5D14A 3PO2B 3NWTA 1A3TA 2F3WA 2A69D 1XTCD 1A15A 3A7LA 2B2WA 1WCMB 4BWGB 3HOWB 2E75C 2N55A 4R8NA 2K03A 4RGOS 3HOYB 1RF2D 2PYKA 2FINB 1KLUD 3BDOA 1ET6A 3SR1A 1HQMC 1TWFB 2B2TC 5JAVA 3EA6A 1PFNA 1HUMA 3AMUA 2EXZA 2RVLA 2CW0D 1SMYD 2AQ1B 3I4NB 2X6LA 4ZUJA 4OL7A 1JC7A 2WKDA 1JOOA 5FO9B 1SYDA 2LY7A 3I4MB 1M8AA 1SNDA 1EFID 3OMCA 1STGA 4KK7A 3JAME 1IYUA 1STHA 3X3MA 5JEAH 3P75A 3NUCA 1RJTA 1IW7D 4V190 4XIGS 1EYCA 4A3KB 5FOBB 3PUWA 4F8MA 3GTJB 3A8IE 3ONAB 4K6LA 3H3VC 2JXMB 3S15B 1V1PA 2KEDA 4F88A 3PO3B 1VCIA 1VDZA 1UNSA 5FO8B 4K6DA 3UI2A 2J4XA 2EJMA 1PTOC 1ENAA 1JOKA 1Q1BA 1EYAA 3VYRA 1B9MA 5I9OA 1DONA 5LHY1 4ZRZA 1O78A 1PTOH 4PMCA 1TIID 5E3FA 2Q8TA 5M5YB 1TKWB 4KY6A 4KD3A 1Z6HA 3OWEB 4TRDA 4KKSA 3BZDB 3A55A 4IUVA 2B63B 1QOHA 1AW7A 5KYIA 1PTOF 3D6WA 1XXGA 1SE3A 2O2LD 5M3FB 4WRDA 3SEBA 3JAML 2XSCA 2FJ2A 4CJ0B 3EQLC 3CHBD 2A6HC 5I2YA 1F9RA 1VMCA 1GUTA 1F2YA 5KYLA 3V96A 4BY1B 3E0JA 2YU9B 2K33A 2IW3A 2VB2X 4IUUA 3SXHA 4KY7A 3K5MA 5D65A 5DM63 4A3GB 3FPUB 4HMIA 5G3LD 1AN8A 3T56B 1RTNA 1AP0A 1WVLA 3J7AV 3OIQA 5C4ZA 1RD9D 2B2YA 2QILA 2KJXA 3GTMB 2KVMA 3H91A 1DM0B 4QIWB 3N6RA 1Q8IA 1KTKA 2EYFA 1JQYD 5T1GA 2GA4B 1ZKOA 2C9OA 3P20A 4M8AA 5A35A 5IOCA 3S1RB 2ZXPA 3KBXA 2B8FA 3K6OA 3SK6A 1Y1VB 2EDGA 2F0GA 2AWNA 2RSNA 4DAYA 5FK9C 1GHKA 1I4PA 1EY5A 4RH6A 2R92B 1OO9B 3FVQA 1AFPA 4ZLTF 2L9HA 4J8QA 5EPKA 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFN A;  2FMC A;  2K6A A; 
#chains in the Genus database with same CATH topology
 5C4H A;  1XMO Q;  2NVY B;  4LF4 L;  2L55 A;  1JJC B;  3RZD H;  3AFQ A;  4DNI A;  3E6Z X;  3URY A;  4DNR B;  4DV4 L;  3H3V H;  1UE7 A;  1PLF A;  1ESR A;  2UUC L;  2HD3 A;  1EYD A;  1D5X C;  4K5V A;  3VR3 A;  3GDE A;  3SHL A;  3PF5 A;  3W1B A;  2OF1 A;  3NEL A;  3J80 i;  4C3I G;  1AE2 A;  2ATW A;  3NSW A;  3UDX A;  2JA5 H;  1MJE A;  3RD4 A;  2B2U C;  2I5H A;  5I9P A;  3DWA A;  2CH4 W;  4KY5 A;  2CW0 C;  1SFO B;  3H09 A;  1TY0 A;  2OT2 A;  5FJ8 G;  2DJF C;  4YHH L;  1TS3 A;  3CQZ B;  2FXQ A;  3PUV A;  2UUB L;  5ELE A;  1N36 L;  3MVV A;  2WAQ G;  1TT2 A;  4IZ8 A;  3V2T A;  1VQ8 A;  4KJN A;  1VQD A;  4MZ9 A;  3E3X A;  1HR0 W;  1DD2 A;  3J80 L;  2Z9H A;  4DV2 Q;  1GO3 E;  5ELF A;  3J81 i;  1FVI A;  2NTT A;  1I3Q B;  3ICE A;  3M4O B;  3PF4 A;  1CQV A;  1DGS A;  4OWT B;  4CJ1 B;  4P71 A;  2X6G A;  2DY7 A;  3I8Z A;  1EY4 A;  3HOZ B;  4JV5 L;  2YU9 H;  4B3T Q;  3L7Z C;  1XNR L;  2BOS A;  2UUA Q;  1EOV A;  3RLN A;  4HJ5 A;  3WOE A;  2I46 A;  3MA2 B;  4IFD H;  3IL8 A;  1IZ6 A;  1D5Z C;  2K1B A;  3CD6 A;  2VZA A;  3FRP B;  4C2M B;  2K52 A;  5I4D A;  1AZP A;  1C0A A;  4KV6 A;  2QKI C;  4L6T B;  3PIO A;  4JI8 Q;  1QCB D;  4JC0 A;  1U4M A;  2R6G A;  1GUO A;  1TWF H;  3DWQ A;  1U4P A;  1HA6 A;  3VYT A;  1JMC A;  3A5U A;  3T53 B;  2GVA A;  2K5N A;  1WTQ A;  1SNP A;  1NNX A;  1PZJ D;  1UEA B;  2ZTC A;  4A3M G;  3R2T A;  4UPA A;  2TMP A;  4G7O C;  1SMX A;  3K5O A;  3L0O A;  4A3K G;  1IBK L;  4P75 A;  1TVX A;  2L4N A;  3CRK C;  5EKK A;  3VR6 A;  4DV5 Q;  2RQX A;  1EY9 A;  4C1N K;  2HCC A;  1EL0 A;  2RCF A;  3K57 A;  3R93 A;  2E74 C;  3PIO 3;  2XGT A;  5C4J B;  3KF8 A;  4KD4 A;  4DV3 L;  1TU2 B;  3M4Y A;  5FLX L;  4JYA Q;  3FP9 A;  3C46 A;  1TWA B;  3DHQ A;  2IX3 A;  1LYL A;  2NB0 A;  5EAY A;  1TS4 A;  4DR3 L;  1AEX A;  1RKN A;  2F0V A;  1PFS A;  2P5Z X;  1IKL A;  3HOU G;  2M00 A;  5FLM G;  4HJA A;  3K58 A;  4A3D H;  1NSN S;  2E2I B;  1NE3 A;  1B70 B;  1PXU A;  5J22 A;  2E2I H;  3J80 c;  5KRU A;  1BKB A;  1Q82 C;  4LUZ A;  3ULJ A;  4HIO A;  4NXN L;  1HJP A;  3SK4 A;  3W1G A;  4EVO A;  3I4O A;  2EJG C;  1LTG D;  2G9D A;  2R93 H;  5JVG 3;  3WDN A;  5EPL A;  5IYC G;  2OEO A;  2B2V A;  4YCU A;  1YHB A;  1J5E L;  4JYA L;  2L11 A;  1YIJ A;  5C4J H;  2E2H B;  4ZK9 B;  2KEC A;  2F4I A;  3GTP B;  4KN7 C;  2E5L L;  2E8G A;  1VQK A;  4DA2 A;  3MC0 B;  1E1O A;  4BXX H;  2L5T A;  1G29 1;  3K80 C;  3NK9 A;  3QIA A;  1LV9 A;  4A3F G;  2HT1 A;  1EQV A;  3FHW A;  3CXC A;  1WFQ A;  1FNV A;  3TP5 A;  2K01 A;  4GN3 B;  1HH2 P;  4DKA C;  1FJG L;  5KND A;  5EQ0 A;  4MTN A;  4WOR A;  5E4X A;  3FKI G;  4CDE C;  5D3I B;  4K8J A;  3J81 c;  3BVZ A;  1FR3 A;  1Z7T A;  3S1Q B;  1DOM A;  3EFX D;  5M3M G;  3TME A;  1RCV D;  2F0H A;  4DV0 Q;  1YVC A;  1K28 A;  5KIX A;  1Q1E A;  4Y52 H;  1ICF B;  1K3R A;  3GO5 A;  3I4N H;  2I5L X;  2L0C A;  5JEA G;  1F9Q A;  1PHJ A;  4QJF A;  3GTQ H;  3X3N A;  1WTV A;  1EY7 A;  1XX8 A;  2EOT A;  1SYC A;  1BOS A;  1PH7 A;  3OSO A;  2RBM A;  4UP9 A;  3VR5 A;  1XPU A;  4TKO B;  3TZU A;  1STN A;  3TSS A;  3I73 A;  1KDB A;  1KHI A;  1TWC B;  4TQU S;  2QEX A;  3HOW H;  1DOL A;  1K83 B;  1N36 Q;  4JBW A;  3RLO A;  2B2U A;  3W3A A;  1X32 A;  3K81 C;  4ILW A;  3NBH A;  3W2D A;  4BBS H;  1N33 Q;  3ERS X;  5GAD C;  4K8I A;  4BBR H;  2DY8 A;  2WII B;  1CT1 D;  1Y8P B;  1D6E C;  2MGS A;  3KK7 A;  3RR5 A;  4DK3 C;  3UDF A;  5EKI A;  1N33 L;  3C1E A;  4DUY Q;  5IP7 G;  1S5C D;  4LF5 L;  5K5P A;  3HKS A;  4JI7 Q;  4C3H B;  4Z9C B;  2CQO A;  4ZYS A;  5IGF A;  1XPR A;  4A3J H;  1TWG B;  1EIF A;  4ULL A;  4JI6 L;  1SJE D;  1F9P A;  4IO9 A;  3RLF A;  3OWF A;  1X3G A;  4POG A;  1BO0 A;  2XRS D;  4LW1 A;  3ND8 A;  3GTL H;  3HOW G;  2LFN A;  4IFD I;  3BVG A;  2SEB D;  3RZO H;  1UAP A;  2JA5 B;  5IGC A;  5C0X H;  2F0D A;  5LMN Q;  2ICI A;  1E24 A;  4UAI A;  1HXY D;  4S3S A;  2UXD Q;  1X55 A;  1NTG A;  1PZI D;  3PSI A;  5M9O A;  2EXD A;  1X3E A;  2KCN A;  4LF9 Q;  1CA6 A;  1BXT A;  3IFD A;  2IWH A;  4YCW A;  4DAY B;  4ZUI A;  2M2L A;  3I4N G;  1YNX A;  4QL5 A;  3D3R A;  2IY5 B;  1EWH A;  4AYB G;  3IKJ A;  2XVS A;  3Q6S A;  4OWW B;  4OON A;  3A0J A;  4OGQ C;  3U4Z A;  1A3V A;  1Q3L A;  3CAM A;  3HOU B;  1B8A A;  2JE6 I;  3I4M G;  1K73 C;  2ZJR A;  4O2D A;  1KAW A;  1WTX A;  2YYZ A;  3I72 A;  1GUN A;  5CV7 A;  4IUR A;  4X3T A;  2YTX A;  1HFN A;  3KOJ A;  3BVM A;  2PW7 A;  1BVS A;  4H7B A;  3CQZ H;  1EY6 A;  1WTP A;  1OXS C;  5IGB A;  1HR0 L;  1LTS D;  1VS0 A;  4DR7 Q;  2EIF A;  2CKZ B;  2LKV A;  1XNQ L;  2DNE A;  2OTJ A;  4R4C A;  4ME5 A;  3SGI A;  3BU2 A;  1U4L A;  4RKL A;  4LUV A;  2UXC L;  3M3Y B;  2B63 H;  2O5I C;  4K0K L;  4H0L C;  1S3O A;  3J81 L;  3DEP A;  2VXW A;  1NUC A;  2F0U A;  1S40 A;  2JK8 A;  1TS2 A;  2R61 A;  4B08 A;  1S5E D;  1YNN C;  2JA9 A;  1G2S A;  2KCM A;  4GKJ Q;  1AZQ A;  3PO3 G;  4KHZ A;  4DR3 Q;  1VQI A;  4NMZ A;  3A8J E;  1OXT A;  5M3M B;  4GNX A;  5LL6 S;  3OW2 A;  1R9T H;  4FO2 A;  1L1O A;  3H0G G;  1GUG A;  1VF5 C;  1GOZ A;  3AYH B;  5C44 B;  3HKZ E;  2AUK A;  2RCN A;  1HNZ Q;  2CQA A;  2XN9 C;  1XWE A;  3G7L A;  4HAE A;  4A3E H;  2XIW A;  1PTO D;  1LTL A;  4C3J B;  1GM5 A;  1K8G A;  4DR1 Q;  2NVT B;  4G7H C;  1STB A;  1PFB A;  1IBM Q;  2VUM G;  1WCM G;  3GTM H;  1VQE A;  3HEJ A;  3I55 A;  3MZ5 A;  2K4K A;  3KF8 B;  5JJL A;  2NN6 G;  3T1Y L;  2VNU D;  4DPG A;  1EYG A;  1LAC A;  4P2C B;  1N8R C;  3S14 B;  1Y1W B;  2ZJP A;  2J7Z A;  4ODG A;  2SNM A;  4P72 A;  4BBR B;  1QZG A;  1SN8 A;  1SYE A;  2OTL A;  1GXD C;  1OXX K;  1DXM A;  2HQE A;  5C44 H;  1V1Q A;  5JVH 3;  1D1K A;  1PV4 A;  4JI0 L;  1BF4 A;  3KDF A;  4C3H G;  3A56 A;  3BYT B;  4KI0 A;  4R9W A;  4RHS A;  5BN3 A;  4JV5 Q;  1KXL A;  3T1H Q;  2A1A A;  4N9P A;  2YTV A;  2B3G A;  5C0X I;  3PQI A;  4KHP Q;  3DUZ A;  1JJ2 A;  5I2X A;  2BE5 D;  1Q7Y C;  1VQ9 A;  1O80 A;  3GTO B;  2RHQ B;  3C2P A;  4RFB A;  4CKB A;  2F0E A;  4MIU A;  2BDO A;  3CW2 C;  1PYW D;  5IYB H;  1F2M A;  4DV7 Q;  1Q12 A;  3K5N A;  1ASY A;  1E2V A;  1LT5 D;  2V4D A;  1E22 A;  2NN6 H;  1GJX A;  2I0Q A;  1P8L A;  1Q90 A;  1NMF A;  4PZ8 A;  2F1M A;  5LMN W;  5CV8 A;  1A8V A;  4DV1 Q;  1WCM H;  3M4P A;  4X65 Q;  1MSG A;  5A2Q E;  2PQA B;  2Z6B A;  1RTO A;  4HSV A;  4A3F B;  3J80 E;  2FMC A;  2F0P A;  3S1M B;  1B4O A;  1VQB A;  4JG2 A;  1GD7 A;  5L37 A;  2AQ3 B;  2Q2U A;  1TXY A;  1EU4 A;  4YHH Q;  2F0L A;  4WJ3 M;  1EEF D;  1KRT A;  4A3E G;  3TP6 A;  3FKI B;  1K8A C;  3KJO A;  1EY8 A;  2EY1 A;  3O13 A;  3F2U A;  1A62 A;  3K0Y A;  4YY3 L;  1A2T A;  4EX5 A;  3I4M H;  3JAM i;  3IFT A;  1B50 A;  2K14 A;  1JJG A;  3HKZ G;  1LO5 D;  3GTP H;  2B2W C;  1E3P A;  3K0X A;  1CZW A;  4APV A;  1UUP A;  2E76 C;  1DCZ A;  3TEH B;  2JYO A;  1HCZ A;  3S15 H;  2IHF A;  4HIM A;  4A3I B;  4JI2 L;  2F0K A;  4OIJ A;  2WB1 B;  1MKH A;  3S2D H;  1N34 L;  1HZB A;  1I6H B;  2MO0 A;  4F7X A;  3TRE A;  4WFN 3;  4GNX C;  2Y0S B;  1NBW A;  3HOY H;  4OO1 G;  2B63 G;  2F52 A;  2O4X A;  4OWX B;  2K7V A;  3GTJ H;  1I94 L;  1C4Q A;  2KCT A;  4Y7N B;  4LF9 L;  1L0Y B;  1YNJ D;  3OMG A;  2D0P A;  1JWM D;  4GN5 A;  4U68 A;  4B9W A;  2FMM A;  2MJ8 A;  4IPG A;  2BA0 A;  4N8X 1;  2IL8 A;  3NWS A;  4LF7 Q;  4X66 L;  5CV6 A;  1FNW A;  2VQF L;  4A3B G;  4B3R Q;  1LTB D;  1W6K A;  2NVY H;  4C3H H;  2ALY B;  1A63 A;  4FVM A;  1Y8N B;  3OOC A;  4FF1 A;  5M3F G;  5JOB A;  2UUC Q;  1CSQ A;  1PYB A;  1WD0 A;  2K5D A;  2WAQ B;  1PH8 A;  2F0N A;  5EKL A;  5C44 G;  1S72 A;  4CDF C;  1HZC A;  4ID6 A;  2PQA A;  2KA7 A;  3ERO A;  1ET9 A;  3HP3 A;  1O7I A;  1VQ7 A;  4JPB W;  5CV9 A;  5K36 H;  3ND9 A;  2RSO A;  2EY6 A;  2SOB A;  3EVQ A;  1Y69 U;  4JI6 Q;  4AYB E;  5ISR A;  1F2L A;  3GTK H;  5COY A;  2MPM A;  1LTA D;  2JP1 A;  1IL2 A;  1EQQ A;  4KMU C;  2B2V C;  2EYH A;  1HR0 Q;  4JOI C;  1L0W A;  3BZC A;  1B44 D;  3KLS X;  4JCV E;  4HMJ A;  2HDL A;  3K5L A;  4DV3 Q;  3K7A B;  3ZYY X;  4GLX A;  3J7A 5;  3NQT A;  4AQY Q;  1B2T A;  1XPO A;  3NTI A;  3R2I A;  4NW2 A;  1I6H H;  3D4D A;  3PUY A;  3S9W A;  2PI2 E;  5CV5 A;  1YI2 A;  3T1Y Q;  3QO2 A;  1CQF A;  2IX0 A;  3CU7 A;  3A5Z B;  5TSS A;  1LLR D;  4I7A A;  4X64 Q;  1D1I A;  2CHB D;  3S24 A;  3OTO Q;  3CCL A;  3K7A H;  5C0X G;  4GKJ L;  3KDF B;  4ZAI A;  2F0Q A;  1X54 A;  3S17 H;  1PYS B;  3H0G H;  4DGZ A;  4GNX B;  4DR1 L;  3HOZ H;  3TRZ A;  2PNR C;  4KN4 C;  4LFB L;  4J6H A;  1N32 L;  4DK1 A;  4J1M A;  5IP9 H;  1B3Q A;  2WP8 J;  1EQT A;  3LGJ A;  4KTA A;  4EQO A;  4A3J G;  3CCE A;  3G71 A;  1I4H A;  1UE6 A;  3LWE A;  5M3M H;  3UDI A;  3BS1 A;  2MUY A;  1CSP A;  2MHV A;  1W3S A;  2KOL A;  3HGB A;  5HY6 A;  4A3M B;  1CK1 A;  1HTL D;  4DR2 Q;  5K36 G;  5EJW A;  5CBE E;  2JA6 H;  4QF4 A;  3I7F A;  3D6C A;  1PRT D;  1X56 A;  5CMD A;  2ENB A;  1JCK B;  4BBS G;  3OYY A;  2JA7 B;  3PGZ A;  5M3F H;  4NXN Q;  4IPD A;  1GUS A;  3JAM c;  4OHJ A;  3D8G A;  2HQL A;  4N9T A;  3A54 A;  4IJH A;  3H3V I;  1V9P A;  3H15 A;  2R93 G;  1QNU A;  1HA5 A;  4H44 C;  2MNA A;  3QOJ A;  4M1U B;  3E9H A;  1SAP A;  3T4A C;  3Q23 A;  3WWV A;  2BE5 C;  1B53 A;  3ITP A;  1SXT A;  1WD1 A;  2QDL A;  2I07 B;  4DV7 L;  1QE6 A;  2A6E C;  1SE2 A;  4KHV A;  1CZG A;  1XMO L;  3KF6 B;  2RDF A;  3I70 A;  1SJH D;  3I4L A;  3H94 A;  4BS9 A;  2F03 A;  1A2U A;  2CWP A;  4XQN A;  3M7G A;  1R9T B;  2R92 H;  2PPB C;  2F3I A;  4ZCK A;  2A68 C;  2AMC B;  1JB3 A;  4B3M L;  1H9R A;  1E1T A;  3FKI H;  2A74 C;  1FNU A;  3E5S A;  1I6V C;  2CH4 A;  4AH6 A;  3HG9 A;  4JI0 Q;  4IUT A;  3STB C;  2PZU A;  3S1M H;  1SSO A;  4A3F H;  5ELB A;  2EYL A;  2ZTE A;  3S14 H;  1I4X A;  4JI5 L;  5JJI A;  4DXF A;  2G5D A;  1VQC A;  3MXU A;  4WJW A;  2DNC A;  2BA1 A;  2Y0S G;  4UP7 A;  4YWM A;  1LTR D;  3NEM A;  3BZK A;  1IL8 A;  2PW5 A;  3W5O A;  1QZH A;  5CYU A;  2QEJ C;  1GHJ A;  3RUZ A;  5GAH C;  4XXE A;  4K5W A;  5LMN L;  1SYB A;  2XTI A;  1ZEQ X;  1VQM A;  1O7Y A;  2K04 A;  1ZYR D;  1C7Y A;  2JA6 G;  5C4X B;  1BQQ T;  3SK8 A;  3MEH A;  1PRT C;  5IYB G;  4C1N I;  5HGT A;  1G6Z A;  4RCO A;  3PUZ A;  3EBE A;  1PDQ A;  1KLG D;  1NR4 A;  3CCU A;  1BDO A;  4EQN A;  4EQP A;  2L1B A;  1W6J A;  5IWA Q;  5C0X J;  2V1C C;  2BDN A;  4QUC A;  1PRT B;  4LAA A;  2TSS A;  3UE1 A;  3BDL A;  3D31 A;  1XNQ Q;  1PFM A;  4K5X A;  4IFD G;  1RHP A;  2JEA I;  4DUY L;  5A2Q L;  1EOT A;  4IFD J;  2Z8L A;  4L5R C;  1KDA A;  2C5C A;  4CDC C;  3T13 A;  1CKN B;  5C5L A;  5BR8 Q;  4FF2 A;  2R7Z B;  1I4R A;  3IAY A;  2I5M X;  2R7F A;  3NTK A;  2VQF Q;  1WYD A;  2JJQ A;  2ZXR A;  4OO1 H;  5J3B A;  3HOY G;  4FDB A;  4U67 3;  4HN7 A;  3MAQ A;  3S17 B;  2D2C C;  4DN4 M;  1LM0 A;  1PH2 A;  3VYU A;  5COR A;  3KFU A;  5EBD A;  1ZXT A;  2F0F A;  4IUN A;  1G2T A;  3NP8 A;  2KQ3 A;  1LTI D;  2ZTD A;  3NXW A;  2HHH L;  1TY2 A;  3DEO A;  1QUQ A;  1VQO A;  1J8I A;  5M5X H;  1OXU A;  1EU3 A;  4JI7 L;  4X66 Q;  1KDC A;  3E9I A;  4B3R L;  4I65 A;  4JVZ A;  3VA7 A;  4LWC A;  3E0E A;  4XT3 B;  2CCZ A;  1C48 A;  1DOK A;  1HUN A;  2QDB A;  4A3E B;  5JJK A;  2C35 B;  2VQE L;  1KNE A;  4BY7 G;  2PCF B;  2JEB I;  5C6A A;  2L15 A;  2QF7 A;  2B2Y C;  1F9S A;  1PTO B;  2VS1 A;  3I56 A;  3AQQ A;  2GVB A;  4DV4 Q;  3LWU A;  4GN4 B;  5IGE A;  1U9R A;  1EZ6 A;  3CCM A;  2CVR A;  1IKM A;  2JA5 G;  1YJW A;  5JPN C;  1SMY C;  3GD7 A;  3F2D A;  5IWA L;  3HKZ B;  5EGT A;  4ZKB B;  1CA5 A;  1MJC A;  4ME3 A;  3CME A;  4BBS B;  3ERQ A;  3HFZ B;  4NP5 A;  5I6Y A;  3TS0 A;  2EYM A;  1X65 A;  1QNK A;  4G4K A;  1L1O B;  1HNX L;  2CFM A;  2XWJ B;  1G6P A;  1K83 H;  2EE1 A;  1GKH A;  1R4Q B;  3PO3 H;  2E2D C;  1CM9 A;  2JA8 H;  3DM3 A;  1SYG A;  4AYB B;  5CGK A;  4LFA L;  3U58 A;  1QG7 A;  2K32 A;  4QUF A;  3TP8 A;  1Q46 A;  4PNY A;  3M3Y H;  2H4O A;  5AFW A;  3S2H H;  3HRZ C;  4G7Z C;  5H1S E;  3GTG H;  3RZO B;  2Q2T A;  2WAQ E;  1IW7 C;  2WAC A;  1B3A A;  2OQ0 A;  1Z47 A;  1QVF A;  4JI3 Q;  4L8J A;  1BCP D;  1KNA A;  1HQR D;  5FLM H;  2G9H D;  1N32 Q;  4WJ4 A;  4JBM A;  1TWG H;  1S5F D;  1YJN A;  3F8T A;  3KLR A;  3MXG A;  5M5X B;  4QCL A;  4O0A A;  3S1Q H;  1CHP D;  3P7J A;  2AQ2 B;  1EY0 A;  3CCJ A;  3D4W A;  3AFP A;  1YBY A;  2RF4 A;  2Z4I A;  1FJG Q;  4PG3 A;  2Z4H A;  1ROD A;  2EPB A;  2LS0 1;  4CKE A;  4LF7 L;  3AU7 A;  4A3K H;  2D0O A;  5F2D A;  1WTO A;  5I6W A;  2A5H A;  4BY7 H;  2IJ0 A;  5NUC A;  1HNZ L;  3J7A F;  3TP7 A;  1JR0 D;  2B29 A;  1K0R A;  4QB4 A;  1A0I A;  1TS5 A;  3QB3 A;  1UE5 A;  2K5Q A;  2NYZ D;  2KCC A;  1K8M A;  1V1P B;  2BH2 A;  3U4V A;  1V1O A;  3J7Y W;  3R3O A;  1UWV A;  4RWS C;  1L1O C;  1XYI A;  1SE4 A;  4DU9 A;  1QB5 D;  1ILP A;  4RKB A;  4MTK A;  4A75 A;  3DM1 A;  1BCP C;  4XDX A;  1IBL Q;  4PZ6 A;  4B3S L;  2HDM A;  2K28 A;  4IQZ A;  2K6A A;  5JJZ A;  3MFG A;  1BCP B;  3GV3 A;  3H0G B;  1CFM A;  2A68 D;  3MEF A;  2F0T A;  5IYD G;  2NZH A;  1VQN A;  4ZKC B;  3BJU A;  2PZW A;  5IT9 E;  5IOD A;  2QCP X;  4OIK A;  4YWL A;  2MP1 A;  4DXG A;  1PMR A;  2AWO A;  1EUJ A;  5BN5 A;  4UHV A;  4X3U A;  2FHT A;  1FYC A;  4A3J B;  3AB9 A;  4C3J G;  2EY5 A;  5GAG C;  2N49 A;  4L63 B;  4HSP A;  4ZQ3 A;  1I50 B;  3M85 A;  2QA4 A;  5FLX c;  2HHH Q;  2ID0 A;  2ES2 A;  3V05 A;  1P16 A;  1ASZ A;  3NQI A;  1HTP A;  1YHQ A;  5KGU A;  1PVO A;  3BDC A;  3K7U C;  1E0B A;  3SK5 A;  2LMC B;  3Q0A A;  1Y8O B;  1KL9 A;  2ZT9 C;  4R1J A;  2K05 A;  1I3Q H;  3H6M A;  3DMU A;  4BBR G;  1O7Z A;  2VB3 X;  5J39 A;  3I2Z A;  3A74 A;  4LMQ D;  3HZX A;  2ZJQ A;  1C9O A;  1SNC A;  1BBX C;  4PQX A;  1MGS A;  1WTW A;  1TWH B;  4FXD A;  5C3E H;  2VUM H;  2R93 B;  1SNO A;  4HIK A;  3CPF A;  2NZ1 D;  3SDZ A;  4DR7 L;  3GQB A;  2D9U A;  2Z0S A;  1HFG A;  1T5E A;  4HCE A;  3OW7 A;  5JPM C;  1BR9 A;  1RL2 A;  5AJ3 L;  4JI5 Q;  4FYD A;  1HZA A;  3I3C A;  4UP8 A;  1EWC A;  1STA A;  2B2T A;  1L0X B;  1XNR Q;  4X62 Q;  1HHV A;  4CGY B;  3WOF A;  2IT1 A;  4X3S A;  4GOP A;  4J15 A;  4A3D B;  3S2D B;  2J0T D;  1U4R A;  4XTC S;  2R92 G;  2EYP A;  1D5M C;  1M1K C;  3R8B A;  5C3E B;  1PH1 A;  1T5X D;  4JK1 C;  2HCI A;  4R8I A;  4YY3 Q;  2IPK D;  1I94 Q;  5C3W A;  4DV6 Q;  5LL6 X;  4RGN A;  1N9W A;  1SE8 A;  3OHX C;  3CCS A;  4IOC A;  4K2K A;  4O1N A;  1TQO A;  2QGQ A;  5GRO A;  3J81 E;  1JWU D;  3C3L A;  3K59 A;  4NDX A;  4NXM Q;  2XNA C;  3QG1 A;  2NN6 I;  3M4O H;  1HRJ A;  2D5D A;  2WFW A;  4NKL A;  1IYV A;  1OTC A;  4HTH A;  3RMH A;  4JI4 L;  1NMG A;  4A93 G;  3MXN A;  3PV0 A;  4RHR A;  1Q8K A;  1EIY B;  2LXK A;  2E2H H;  3HOX G;  4IN3 A;  4YIJ A;  1PH6 A;  4PZ7 A;  4KKT A;  1JE5 A;  3BYY B;  2NTS A;  1HZ9 A;  4B9X A;  1IXR A;  1CKO A;  4Q0F A;  3TS2 A;  4DNT B;  5ELC A;  5LMU L;  3NHH A;  4I7Z C;  4B3T L;  2ICE C;  2UXC Q;  4DR2 L;  2NUC A;  1PZK D;  2E2J B;  5KNB A;  1J9O A;  3A7A B;  5IGG A;  3EN2 A;  4BA1 I;  1STE A;  2EQS A;  3DLL A;  1FGB D;  1KAA A;  1YHA A;  2A6E D;  2AUJ D;  2H1E A;  4JBJ A;  1SRO A;  1ESF A;  4O42 A;  5EPJ A;  4A3I G;  3NE5 B;  1G91 A;  1PH9 A;  1O7L A;  2RA4 A;  4DFA A;  3EJI A;  2VUM B;  3HOU H;  5G3L F;  5C3X A;  2R7Z G;  3QJY A;  3N52 A;  4IPH A;  3TDQ A;  1WTR A;  3RZD B;  3CC2 A;  1S5B D;  3KF6 A;  4KKU A;  3HOZ G;  1D2B A;  2GN5 A;  3S16 B;  2RKS A;  1VQA A;  2RDH A;  5IIF A;  3MWY W;  4IUQ A;  1HPC A;  1D8L A;  3CRL C;  3CCR A;  4A3B B;  1LT3 D;  3PO2 H;  5IT9 L;  1LTT D;  4FP5 D;  4DV2 L;  1AH9 A;  5CC4 A;  4H13 C;  2N78 A;  4QIW E;  1A3U A;  2M9V A;  5ELD A;  1Z9F A;  4QMG A;  1PH5 A;  1RIP A;  4IJL A;  4P73 A;  5DEH A;  5M5W B;  2KHJ A;  3Q22 A;  2FFK B;  1YNN D;  4IOA A;  2NVQ B;  1I50 H;  3HOV B;  1NJI C;  3PUX A;  4PMW A;  1GUW A;  1LAB A;  1JOQ A;  3G6J B;  2N3S A;  1Y1W H;  1L2F A;  3LNN A;  2DJG C;  3A8K E;  5D3D A;  1KD1 C;  3KLS A;  4LFB Q;  1YNJ C;  1ZYR C;  2AKW B;  1CI3 M;  1H9K A;  5LMU Q;  2F4V L;  1SRU A;  5IP7 H;  1IBL L;  4B3S Q;  2HUG A;  3K8A A;  1ONL A;  3D4R A;  3L2P A;  3GP7 A;  2DN8 A;  3S2H B;  1F2Z A;  1QWY A;  3IRB A;  1B1Z A;  4R4Q A;  2OWO A;  4EGV A;  4CDD C;  4QQB X;  4A3I H;  2WB1 E;  3EIV A;  4FNF A;  4RCN A;  2ZM6 L;  4BXX G;  4HR7 B;  2JA8 B;  4EQ5 A;  4FXK C;  4LJZ C;  3SVM A;  2KUM A;  4K14 A;  3MTS A;  3MHB A;  4OXP A;  4A3B H;  3J7Z C;  3RN5 A;  4GZY C;  5EBC A;  3NPP A;  4JW0 A;  1KQS A;  4FF4 A;  1B9N A;  2LXJ A;  3J81 j;  1Q81 C;  2EVB A;  2A69 C;  4C3I B;  1FD7 D;  4PV1 C;  1EQR A;  3MXN B;  4X3K A;  4LK1 C;  5T1I A;  4V0B A;  1GVP A;  3P1H A;  2LSS A;  4NB3 A;  4H02 A;  3CP0 A;  4LFC L;  4UY8 C;  3CPW A;  2Y0S E;  4A93 H;  4MNO A;  2D62 A;  1WI5 A;  2KHI A;  1ICW A;  1MHW C;  3VR4 A;  5E7N A;  5BR8 L;  4RGM A;  4A3D G;  4DAV A;  1J6Q A;  1LT4 D;  1BBU A;  3FPP A;  1CHQ D;  5C4X H;  3B6Y A;  4RA8 A;  1YJ9 A;  1X9N A;  1X6O A;  3PIP 3;  2IX1 A;  2EZV A;  2JA7 G;  1ENC A;  4HID A;  3Q24 A;  4L5S A;  2NVX B;  2VL6 A;  1X3F A;  3ER0 A;  3S1N H;  1S4Z A;  1VQ5 A;  3GTG B;  2R7D A;  2N8N A;  4OO1 I;  2B39 A;  3L9A X;  2WB1 G;  2WIN B;  3FDT A;  1R4P B;  4IAL A;  4C3I H;  5DLQ E;  1JE4 A;  4DUZ Q;  1C8C A;  3VR2 A;  3CC7 A;  4ABN A;  4XYQ A;  4DF7 A;  4LNQ A;  3CKI B;  2R3Z A;  5IYC H;  3T51 B;  3NTH A;  1QJO A;  4KLK A;  4X65 L;  3KJP A;  2EYO A;  4LF5 Q;  4K0K Q;  3MFY A;  1YZ6 A;  1MIU A;  4DK0 A;  2SDF A;  3I90 A;  3LX0 A;  1G8Z D;  1V8Q A;  2NWG A;  1CKM A;  5HUR A;  2F0W A;  1Y1V H;  1STY A;  3KBG A;  5KEE A;  1YEZ A;  2Q2H A;  2Q8I B;  3HS0 C;  2BCO A;  3T16 A;  3GV6 A;  5J1Z A;  3OPO A;  1KC8 C;  3DXJ C;  2K5V A;  2OXP A;  5DM7 3;  4FF3 A;  1VMP A;  4OEL B;  1WJJ A;  1F77 A;  5KNC A;  1H9S B;  2JQO A;  3GTL B;  1JOR A;  3CMA A;  1CUK A;  1II3 A;  2PO4 A;  1VQ4 A;  1SBB B;  3NBI A;  2XRQ D;  2A73 B;  3G4S A;  3VYS A;  3STB D;  1W2B A;  4NXM L;  1BNZ A;  2Z6K C;  3TZD A;  3VA5 A;  2YTY A;  1MBY A;  1H9J A;  5GQO A;  3QR8 A;  1MD2 D;  1EEI D;  1KAB A;  5FKA C;  3Q8D A;  1M90 C;  1TR5 A;  4DR5 Q;  4Q5V A;  5CV4 A;  2L12 A;  2WKC A;  1SYF A;  4DR6 L;  5IYD H;  1E2W A;  3DWP A;  3S16 H;  2EJF C;  2MO1 A;  2PQE A;  1U0L A;  3C1F A;  1ML0 D;  4TSS A;  1JIC A;  3TN2 A;  4E6I A;  2K5H A;  2UUA L;  1RDP D;  3I91 A;  4LF8 Q;  3HOV G;  3L3O C;  1SEB D;  3PIP A;  2F0J A;  4BY1 G;  1ILQ A;  1LUZ A;  4JI2 Q;  4BY1 H;  4G57 A;  1V43 A;  4LUO A;  2F0I A;  1CTM A;  4PMB A;  5E1F A;  4MN3 A;  2N88 A;  4IUP A;  4DAP A;  4HJ7 A;  3FMC A;  2PMZ E;  1ENF A;  3CC4 A;  4LF6 Q;  3GTQ B;  4A3G G;  3OIP A;  1DYQ A;  3CCV A;  1FGU A;  2JN4 A;  3M7N A;  3U50 C;  1NR2 A;  3PMF A;  4CJ2 C;  4POF A;  1SNQ A;  5BN4 A;  2Z6K A;  5DAU A;  2X69 A;  1BUV T;  3MXP A;  4C2M H;  1IHZ A;  4MHE A;  4NPS A;  4OEM B;  2A19 A;  4TVA B;  2KHS A;  1YIT A;  3S1N B;  1LT6 D;  4GLA C;  4HCS A;  4RMF A;  2B8G A;  1KRS A;  3U9O A;  1N34 Q;  4HED A;  2E2J H;  2XWB B;  4X62 L;  4LF8 L;  5C5M A;  1IBK Q;  2SNS A;  4JBK A;  1H9S A;  4JI1 L;  1HNX Q;  2DGY A;  4XT1 B;  2VY3 A;  2Q8R E;  1PA6 A;  4A93 B;  1Q86 C;  1EZ8 A;  2F0S A;  2PMZ B;  1DJR D;  3HOX B;  1A6X A;  4XQJ A;  2KEE A;  3AEV A;  4BY7 B;  4UDU C;  5E4W C;  4LFA Q;  2UXB L;  1JT8 A;  1Y1V G;  4R4I A;  4DV6 L;  1DZ1 A;  2NBF A;  5CBA E;  1E7Z A;  4XQQ A;  4C56 C;  3FEW X;  4RAU C;  1I4Q A;  1PRT F;  1H9M A;  5FJ8 H;  1I4G A;  2KBN A;  1B7Y B;  1VQP A;  1I5F A;  1MI2 A;  4JOI A;  1MSH A;  3NBH B;  2F0O A;  3KUP A;  5FO7 B;  2A6H D;  5DNF A;  1BCP F;  5CR3 A;  1SFO H;  1X3Q A;  2KEN A;  4Y7N H;  4RGT A;  4B3M Q;  1X3P A;  4CBV A;  1WOC A;  2ZXO A;  3QWN A;  3SE0 A;  4KJO A;  4F87 A;  3CCQ A;  3RN2 A;  5JEA J;  3TBI B;  5FLX E;  1JWS D;  3U9S A;  4A4I A;  2F3V A;  4CHT B;  1E2Z A;  4XYO A;  4FXG C;  1NCV A;  2Z1C A;  1H95 A;  4K2L A;  2K50 A;  1SDF A;  1QIL A;  1K0S A;  2EY2 A;  3PCO B;  3UDG A;  2NZO A;  2JA7 H;  1FL0 A;  1NAP A;  1EIG A;  1QUQ B;  3QOL A;  3HOV H;  2EYJ A;  3F2C A;  2NVQ H;  2PZT A;  3GTK B;  2JA6 B;  5C4X G;  2K5W A;  1M4V A;  3M4Q A;  4CKC A;  2F0M A;  1S5D D;  1TWH H;  1OXV A;  5M5W H;  1VF7 A;  1EIH A;  4BA2 I;  3NEN A;  1K8O A;  4AIM A;  5HGQ A;  2JSO A;  4KHP L;  2RDG A;  3BG3 A;  2O5J C;  4DV0 L;  5IGD A;  2WV6 D;  1SNM A;  5IY0 A;  5D14 A;  3PO2 B;  3NWT A;  1A3T A;  2F3W A;  2A69 D;  1XTC D;  1A15 A;  3A7L A;  2B2W A;  1CKN A;  5AJ3 Q;  2K75 A;  1WCM B;  4BWG B;  1TWC H;  3HOW B;  2E75 C;  4YCV A;  2N55 A;  4R8N A;  2K03 A;  4RGO S;  1WTH A;  2VW9 A;  3HOY B;  1RF2 D;  2PYK A;  2FIN B;  1KLU D;  3KLW A;  3BDO A;  5ELN A;  1ET6 A;  3SR1 A;  1HQM C;  1TWF B;  2B2T C;  5JAV A;  3EA6 A;  1PFN A;  1HUM A;  3AMU A;  2HIV A;  4GKK L;  2UXB Q;  2EXZ A;  4A3C G;  2IHE A;  2CW0 D;  2RVL A;  1SMY D;  2H5X A;  1IBM L;  4LF6 L;  2AQ1 B;  3I4N B;  4GLV B;  2X6L A;  4ZUJ A;  3GTO H;  4QGU A;  4HJ9 A;  3ULP A;  3M9B A;  4OL7 A;  1JC7 A;  2WKD A;  4GKK Q;  1JOO A;  4ALP A;  5FO9 B;  2BH8 A;  1SYD A;  4JI4 Q;  2LY7 A;  3I4M B;  2UUB Q;  2YV5 A;  1M8A A;  3D0F A;  1SND A;  3UE0 A;  3KYH C;  5IE8 A;  1EFI D;  2ASB A;  4A3L H;  3OMC A;  4RG1 A;  1STG A;  4KK7 A;  3JAM E;  1VQL A;  1AE3 A;  1IYU A;  1STH A;  3X3M A;  5JEA H;  1SR3 A;  4DR6 Q;  4GOP B;  3P75 A;  4DR5 L;  3NUC A;  1RJT A;  1IW7 D;  4V19 0;  4XIG S;  1EYC A;  4A3K B;  1VQ6 A;  1UEB A;  5FOB B;  4GOP C;  4QY7 A;  3PUW A;  1BBW A;  4N8F A;  4F8M A;  4HJ8 A;  3GTJ B;  3A8I E;  1QVG A;  1XTD A;  3ONA B;  2NVX H;  1VQH A;  4K6L A;  2RHS B;  3H3V C;  1VQJ A;  2OQK A;  2JXM B;  1XMQ Q;  3S15 B;  1V1P A;  1VQG A;  2KED A;  4F88 A;  3PO3 B;  1EWI A;  2CWA A;  5M5Y H;  1VCI A;  1NY4 A;  2MQH A;  1VDZ A;  1UNS A;  4JI8 L;  1XJV A;  5FO8 B;  4K6D A;  3UI2 A;  1XMQ L;  1U5K A;  2J4X A;  2EJM A;  1PH4 A;  1PTO C;  4IPC A;  1TWA H;  1ENA A;  1JOK A;  1Q1B A;  1QVC A;  5C3E G;  1EYA A;  2DUD A;  2QW7 A;  3VYR A;  1B9M A;  5I9O A;  1DON A;  4X6A H;  5LHY 1;  4ZRZ A;  1T9H A;  1O78 A;  1PTO H;  4PMC A;  3HOX H;  1TII D;  5E3F A;  2Q8T A;  5M5Y B;  1TKW B;  4KY6 A;  4KD3 A;  1Z6H A;  3OWE B;  4JI3 L;  4TRD A;  4KKS A;  3BZD B;  3A55 A;  4IUV A;  1K3B C;  2MFI A;  2B63 B;  2A8V A;  1QOH A;  4YWK A;  1HNW L;  2UXD L;  5ELO A;  1AW7 A;  3S1R H;  5KYI A;  1PTO F;  3D6W A;  1Y1W G;  4DR4 L;  1XXG A;  5IP9 G;  1SE3 A;  2PI2 A;  4LFC Q;  3F2B A;  2O2L D;  5M3F B;  4WRD A;  3SEB A;  3JAM L;  2XSC A;  2FJ2 A;  4CJ0 B;  3EQL C;  3CHB D;  4DV5 L;  2A6H C;  5I2Y A;  4A76 A;  1K9M C;  4A3L G;  4DK6 C;  1F9R A;  1VMC A;  5IT9 c;  1GUT A;  1D7Q A;  3JC6 6;  1F2Y A;  1KIX A;  5KYL A;  4A3G H;  3PO2 G;  4A3M H;  3ZJY C;  2VQE Q;  3V96 A;  4X64 L;  3OTO L;  4BY1 B;  2Q2I A;  3CF5 A;  3E0J A;  2YU9 B;  5GAE C;  2K33 A;  2IW3 A;  2VB2 X;  4IUU A;  3SXH A;  3G48 A;  1Y14 B;  1EFW A;  1VQF A;  3RNU A;  4KY7 A;  3K5M A;  5D65 A;  2ZM6 Q;  3TQY A;  2R7Z H;  5DM6 3;  4AQY L;  4A3G B;  3FPU B;  1HNW Q;  4HMI A;  1J5E Q;  4A3C H;  5G3L D;  1AN8 A;  4R4T A;  3T56 B;  1UE1 A;  4DUZ L;  1PH3 A;  1IYJ B;  1RTN A;  1AP0 A;  1WVL A;  3G6E A;  3J7A V;  4OX9 L;  2F4V Q;  3OIQ A;  4L5T A;  3T1H L;  5C4Z A;  1RD9 D;  2B2Y A;  4R4O A;  3F1Z A;  2QIL A;  2KJX A;  3ULL A;  4OX9 Q;  3GTM B;  2KVM A;  3H91 A;  1DM0 B;  1SLJ A;  4QIW B;  4P74 A;  3N6R A;  2OCE A;  2UU9 Q;  1Q8I A;  1KTK A;  2NVT H;  2EYF A;  1JQY D;  1G51 A;  5T1G A;  2GA4 B;  1ZKO A;  2C9O A;  3VDY A;  2HIX A;  3P20 A;  4C3J H;  1JB7 A;  4M8A A;  2E5L Q;  4DR4 Q;  5A35 A;  5IOC A;  3S1R B;  2ZXP A;  3KBX A;  2B8F A;  3K6O A;  3SK6 A;  1Y1V B;  2EDG A;  2UU9 L;  2PNH A;  2F0G A;  4DAM A;  2AWN A;  2RSN A;  4LF4 Q;  4DAY A;  5FK9 C;  1GHK A;  4JI1 Q;  1I4P A;  1EY5 A;  4L5Q A;  4RH6 A;  4DV1 L;  2R92 B;  1OO9 B;  3FVQ A;  2AHO B;  1AFP A;  4ZLT F;  2L9H A;  4J8Q A;  2JA8 G;  5EPK A;  4GS3 A; 
#chains in the Genus database with same CATH homology
 5C4H A;  2NVY B;  2L55 A;  3E6Z X;  3URY A;  4DNR B;  1PLF A;  1ESR A;  1EYD A;  1D5X C;  4K5V A;  3VR3 A;  3SHL A;  2OF1 A;  4C3I G;  3NSW A;  3RD4 A;  2B2U C;  5I9P A;  3DWA A;  4KY5 A;  2CW0 C;  1SFO B;  3H09 A;  1TY0 A;  2OT2 A;  1TS3 A;  3CQZ B;  3PUV A;  5ELE A;  3MVV A;  1TT2 A;  4IZ8 A;  3V2T A;  4KJN A;  1DD2 A;  3J80 L;  5ELF A;  2NTT A;  1I3Q B;  3M4O B;  1CQV A;  4CJ1 B;  2X6G A;  2DY7 A;  3I8Z A;  1EY4 A;  3HOZ B;  3L7Z C;  2BOS A;  3WOE A;  2I46 A;  3MA2 B;  4IFD H;  3IL8 A;  1D5Z C;  2K1B A;  3FRP B;  4C2M B;  1AZP A;  5I4D A;  4KV6 A;  2QKI C;  4L6T B;  1QCB D;  1U4M A;  2R6G A;  1GUO A;  3DWQ A;  1U4P A;  1HA6 A;  3VYT A;  3T53 B;  1WTQ A;  1SNP A;  1PZJ D;  1UEA B;  3R2T A;  2TMP A;  4G7O C;  3K5O A;  1TVX A;  2L4N A;  3CRK C;  5EKK A;  3VR6 A;  2RQX A;  1EY9 A;  4C1N K;  2HCC A;  1EL0 A;  3K57 A;  3R93 A;  2E74 C;  3PIO 3;  5C4J B;  3KF8 A;  4KD4 A;  1TU2 B;  3M4Y A;  5FLX L;  3C46 A;  1TWA B;  3DHQ A;  2IX3 A;  2NB0 A;  1TS4 A;  1AEX A;  1RKN A;  2F0V A;  1IKL A;  2M00 A;  3K58 A;  1NSN S;  2E2I B;  1PXU A;  5J22 A;  5KRU A;  3SK4 A;  4EVO A;  2EJG C;  1LTG D;  2G9D A;  5JVG 3;  3WDN A;  5EPL A;  2OEO A;  2B2V A;  2L11 A;  2E2H B;  4ZK9 B;  2KEC A;  2F4I A;  3GTP B;  4KN7 C;  4DA2 A;  3MC0 B;  2L5T A;  1G29 1;  3NK9 A;  3QIA A;  1LV9 A;  1EQV A;  1FNV A;  3TP5 A;  2K01 A;  5KND A;  5EQ0 A;  4WOR A;  5E4X A;  5D3I B;  4K8J A;  3BVZ A;  1FR3 A;  1Z7T A;  3S1Q B;  1DOM A;  3EFX D;  3TME A;  1RCV D;  2F0H A;  5KIX A;  1Q1E A;  3GO5 A;  2L0C A;  5JEA G;  1F9Q A;  3X3N A;  1WTV A;  1EY7 A;  1XX8 A;  2EOT A;  1SYC A;  1BOS A;  3OSO A;  2RBM A;  3VR5 A;  4TKO B;  3TZU A;  1STN A;  3TSS A;  3I73 A;  1KDB A;  1TWC B;  4TQU S;  1DOL A;  1K83 B;  4JBW A;  2B2U A;  1X32 A;  3W3A A;  4ILW A;  3NBH A;  3W2D A;  4K8I A;  2DY8 A;  2WII B;  1CT1 D;  1Y8P B;  1D6E C;  2MGS A;  3KK7 A;  5EKI A;  3C1E A;  1S5C D;  5K5P A;  4C3H B;  4Z9C B;  4ZYS A;  5IGF A;  1TWG B;  4ULL A;  1SJE D;  1F9P A;  3RLF A;  3OWF A;  1BO0 A;  2XRS D;  3ND8 A;  2LFN A;  4IFD I;  3BVG A;  2SEB D;  1UAP A;  2JA5 B;  5IGC A;  5C0X H;  2F0D A;  2ICI A;  4UAI A;  1HXY D;  4S3S A;  1PZI D;  5M9O A;  2KCN A;  1CA6 A;  1BXT A;  3IFD A;  2IWH A;  4ZUI A;  2M2L A;  3D3R A;  1EWH A;  3IKJ A;  2XVS A;  3Q6S A;  4OGQ C;  1A3V A;  1Q3L A;  3HOU B;  2JE6 I;  1WTX A;  2YYZ A;  3I72 A;  1GUN A;  5CV7 A;  4IUR A;  4X3T A;  1HFN A;  3BVM A;  2PW7 A;  4H7B A;  1EY6 A;  1WTP A;  1OXS C;  5IGB A;  1LTS D;  2LKV A;  2DNE A;  4ME5 A;  1U4L A;  4RKL A;  3M3Y B;  2O5I C;  4H0L C;  3J81 L;  3DEP A;  2VXW A;  1NUC A;  2F0U A;  1TS2 A;  2R61 A;  4B08 A;  1S5E D;  1YNN C;  1G2S A;  1AZQ A;  4KHZ A;  3A8J E;  4NMZ A;  1OXT A;  5M3M B;  5LL6 S;  4FO2 A;  1GUG A;  1VF5 C;  1GOZ A;  5C44 B;  2AUK A;  2CQA A;  2XN9 C;  1XWE A;  3G7L A;  4HAE A;  2XIW A;  1PTO D;  4C3J B;  2NVT B;  4G7H C;  1STB A;  1PFB A;  3HEJ A;  3MZ5 A;  2NN6 G;  2VNU D;  1LAC A;  4P2C B;  3S14 B;  1Y1W B;  2J7Z A;  4ODG A;  2SNM A;  4BBR B;  1SYE A;  1GXD C;  1OXX K;  1DXM A;  2HQE A;  5JVH 3;  1D1K A;  1BF4 A;  4C3H G;  3A56 A;  3BYT B;  4KI0 A;  4R9W A;  4RHS A;  5BN3 A;  4N9P A;  5C0X I;  3DUZ A;  5I2X A;  2BE5 D;  1O80 A;  3GTO B;  3C2P A;  4RFB A;  4CKB A;  2F0E A;  4MIU A;  2BDO A;  1PYW D;  1F2M A;  1Q12 A;  3K5N A;  1E2V A;  1LT5 D;  2V4D A;  1GJX A;  2NN6 H;  1Q90 A;  2F1M A;  5CV8 A;  1MSG A;  5A2Q E;  1RTO A;  4HSV A;  4A3F B;  3J80 E;  2FMC A;  2F0P A;  3S1M B;  1B4O A;  2AQ3 B;  1EU4 A;  2F0L A;  1EEF D;  3TP6 A;  3FKI B;  1EY8 A;  2EY1 A;  3O13 A;  3F2U A;  3K0Y A;  1A2T A;  3IFT A;  1B50 A;  1LO5 D;  2B2W C;  1CZW A;  1UUP A;  2E76 C;  1DCZ A;  2JYO A;  1HCZ A;  4A3I B;  2F0K A;  4OIJ A;  2WB1 B;  1I6H B;  4F7X A;  4WFN 3;  2Y0S B;  4OO1 G;  2O4X A;  2K7V A;  1C4Q A;  4Y7N B;  1L0Y B;  1YNJ D;  3OMG A;  1JWM D;  4U68 A;  4B9W A;  2FMM A;  2MJ8 A;  2BA0 A;  2IL8 A;  3NWS A;  5CV6 A;  1FNW A;  1LTB D;  1W6K A;  4FVM A;  1Y8N B;  3OOC A;  4FF1 A;  5JOB A;  1WD0 A;  2K5D A;  2WAQ B;  2F0N A;  5EKL A;  4ID6 A;  2KA7 A;  3ERO A;  1ET9 A;  3HP3 A;  5CV9 A;  5K36 H;  3ND9 A;  2RSO A;  2EY6 A;  2SOB A;  3EVQ A;  1Y69 U;  5ISR A;  1F2L A;  5COY A;  2MPM A;  1LTA D;  2JP1 A;  4KMU C;  2B2V C;  2EYH A;  1B44 D;  3KLS X;  4HMJ A;  2HDL A;  3K5L A;  3K7A B;  3ZYY X;  3NQT A;  1B2T A;  3NTI A;  3R2I A;  4NW2 A;  3D4D A;  3PUY A;  3S9W A;  5CV5 A;  3QO2 A;  1CQF A;  2IX0 A;  3CU7 A;  5TSS A;  1LLR D;  1D1I A;  2CHB D;  5C0X G;  4ZAI A;  2F0Q A;  4DGZ A;  2PNR C;  4KN4 C;  4J6H A;  4DK1 A;  4J1M A;  2WP8 J;  1EQT A;  4KTA A;  4EQO A;  1I4H A;  3LWE A;  3BS1 A;  2MUY A;  2MHV A;  2KOL A;  3HGB A;  4A3M B;  1CK1 A;  1HTL D;  5K36 G;  5EJW A;  5CBE E;  4QF4 A;  3D6C A;  1PRT D;  5CMD A;  2ENB A;  1JCK B;  2JA7 B;  1GUS A;  4OHJ A;  3D8G A;  4N9T A;  3A54 A;  1QNU A;  1HA5 A;  4H44 C;  3QOJ A;  4M1U B;  1SAP A;  3T4A C;  3Q23 A;  2BE5 C;  1B53 A;  3ITP A;  1SXT A;  1WD1 A;  2I07 B;  1QE6 A;  2A6E C;  1SE2 A;  4KHV A;  1CZG A;  2RDF A;  3I70 A;  1SJH D;  3I4L A;  3H94 A;  4BS9 A;  2F03 A;  1A2U A;  4XQN A;  3M7G A;  1R9T B;  2PPB C;  2A68 C;  1JB3 A;  1H9R A;  2A74 C;  1FNU A;  3E5S A;  1I6V C;  3HG9 A;  4IUT A;  2PZU A;  1SSO A;  5ELB A;  2EYL A;  1I4X A;  4DXF A;  3MXU A;  4WJW A;  2DNC A;  2BA1 A;  1LTR D;  1IL8 A;  2PW5 A;  5CYU A;  2QEJ C;  1GHJ A;  3RUZ A;  4XXE A;  4K5W A;  1SYB A;  1ZEQ X;  1O7Y A;  2K04 A;  1ZYR D;  5C4X B;  1BQQ T;  3SK8 A;  3MEH A;  1PRT C;  4C1N I;  5HGT A;  1G6Z A;  4RCO A;  3PUZ A;  1PDQ A;  1KLG D;  1NR4 A;  1BDO A;  4EQN A;  4EQP A;  2L1B A;  1W6J A;  5C0X J;  4QUC A;  2BDN A;  1PRT B;  4LAA A;  2TSS A;  3BDL A;  3D31 A;  1PFM A;  4K5X A;  4IFD G;  1RHP A;  2JEA I;  5A2Q L;  1EOT A;  4IFD J;  2Z8L A;  1KDA A;  2C5C A;  3T13 A;  5C5L A;  4FF2 A;  2R7Z B;  1I4R A;  3IAY A;  3NTK A;  2ZXR A;  4OO1 H;  4U67 3;  4HN7 A;  3MAQ A;  3S17 B;  2D2C C;  4DN4 M;  3VYU A;  5COR A;  5EBD A;  1ZXT A;  2F0F A;  4IUN A;  1G2T A;  3NP8 A;  2KQ3 A;  1LTI D;  3NXW A;  1TY2 A;  3DEO A;  1J8I A;  1OXU A;  1EU3 A;  1KDC A;  4I65 A;  3VA7 A;  4XT3 B;  1C48 A;  1DOK A;  1HUN A;  2QDB A;  4A3E B;  1KNE A;  2PCF B;  2JEB I;  5C6A A;  2QF7 A;  2B2Y C;  1F9S A;  1PTO B;  3LWU A;  5IGE A;  1U9R A;  1EZ6 A;  2CVR A;  1IKM A;  5JPN C;  1SMY C;  3GD7 A;  3HKZ B;  5EGT A;  4ZKB B;  1CA5 A;  4BBS B;  3ERQ A;  4NP5 A;  5I6Y A;  2EYM A;  1QNK A;  4G4K A;  2XWJ B;  2EE1 A;  1R4Q B;  2E2D C;  1CM9 A;  1SYG A;  4AYB B;  5CGK A;  1QG7 A;  2K32 A;  4QUF A;  3TP8 A;  4PNY A;  2H4O A;  5AFW A;  3HRZ C;  4G7Z C;  3RZO B;  2WAC A;  1IW7 C;  1B3A A;  1Z47 A;  4L8J A;  1BCP D;  1KNA A;  1HQR D;  2G9H D;  1S5F D;  3KLR A;  3MXG A;  5M5X B;  4QCL A;  1CHP D;  3P7J A;  2AQ2 B;  1EY0 A;  3D4W A;  2Z4I A;  2Z4H A;  1ROD A;  2EPB A;  2LS0 1;  4CKE A;  3AU7 A;  5F2D A;  1WTO A;  5I6W A;  2A5H A;  2IJ0 A;  5NUC A;  3J7A F;  3TP7 A;  1JR0 D;  4QB4 A;  3QB3 A;  1TS5 A;  2K5Q A;  2NYZ D;  2KCC A;  1K8M A;  1V1P B;  1V1O A;  3J7Y W;  3R3O A;  4RWS C;  1XYI A;  1SE4 A;  4DU9 A;  1QB5 D;  1ILP A;  4RKB A;  3DM1 A;  1BCP C;  4XDX A;  2HDM A;  2K28 A;  4IQZ A;  2K6A A;  5JJZ A;  3MFG A;  1BCP B;  3GV3 A;  3H0G B;  1CFM A;  2A68 D;  2F0T A;  4ZKC B;  2PZW A;  5IT9 E;  5IOD A;  2QCP X;  4OIK A;  2MP1 A;  4DXG A;  1PMR A;  2AWO A;  5BN5 A;  4X3U A;  2FHT A;  1FYC A;  4A3J B;  3AB9 A;  4C3J G;  2EY5 A;  4L63 B;  4HSP A;  4ZQ3 A;  1I50 B;  3M85 A;  2ID0 A;  3V05 A;  3NQI A;  1HTP A;  5KGU A;  3BDC A;  1E0B A;  3SK5 A;  2LMC B;  3Q0A A;  1Y8O B;  2ZT9 C;  2K05 A;  3H6M A;  3DMU A;  1O7Z A;  2VB3 X;  5J39 A;  3HZX A;  4LMQ D;  1SNC A;  1BBX C;  4PQX A;  1MGS A;  1WTW A;  1TWH B;  4FXD A;  2R93 B;  1SNO A;  2NZ1 D;  3SDZ A;  3GQB A;  2D9U A;  1HFG A;  1T5E A;  4HCE A;  3OW7 A;  5JPM C;  1BR9 A;  4FYD A;  3I3C A;  1EWC A;  1STA A;  2B2T A;  1L0X B;  1HHV A;  4CGY B;  3WOF A;  2IT1 A;  4X3S A;  4A3D B;  3S2D B;  2J0T D;  1U4R A;  4XTC S;  2EYP A;  1D5M C;  3R8B A;  5C3E B;  1T5X D;  4JK1 C;  2HCI A;  4R8I A;  2IPK D;  5C3W A;  5LL6 X;  4RGN A;  3OHX C;  3C3L A;  4K2K A;  4O1N A;  1TQO A;  3J81 E;  1JWU D;  3K59 A;  4NDX A;  2XNA C;  2NN6 I;  3QG1 A;  1HRJ A;  2D5D A;  4NKL A;  1IYV A;  4HTH A;  3RMH A;  3MXN A;  3PV0 A;  4RHR A;  4IN3 A;  4YIJ A;  4KKT A;  3BYY B;  2NTS A;  4B9X A;  4Q0F A;  4DNT B;  5ELC A;  3NHH A;  4I7Z C;  2ICE C;  2E2J B;  2NUC A;  1PZK D;  5KNB A;  1J9O A;  3A7A B;  5IGG A;  4BA1 I;  1STE A;  1FGB D;  1KAA A;  2A6E D;  2AUJ D;  2H1E A;  1ESF A;  4O42 A;  5EPJ A;  3NE5 B;  1G91 A;  1O7L A;  2RA4 A;  4DFA A;  3EJI A;  2VUM B;  5G3L F;  5C3X A;  3QJY A;  3N52 A;  3TDQ A;  1WTR A;  3RZD B;  1S5B D;  4KKU A;  1D2B A;  3S16 B;  2RKS A;  2RDH A;  5IIF A;  3MWY W;  4IUQ A;  1HPC A;  3CRL C;  4A3B B;  1LT3 D;  5IT9 L;  1LTT D;  4FP5 D;  5CC4 A;  4H13 C;  1A3U A;  2M9V A;  5ELD A;  4QMG A;  5DEH A;  5M5W B;  3Q22 A;  2FFK B;  1YNN D;  2NVQ B;  3HOV B;  3PUX A;  4PMW A;  1GUW A;  1LAB A;  1JOQ A;  3G6J B;  3LNN A;  3A8K E;  5D3D A;  3KLS A;  1YNJ C;  1ZYR C;  1CI3 M;  1H9K A;  2HUG A;  1ONL A;  3D4R A;  3GP7 A;  2DN8 A;  3S2H B;  1F2Z A;  1QWY A;  1B1Z A;  4EGV A;  4FNF A;  4RCN A;  4HR7 B;  2JA8 B;  4FXK C;  4LJZ C;  3SVM A;  2KUM A;  4K14 A;  3MTS A;  3MHB A;  4GZY C;  5EBC A;  3NPP A;  4FF4 A;  1B9N A;  2EVB A;  2A69 C;  4C3I B;  1FD7 D;  4PV1 C;  4X3K A;  4LK1 C;  5T1I A;  4V0B A;  3P1H A;  2D62 A;  1ICW A;  3VR4 A;  4RGM A;  4DAV A;  1LT4 D;  3FPP A;  1CHQ D;  4RA8 A;  3PIP 3;  2IX1 A;  2EZV A;  1ENC A;  2NVX B;  3Q24 A;  1S4Z A;  3GTG B;  2B39 A;  3L9A X;  2WIN B;  3FDT A;  1R4P B;  4IAL A;  1JE4 A;  1C8C A;  3VR2 A;  4ABN A;  4XYQ A;  4DF7 A;  3CKI B;  2R3Z A;  3T51 B;  3NTH A;  1QJO A;  2EYO A;  3MFY A;  4DK0 A;  2SDF A;  3I90 A;  3LX0 A;  1G8Z D;  1V8Q A;  2NWG A;  5HUR A;  2F0W A;  1STY A;  3KBG A;  5KEE A;  2Q8I B;  3HS0 C;  2BCO A;  3T16 A;  3GV6 A;  5J1Z A;  3OPO A;  3DXJ C;  2OXP A;  5DM7 3;  4FF3 A;  1VMP A;  1F77 A;  5KNC A;  1H9S B;  3GTL B;  1JOR A;  1II3 A;  2PO4 A;  1SBB B;  3NBI A;  2XRQ D;  2A73 B;  3VYS A;  1BNZ A;  3TZD A;  3VA5 A;  1MBY A;  1H9J A;  1MD2 D;  1EEI D;  1KAB A;  5FKA C;  1TR5 A;  4Q5V A;  5CV4 A;  2L12 A;  2WKC A;  1SYF A;  1E2W A;  3DWP A;  2EJF C;  2PQE A;  3C1F A;  1ML0 D;  4TSS A;  1JIC A;  3TN2 A;  4E6I A;  1RDP D;  3I91 A;  3L3O C;  1SEB D;  2F0J A;  1ILQ A;  4G57 A;  1V43 A;  2F0I A;  1CTM A;  4PMB A;  5E1F A;  4MN3 A;  2N88 A;  4IUP A;  4DAP A;  3FMC A;  1ENF A;  3GTQ B;  3OIP A;  1DYQ A;  3M7N A;  1NR2 A;  3PMF A;  4CJ2 C;  1SNQ A;  5BN4 A;  5DAU A;  2X69 A;  1BUV T;  3MXP A;  1IHZ A;  4MHE A;  2KHS A;  3S1N B;  1LT6 D;  4HCS A;  2B8G A;  3U9O A;  4HED A;  2XWB B;  5C5M A;  2SNS A;  1H9S A;  4XT1 B;  2Q8R E;  4A93 B;  1EZ8 A;  2F0S A;  2PMZ B;  1DJR D;  3HOX B;  1A6X A;  4XQJ A;  2KEE A;  4BY7 B;  4UDU C;  5E4W C;  1DZ1 A;  2NBF A;  5CBA E;  4XQQ A;  4C56 C;  3FEW X;  4RAU C;  1I4Q A;  1PRT F;  1H9M A;  1I4G A;  1MI2 A;  1MSH A;  2F0O A;  3KUP A;  5FO7 B;  2A6H D;  5DNF A;  1BCP F;  5CR3 A;  1X3Q A;  4RGT A;  1X3P A;  4CBV A;  2ZXO A;  3QWN A;  3SE0 A;  4KJO A;  4F87 A;  5JEA J;  3TBI B;  5FLX E;  1JWS D;  3U9S A;  2F3V A;  4CHT B;  1E2Z A;  4XYO A;  4FXG C;  1NCV A;  2Z1C A;  4K2L A;  1SDF A;  1QIL A;  2EY2 A;  1NAP A;  1EIG A;  3QOL A;  2EYJ A;  2PZT A;  3GTK B;  2JA6 B;  2K5W A;  1M4V A;  4CKC A;  2F0M A;  1S5D D;  1OXV A;  1VF7 A;  1EIH A;  4BA2 I;  1K8O A;  2O5J C;  2JSO A;  2RDG A;  3BG3 A;  5IGD A;  2WV6 D;  1SNM A;  5D14 A;  3PO2 B;  3NWT A;  1A3T A;  2F3W A;  2A69 D;  1XTC D;  1A15 A;  3A7L A;  2B2W A;  1WCM B;  4BWG B;  3HOW B;  2E75 C;  2N55 A;  4R8N A;  2K03 A;  4RGO S;  3HOY B;  1RF2 D;  2PYK A;  2FIN B;  1KLU D;  3BDO A;  1ET6 A;  3SR1 A;  1HQM C;  1TWF B;  2B2T C;  5JAV A;  3EA6 A;  1PFN A;  1HUM A;  3AMU A;  2EXZ A;  2RVL A;  2CW0 D;  1SMY D;  2AQ1 B;  3I4N B;  2X6L A;  4ZUJ A;  4OL7 A;  1JC7 A;  2WKD A;  1JOO A;  5FO9 B;  1SYD A;  2LY7 A;  3I4M B;  1M8A A;  1SND A;  1EFI D;  3OMC A;  1STG A;  4KK7 A;  3JAM E;  1IYU A;  1STH A;  3X3M A;  5JEA H;  3P75 A;  3NUC A;  1RJT A;  1IW7 D;  4V19 0;  4XIG S;  1EYC A;  4A3K B;  5FOB B;  3PUW A;  4F8M A;  3GTJ B;  3A8I E;  3ONA B;  4K6L A;  3H3V C;  2JXM B;  3S15 B;  1V1P A;  2KED A;  4F88 A;  3PO3 B;  1VCI A;  1VDZ A;  1UNS A;  5FO8 B;  4K6D A;  3UI2 A;  2J4X A;  2EJM A;  1PTO C;  1ENA A;  1JOK A;  1Q1B A;  1EYA A;  3VYR A;  1B9M A;  5I9O A;  1DON A;  5LHY 1;  4ZRZ A;  1O78 A;  1PTO H;  4PMC A;  1TII D;  5E3F A;  2Q8T A;  5M5Y B;  1TKW B;  4KY6 A;  4KD3 A;  1Z6H A;  3OWE B;  4TRD A;  4KKS A;  3BZD B;  3A55 A;  4IUV A;  2B63 B;  1QOH A;  1AW7 A;  5KYI A;  1PTO F;  3D6W A;  1XXG A;  1SE3 A;  2O2L D;  5M3F B;  4WRD A;  3SEB A;  3JAM L;  2XSC A;  2FJ2 A;  4CJ0 B;  3EQL C;  3CHB D;  2A6H C;  5I2Y A;  1F9R A;  1VMC A;  1GUT A;  1F2Y A;  5KYL A;  3V96 A;  4BY1 B;  3E0J A;  2YU9 B;  2K33 A;  2IW3 A;  2VB2 X;  4IUU A;  3SXH A;  4KY7 A;  3K5M A;  5D65 A;  5DM6 3;  4A3G B;  3FPU B;  4HMI A;  5G3L D;  1AN8 A;  3T56 B;  1RTN A;  1AP0 A;  1WVL A;  3J7A V;  3OIQ A;  5C4Z A;  1RD9 D;  2B2Y A;  2QIL A;  2KJX A;  3GTM B;  2KVM A;  3H91 A;  1DM0 B;  4QIW B;  3N6R A;  1Q8I A;  1KTK A;  2EYF A;  1JQY D;  5T1G A;  2GA4 B;  1ZKO A;  2C9O A;  3P20 A;  4M8A A;  5A35 A;  5IOC A;  3S1R B;  2ZXP A;  3KBX A;  2B8F A;  3K6O A;  3SK6 A;  1Y1V B;  2EDG A;  2F0G A;  2AWN A;  2RSN A;  4DAY A;  5FK9 C;  1GHK A;  1I4P A;  1EY5 A;  4RH6 A;  2R92 B;  1OO9 B;  3FVQ A;  1AFP A;  4ZLT F;  2L9H A;  4J8Q A;  5EPK A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...