2LFNA

Identification of the key regions that drive functional amyloid formation by the fungal hydrophobin eas
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
SATTIGPNTCSIDDYKPYCCQSMSGSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSGLIINAANCVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrophobin
publication title Self-assembly of functional, amphipathic amyloid monolayers by the fungal hydrophobin EAS
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.520 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lfnA00
2K6AA 2FMCA 2LFNA
chains in the Genus database with same CATH superfamily
1Y8OB 4RA8A 3FPUB 1EYCA 3QIAA 2EZVA 5GROA 1K3BC 3Q8DA 3AFQA 4DV3Q 4BY1G 3S2HH 2K1BA 4JI1Q 4HIOA 3ULJA 4Y7NH 2YU9B 1LM0A 2KCMA 2XWJB 3SK6A 3PO2G 3CKIB 3QOJA 3N6RA 2R92G 4JI3L 1STEA 5H1SE 4UHVA 1FNUA 4L5TA 1SMYD 4XIGS 2B39A 4FXDA 5HGTA 3GV3A 3CCEA 2H1EA 5A2QE 2F0UA 3M7NA 3H3VH 4CJ1B 4KLKA 2RCNA 3V05A 2JJQA 1DGSA 3HZXA 1OXSC 2HQLA 1B50A 3FPPA 2UUAL 1KL9A 2IY5B 2D0OA 3L7ZC 4FNFA 4JC0A 4K8JA 3V96A 2OCEA 4MTKA 4DPGA 2JA7H 5JEAH 3A5UA 2VUMB 1JOQA 2UUAQ 1IYUA 4C2MH 3KF6B 1I3QH 2EY2A 1Y1WB 1KDAA 3U4VA 1K73C 2ASBA 3DEPA 3K7UC 3S9WA 3PUYA 1PZJD 2IX3A 2A19A 2QF7A 3PMFA 4DUZL 3R3OA 1KRTA 2LFNA 3AQQA 5FJ8H 4OWXB 3IL8A 1DD2A 2EXZA 3FMCA 5EJWA 5DEHA 5JPNC 2CVRA 1G291 2BA0A 3PF5A 3UDIA 3VDYA 2JA7G 2B8GA 2KCNA 3GV6A 3A55A 5KYIA 2IW3A 4RWSC 3CQZB 1QJOA 5IGDA 1IKLA 3OWEB 1U0LA 3NELA 2UUCQ 5IGGA 3UDFA 2HUGA 4ODGA 2NN6H 5I9OA 2B63B 1PXUA 1H95A 1WTXA 2RA4A 1IBLQ 5FJ8G 3RZOH 4QUCA 2OXPA 1VQFA 1VQMA 2E2HB 4UP8A 1YVCA 2Q2HA 3FKIH 1YIJA 2F03A 3OW2A 1WOCA 2QEXA 4DAPA 1HPCA 3OMCA 1HRJA 4KV6A 1DM0B 3J7ZC 5IYCH 3W3AA 1NCVA 1A15A 4DV7L 2F0FA 4XYQA 1AE3A 1L0XB 1TWAB 1CTMA 4JI7Q 2QW7A 1K8OA 2K01A 2KQ3A 3T1HL 1F77A 4PG3A 4QMGA 4G7ZC 4F8MA 4QJFA 2NN6G 1ILQA 4RGOS 4IOAA 4I65A 3PO2B 2RSOA 5ELBA 1Y8PB 2P5ZX 3MXGA 4GOPB 2F0DA 3GTGH 1QCBD 5G3LF 5AFWA 1AP0A 1SE3A 4ZK9B 2BOSA 3VYUA 3FKIG 3CW2C 5JJKA 1I6VC 3EN2A 4B3RQ 1YNJC 3OSOA 2AHOB 2NVQB 4U68A 4KTAA 1YITA 1EQQA 4B3TL 5C4ZA 4QQBX 1SLJA 5IYCG 4POGA 4G7OC 1TS4A 4G57A 1Z7TA 5EPKA 4OXPA 1N34L 3STBC 3L2PA 2XNAC 3M9BA 2Q8TA 1TWCH 3S2HB 1LABA 1S5CD 3OTOQ 4LF5L 3I4OA 2RVLA 1N34Q 1EL0A 1CM9A 3ER0A 5L37A 1GD7A 1HA6A 3D4RA 1T5EA 3TREA 4LF5Q 5I2YA 1DZ1A 1EYGA 4X65L 3RZDB 5DM73 3GTMH 1KAWA 1MBYA 3DMUA 3MC0B 1SAPA 3TN2A 3FP9A 1ZYRC 1X9NA 3HOXB 1VQNA 1HJPA 4O0AA 5FK9C 3CCSA 1KLGD 3KK7A 2UU9L 4K0KQ 2Z9HA 2JA7B 1E7ZA 2F0VA 1IBKL 4P73A 3OIPA 4RAUC 1I3QB 3CRLC 3WWVA 1KDBA 4LUZA 1WCMH 4KI0A 5CV5A 3I8ZA 3H15A 2I46A 2Q2TA 2RQXA 2ZTCA 1C9OA 2AQ3B 3CCQA 5E3FA 5LMUL 1PFBA 2LMCB 3TDQA 4C1NK 1MGSA 5C0XI 2Z6BA 4DR5L 5IYDH 1UWVA 5ELEA 1WD1A 4A93H 3RLFA 1A63A 2ES2A 2KCCA 2TSSA 3FVQA 1LTAD 4R4QA 1IHZA 3KYHC 1YNJD 4O2DA 4PMCA 1JJCB 1ZKOA 1Y1VG 1WCMG 5C3WA 1K8AC 2XIWA 3NENA 1PRTF 3STBD 4C3HG 1EQVA 3U9OA 1H9SB 2Q2UA 1EIYB 4JG2A 1PH6A 2I5HA 1LT4D 4YCUA 3FKIB 3E0JA 2YV5A 1EEID 5IYDG 3PGZA 1HA5A 3EFXD 5NUCA 3S1NH 1QUQA 2J7ZA 2O4XA 2B2YA 4WJ4A 3PQIA 2X6GA 2WKCA 3NE5B 3P20A 1AZQA 4C3JH 4K8IA 2IHEA 2NBFA 3I3CA 1SMXA 3BVGA 2DNCA 1ZYRD 2Q8RE 2K05A 4ZUJA 1MI2A 1CKOA 3GTGB 3S16H 1PVOA 4DAVA 1H9MA 2YTXA 2E2JH 2PO4A 3E6ZX 3PO3H 1TY2A 1AZPA 4G7HC 4UAIA 4JI4Q 1HUMA 2K14A 1M4VA 3NBHB 1BCPF 4DV5Q 1TWCB 4IURA 5LL6S 5IWAL 5AJ3Q 1OXXK 4C3JG 1AH9A 1WI5A 4I7ZC 2QA4A 1K0SA 1RTOA 4JBMA 1T5XD 2WACA 1E3PA 5JAVA 1SDFA 4MHEA 2RHSB 3RN5A 5IWAQ 3A54A 4IQZA 1NTGA 1OXVA 4Q5VA 3GTMB 3PO3G 4I7AA 5E1FA 1L1OB 1S5BD 4XT3B 4Z9CB 3PIO3 1IYVA 1WTHA 2CW0C 3HKZE 3F8TA 1VQ5A 4HCSA 4XQJA 3TZUA 1Q8KA 1QG7A 5D65A 4NXNQ 2L11A 3GP7A 1H9JA 5J22A 4X62L 4JI6L 3D6CA 4NXMQ 2MO0A 1JICA 3B6YA 4JK1C 2RDHA 5EPJA 5IY0A 3SXHA 1BXTA 1VQGA 4FF4A 4HJ8A 2Z4HA 2F0OA 4JI6Q 3A8JE 4OO1I 1KLUD 1WCMB 3J80L 2F3WA 1QVFA 1ONLA 3S17H 4A4IA 1DJRD 1K28A 1VCIA 3VYRA 4PZ8A 2F0PA 2NZ1D 5JJZA 1MJEA 2BE5C 2JP1A 3CMAA 1TIID 3NPPA 2AQ2B 3ZJYC 4LAAA 3UDXA 1O80A 1B44D 1PZKD 2R7DA 1E1OA 4LF6Q 2KEDA 2OT2A 4BBRH 2WB1G 4DR3L 1Q12A 4A93B 3HEJA 4DR4Q 3CCMA 1B53A 4DNTB 1IKMA 4QY7A 3T56B 1PRTC 4ZQ3A 1HR0L 4HJAA 2Y0SE 4ZLTF 3CC4A 3W1GA 4DR3Q 2NVQH 2XSCA 3Q6SA 4EQ5A 3J80E 3OHXC 3C2PA 5C0XH 1XPOA 4WRDA 1PTOF 3T53B 2K4KA 3U50C 1X6OA 1NJIC 1QZHA 1ESFA 2G9HD 2N3SA 3K5OA 1LTID 2EJGC 3JAMi 4KJNA 4QB4A 2PZTA 5J39A 3H94A 3S1NB 1UE7A 4DAYB 4CDEC 1HTPA 1BNZA 1RKNA 4C3JB 2QDBA 3QOLA 4R9WA 1CZGA 2PNRC 2EJFC 4LF4Q 2CW0D 5C0XG 3Q22A 4RGNA 4GKJL 2EYHA 5C44H 2XVSA 1O78A 2CH4A 2I0QA 4GN4B 4OX9Q 2B2YC 3DM1A 2MNAA 5C5MA 4KK7A 3TP8A 2R7FA 3KF8A 1BCPC 1CI3M 4HN7A 2ZJQA 1IYJB 1X3QA 5I6WA 4AYBE 2UXCL 3IFTA 1RIPA 3D6WA 1I94L 2NTTA 3R2IA 3L9AX 3CP0A 2PQAB 1MKHA 3ULLA 1EWIA 2HDLA 2HIVA 3KJPA 3IFDA 2UXCQ 4LFCL 1STGA 4GLAC 1CA6A 3AYHB 1I94Q 2BE5D 2Z8LA 5C44G 1EUJA 1EOVA 1CT1D 1IL2A 1SYCA 2DJGC 1EZ8A 3V2TA 1EY4A 2KCTA 4L8JA 1B2TA 4FO2A 2HHHQ 2CQAA 1LT6D 5J3BA 4LFCQ 3I4LA 5GAGC 3JAMc 1PRTD 1F9PA 1HZCA 5KYLA 2WAQG 1GHKA 3HOZB 1X56A 3HOWH 2KHIA 2JSOA 2N8NA 5IP9H 4KY7A 3HOYH 2AUJD 1FVIA 3BZDB 1G6PA 1XXGA 1F2MA 2DGYA 3CCLA 4O1NA 3CF5A 4Q0FA 1IZ6A 2WV6D 4IUPA 1XTDA 1EY0A 1VQDA 3AEVA 2UXBL 2LXKA 1WJJA 1ZEQX 4L5SA 1ET9A 2JK8A 1X54A 2A1AA 4KKUA 2Y0SB 3RR5A 5I2XA 4LJZC 4LF9L 2UXBQ 2N55A 3T4AC 2HDMA 4DV1Q 3S17B 4A3GH 3VA7A 3HOWG 4KHPL 5IP9G 1QILA 4YIJA 2AQ1B 3HOYG 2D2CC 2LXJA 1DONA 4LF9Q 2SOBA 4DV4Q 2FJ2A 4JI5L 2R7ZH 4BWGB 3M3YB 1TY0A 2K7VA 1EIHA 4BBRB 3MXNB 2NN6I 4DF7A 5KEEA 3CAMA 4XYOA 1EY8A 1VMPA 3C46A 4OO1H 2M9VA 2F4VL 4GZYC 5CV9A 4NB3A 1VMCA 1BCPD 4XTCS 1PTOC 3KJOA 3M4PA 4IOCA 2A69C 3EQLC 1SNOA 5ELNA 3H09A 4IALA 2F4VQ 1AFPA 5M5WH 4N8X1 2FMCA 2HQEA 4A3GG 3J81i 1QE6A 3C1EA 4IUTA 4APVA 5FOBB 2R7ZG 1D5XC 1TR5A 2PQEA 3BZKA 4HEDA 5EBCA 4X64Q 1UE1A 2ATWA 1SRUA 3G4SA 4AYBB 1WTVA 5JJLA 2ZXPA 4POFA 4L5QA 2DUDA 2NVXH 1XNQQ 1VQHA 4MNOA 2BH8A 5C44B 2WFWA 2MHVA 4DR1L 3GQBA 3NWTA 4FXGC 3MXUA 5CORA 4IUUA 3U58A 3I72A 2K50A 1HNXL 1E24A 1CKNA 2XN9C 2RHQB 3RN2A 4DR1Q 4QUFA 1PH9A 3DUZA 1HNXQ 1XNRL 3PIOA 5DLQE 4L6TB 3Q23A 4X3SA 2EYOA 2NVYH 3CHBD 1SEBD 5EGTA 3K7AB 1RCVD 2WINB 1XNRQ 1LTLA 5FO8B 5EQ0A 3NTKA 5FLXc 3J81c 5IODA 3F2BA 3KLWA 2E74C 5GQOA 5E4XA 5HURA 1XWEA 1KHIA 3L3OC 2R6GA 3QR8A 1GKHA 4JI3Q 1PTOD 4C3IB 3PUWA 1ICWA 3K5LA 2M00A 1AEXA 1PHJA 2A69D 4IPGA 4DV6L 3TS0A 4JV5L 1K0RA 5BN5A 1KIXA 4KD3A 1Q90A 5CV4A 3P7JA 4IUQA 4P2CB 3S2DH 3DM3A 3HOUH 4DV6Q 4K6DA 4JV5Q 1LYLA 4A3FH 4YHHL 1I4QA 2PNHA 2MJ8A 1UE5A 2N88A 4DK3C 4A3GB 4H02A 2DN8A 3K5MA 2ZT9C 4EGVA 3EROA 2R3ZA 1JC7A 3MWYW 3SDZA 2PZWA 2K28A 2R7ZB 2K5VA 4J8QA 2CQOA 1EIFA 1PH3A 1GUTA 1K3RA 2A73B 4N9PA 2L15A 4A75A 4OWTB 2L5TA 2M2LA 1JB3A 4DUZQ 4JI8L 3HOUG 4PNYA 1VS0A 1F9RA 5D14A 5JVG3 2F0SA 4A3FG 2Q8IB 3FDTA 4OIJA 2A8VA 1QVGA 3VR3A 1GXDC 4CKEA 5M5WB 1CKMA 1X55A 3ITPA 3CU7A 1EFID 1HNZL 3DWPA 1KTKA 1V1PA 2WKDA 2QDLA 2ZTEA 4FDBA 1PV4A 2L55A 4JBJA 1X3PA 4R4IA 1X65A 2BA1A 1TWFB 4GS3A 1TU2B 2Z6KA 3A7LA 3HS0C 1KQSA 2NVXB 4ID6A 1NSNS 4BY1B 4Y52H 2KBNA 4K2LA 2VQEL 4ALPA 1PH2A 1STAA 1QNKA 3SGIA 5M5YH 4U673 1CZWA 1BQQT 2F0NA 1CQVA 4DV7Q 2R92B 5FKAC 3UE0A 3QO2A 3K81C 3HP3A 3J7YW 1Q1EA 3T1HQ 3KBGA 4KMUC 1I4PA 4A3IH 3G6JB 4JI2L 5CGKA 4ULLA 4IJLA 2K5WA 4NP5A 3TS2A 2O5JC 3CC2A 2F52A 3T1YL 2IX0A 1B7YB 1U4PA 3MEHA 2OTLA 3MVVA 4JI2Q 3QB3A 3F1ZA 2IWHA 2NVYB 3F2DA 1D1KA 2RKSA 2CKZB 1EWHA 4WORA 5T1IA 4IFDH 4E6IA 4Y7NB 2KECA 4B3TQ 1HR0W 1MSHA 2CWAA 4KHVA 3ND9A 2O5IC 1ENCA 3H91A 2K52A 3NTIA 4F87A 3AFPA 1AW7A 1D6EC 4X3TA 4A3IG 3URYA 4CKBA 3ND8A 1QVCA 4O42A 4S3SA 2QEJC 1A0IA 4B3ML 1SN8A 2HIXA 5CR3A 5HY6A 2PW7A 3RNUA 3PCOB 1CUKA 1JOKA 4JVZA 4X65Q 3LNNA 4B3MQ 4IFDG 2B2UA 2QGQA 2YTVA 5IT9L 1EWCA 3KFUA 3HOUB 1D8LA 1J6QA 1XJVA 1PA6A 1NBWA 4DR7L 4A3FB 2KA7A 1XMQL 1I50H 1DXMA 1QB5D 1A2UA 5CYUA 4C2MB 3LX0A 3X3NA 1PRTB 2NZHA 1Y1VH 2UU9Q 4JBWA 4GLXA 4DR7Q 4C3HH 1PTOH 3A5ZB 3K59A 4HTHA 1IBKQ 1JR0D 1F9QA 2RSNA 4PV1C 1SYFA 1BR9A 2L9HA 1YBYA 4LK1C 3CXCA 1X3FA 5IT9E 1EFWA 3ZYYX 2D62A 3EIVA 3I7FA 4N8FA 4TRDA 1C7YA 5LMUQ 1STHA 4GLVB 4EQPA 4JYAL 4RG1A 3OOCA 1O7ZA 1ESRA 1VQKA 3R2TA 2J0TD 4DR5Q 4YWKA 4WJ3M 1VQAA 1J8IA 4JYAQ 2IL8A 2VB2X 2KVMA 1GUOA 4OWWB 3RZOB 1DCZA 2KHJA 1WTQA 3PUXA 1FGUA 1VQ9A 1F2LA 1SROA 1QUQB 4A3LH 2ICIA 4JBKA 1EY6A 2G5DA 4OEMB 2B29A 4N9TA 4QL5A 1BO0A 1SJED 2G9DA 4RHSA 3P1HA 4BY7H 2L0CA 2NUCA 4LFAL 1HH2P 4R1JA 2F0JA 1M90C 1RD9D 2A6EC 5IOCA 4ILWA 3Q0AA 2EJMA 1BBWA 1BDOA 1YHBA 3WOEA 5FO9B 2KUMA 2HT1A 1EYDA 2Z6KC 1Y8NB 1JWSD 4KKSA 3BYTB 1RHPA 2VB3X 4A3LG 4A3IB 3DLLA 4FF2A 3DEOA 2XGTA 3FEWX 3NQTA 3WDNA 2DNEA 3E9HA 1C4QA 2F0HA 1B1ZA 2F0IA 3EVQA 4BY7G 4QGUA 5C0XJ 4MIUA 1GUGA 2EYMA 2ID0A 2PZUA 5C3EH 3I4MH 1N33L 1FR3A 3BZCA 2EY1A 4H44C 4TQUS 2RCFA 5D3IB 5M3MH 2FINB 4OONA 4BS9A 1KXLA 1N33Q 2VQFL 1GUSA 5I4DA 3AMUA 2SDFA 3OMGA 1NY4A 4YY3L 2B2TA 5IGCA 1SE2A 1X3GA 3BU2A 1EQTA 2F0KA 4DA2A 4HJ5A 1B4OA 2VW9A 2DY7A 1B3AA 4HMIA 2O2LD 2VQFQ 1K8MA 2I5MX 3GTKH 5C3EG 2Z1CA 4P71A 1WVLA 1UEBA 3I4MG 1GM5A 4A3KH 4QCLA 1G91A 5C4JH 2DY8A 1HZBA 5M3MG 1NMFA 5M9OA 3CC7A 4X62Q 4DXFA 4BBSH 1U5KA 3A8KE 2F0GA 3BVMA 1Y1VB 1M8AA 1Y14B 2B2UC 3DXJC 2C5CA 4C3HB 1PTOB 4JW0A 1ASYA 1NAPA 4C56C 4MZ9A 1R4PB 1PFSA 2HCIA 1G6ZA 5G3LD 2GN5A 1I4GA 4CDDC 3I55A 1PLFA 3K58A 1CHQD 2A6ED 2JEBI 4LWCA 4A3JH 4AIMA 3MHBA 1Z9FA 5JVH3 2WB1E 3EBEA 1IXRA 1EOTA 1C48A 4IUNA 4CDFC 4A3KG 1LUZA 4IJHA 5M3FH 1A3VA 3NXWA 3EJIA 4BBSG 3NWSA 2LSSA 2VL6A 4XXEA 1ZXTA 1T9HA 1N32L 2KOLA 1HR0Q 3FHWA 4RHRA 5EAYA 1A8VA 1GUNA 2PI2A 1EZ6A 5FO7B 5GADC 4A3JG 2NB0A 1N32Q 2K6AA 3ONAB 4EQNA 3IAYA 5E7NA 3QG1A 5KNBA 1O7IA 4JCVE 1FNVA 3MEFA 5M3FG 1S40A 4A76A 3F2UA 4BY7B 1CA5A 1KABA 1KAAA 4NKLA 2PMZE 4UP9A 1GO3E 2N49A 2L12A 4UPAA 1SJHD 3S16B 1BOSA 2VXWA 2E8GA 3KF8B 1JORA 5IIFA 4JI0L 1E2VA 4CJ0B 3P75A 4DR6L 3TBIB 4BA1I 2E2JB 1BUVT 3NUCA 3PO3B 4GKJQ 3S24A 2JA6G 4RGTA 2X6LA 4JI0Q 4A3DH 1SNQA 4PQXA 4DV0L 1RF2D 2ICEC 5JOBA 4HAEA 2F0MA 1PYWD 3RMHA 1TS2A 5C3EB 4J6HA 3VA5A 3I4MB 3D4WA 1VF7A 3BVZA 2XRQD 4DV0Q 1CSPA 1VQCA 4QIWB 3GTPH 1F9SA 1BKBA 3KDFA 1U4RA 3TP7A 1HZAA 4LMQD 3CD6A 2WAQE 5CV8A 1YJNA 4P72A 3T51B 1I6HH 2SNMA 1WTRA 2F0TA 4LNQA 4K2KA 2F4IA 1JJ2A 4A3DG 3E0EA 3HG9A 3SEBA 1PYSB 2KEEA 2PQAA 4RH6A 1PH4A 3S15H 3J7AF 2E5LL 3GTKB 2ALYB 2QKIC 1J5EL 2WB1B 4DXGA 5BR8L 4A3KB 5EKLA 3W5OA 1N9WA 2K04A 2FXQA 2B2TC 2D0PA 3M4YA 1NUCA 3G7LA 3PSIA 2A68C 1TWGH 2E5LQ 4B08A 4BBSB 1J5EQ 1MJCA 1ENAA 3F2CA 4NW2A 2UUBL 1I4HA 3T16A 1SFOH 1BVSA 1JOOA 4BXXH 4H7BA 1L2FA 4EVOA 5C6AA 4A3JB 1VQ7A 2NWGA 3MFGA 2EYFA 5ELOA 2NVTH 4KHPQ 1KRSA 5K5PA 1HFGA 3TP6A 3GTQH 1MSGA 1LTSD 2NZOA 2FMMA 3D31A 3K8AA 4JI5Q 2F1MA 1HQRD 1Y1WH 2WP8J 3W2DA 2BH2A 2UXDL 3PIP3 2MPMA 3A7AB 1PFNA 4RMFA 2PMZB 4ZCKA 4DK6C 5KNDA 3RD4A 3KLSX 4HJ7A 5TSSA 4BXXG 3AU7A 1SNCA 4RCOA 4ZAIA 4J1MA 3LWUA 3MTSA 3CPFA 4ME3A 4HIKA 1NMGA 3OIQA 3MXNA 2Z0SA 4KY6A 1Q81C 3K57A 1E2WA 1WFQA 3S1RH 3A56A 4YCWA 2I07B 1LV9A 1Q7YC 3UE1A 2PPBC 2ZTDA 5FLMH 1Y1WG 1B70B 3ERQA 3G6EA 1STNA 2YTYA 4F7XA 1WTOA 3JC66 1HNWL 2WIIB 1MD2D 4GKKL 1JE4A 4A3EH 3O13A 1K8GA 5LMNW 2LY7A 4AQYL 3I90A 4AH6A 3BS1A 3EA6A 3HGBA 1CKNB 1GJXA 1HNWQ 1NE3A 4GKKQ 1SSOA 3J7A5 4LUVA 5M5XH 3HFZB 4IFDI 1EU3A 2K5DA 3I70A 3BDOA 3G71A 3BDLA 2WAQB 4XQQA 2A68D 3A0JA 4ME5A 3S1MH 4A3DB 4BA2I 4LW1A 2VZAA 3SK8A 2FFKB 2F3IA 3NQIA 5FLMG 2AMCB 3K5NA 1N8RC 3SK5A 3VR2A 2B63G 4KHZA 1A2TA 2K5NA 1L0WA 4GNXA 4A3EG 1S5ED 1LACA 1G2TA 1JQYD 1RTNA 5E4WC 5KNCA 1SBBB 1V1QA 2MP1A 1VQBA 1IW7C 3BG3A 1EY7A 1RODA 2EDGA 3GTPB 2JA9A 4DU9A 3M4OH 1VQEA 3CCJA 1VQIA 2ZXOA 2E2IH 1I6HB 1UAPA 3HOWB 2JA8H 3HRZC 4PMWA 4X3UA 3HOYB 3I73A 1S72A 3S15B 4JOIA 4FF3A 1LTTD 5EKIA 2JN4A 2CHBD 1GHJA 3ERSX 3VYSA 1U9RA 3KOJA 1SE4A 2K03A 4K5XA 2CH4W 2CCZA 1TWGB 2HCCA 3KLSA 3RZDH 4X3KA 1XMOL 4CHTB 1PYBA 4B9WA 1BF4A 1Z6HA 1W6JA 2EPBA 1SFOB 3PUVA 2JA8G 4PZ6A 4KN7C 4IUVA 3HOXH 4IO9A 3D4DA 4YHHQ 1XMOQ 1S5DD 1CSQA 4IFDJ 1HXYD 3C3LA 1IL8A 1R4QB 3U4ZA 4HJ9A 3RLNA 2NVTB 1I4XA 1YI2A 1MIUA 1E0BA 3GTQB 2B2WA 1JWUD 1NNXA 2FHTA 1ET6A 5CV6A 4GN5A 3J7AV 4ZUIA 1WYDA 1G51A 1UNSA 5IYBH 3CCVA 3KF6A 5CMDA 4IN3A 4MTNA 4JI8Q 3U9SA 2AUKA 3J80i 2BDNA 4FXKC 3CCRA 3JAML 1V1PB 3HOXG 1DOMA 5J1ZA 2A5HA 3Q24A 4RCNA 4OIKA 2A74C 4YWMA 4ZKCB 2PCFB 4OELB 1PH5A 2UUCL 4HCEA 1CK1A 3S1RB 1IW7D 5A35A 5JEAG 1W3SA 1YHQA 1ENFA 1IBLL 2JE6I 2IX1A 1HNZQ 1TWHH 1P16A 1XPUA 5D3DA 3ICEA 2EYJA 4KN4C 3MZ5A 1TS3A 4R4CA 4G4KA 5IYBG 4A3EB 3L0OA 5ISRA 2QILA 3A8IE 2EVBA 2XTIA 3NSWA 4DK0A 1F2YA 1CFMA 3JAME 4HR7B 1HZ9A 3R8BA 4JI7L 5M5XB 2EQSA 2R93H 1VQ8A 1V8QA 1RJTA 2RBMA 3GTJH 3IRBA 2VQEQ 1HHVA 4DNRB 1SYEA 2I5LX 5F2DA 3S1MB 2D9UA 3GO5A 1J9OA 3N52A 2C9OA 1HQMC 1TS5A 4H13C 4HMJA 1K9MC 1E2ZA 4B3RL 3W1BA 5K36H 2QCPX 2SEBD 3TMEA 3T1YQ 3PUZA 2EXDA 4WFN3 4GOPA 3J80c 1Q1BA 1PDQA 2EOTA 4IPCA 3QJYA 3M7GA 2R93G 1B9MA 3OTOL 3M4OB 1LLRD 2GVAA 5BN3A 4UY8C 1K83H 2B8FA 2E2IB 2HD3A 3K6OA 4GNXC 1TQOA 1EY9A 4OL7A 2JA8B 2EYLA 1A6XA 4B9XA 5CC4A 1VQ6A 3TEHB 1PH7A 3CCUA 5K36G 5GAHC 1YZ6A 4RFBA 3S2DB 2K5HA 2PYKA 3BYYB 5C3XA 4P74A 2F0WA 2EYPA 1O7YA 1FD7D 3GDEA 2EY6A 3FRPB 2GVBA 4A3BH 4NMZA 2V4DA 5KGUA 5LMNL 4R4OA 4JOIC 4RGMA 4TVAB 3OYYA 3PIPA 2SNSA 2OF1A 4L63B 4K0KL 3BDCA 1Q46A 4GN3B 1Q82C 5LMNQ 1XMQQ 2BCOA 3SHLA 4IZ8A 3PF4A 3MFYA 5IP7H 2K5QA 1STBA 1XX8A 3SE0A 3KBXA 2B2VA 4IPDA 1EYAA 1GOZA 1Q86C 4A3BG 5FLXL 1VQ4A 4R8NA 3J81L 1SNPA 3VYTA 3I2ZA 4FF1A 2RDGA 4K6LA 2RF4A 2KENA 4UP7A 4YCVA 2B2WC 1YJ9A 2VS1A 2AWOA 1SR3A 2JXMB 5EBDA 5ELCA 1GUWA 1G2SA 5HGQA 4XQNA 4RKLA 4LFBL 1A3TA 4UDUC 1SXTA 2ZJRA 1O7LA 2GA4B 1M1KC 1KNAA 2EY5A 3NHHA 5IP7G 3HKSA 2N78A 5DNFA 1TWHB 5C4HA 4LFBQ 4EQOA 3NP8A 1RL2A 1BCPB 3C1FA 5ELDA 2H5XA 4KJOA 2H4OA 1VF5C 5FLXE 4DFAA 3J81E 1MHWC 1XPRA 2EIFA 4LF8L 1YNXA 1R9TH 1V9PA 5I9PA 1YHAA 1H9SA 2AWNA 2PI2E 5M5YB 2ENBA 1WTPA 1HFNA 1W2BA 1JB7A 1VDZA 2NTSA 2CWPA 2R93B 1HUNA 4LFAQ 1H9KA 3GTJB 4LF8Q 4A93G 1Z47A 2DJFC 4HSPA 3GTLH 1S4ZA 3MXPA 1SNMA 1PMRA 1WTWA 1S5FD 5C5LA 1IBML 1Q8IA 1TT2A 1KDCA 2A6HC 3OWFA 5ELFA 4CKCA 4ZKBB 1ML0D 5CV7A 2IHFA 1EEFD 1KNEA 4JI4L 2NYZD 3KUPA 1DYQA 3UDGA 1HCZA 1IBMQ 1F2ZA 1JE5A 2E76C 4DV5L 2E75C 5AJ3L 4H0LC 4TKOB 3K0XA 3SVMA 1XTCD 1K83B 1L0YB 3I4NH 4TSSA 2IT1A 3HOVH 3NBHA 4ZRZA 1YJWA 1VQJA 1I5FA 4K5WA 5C4XH 4GOPC 1D7QA 2C35B 3AB9A 1QZGA 5DAUA 3TQYA 1QOHA 2JEAI 4YY3Q 4CJ2C 3DWQA 4DV2L 1PH1A 1X32A 4X6AH 4QF4A 4B3SL 4DN4M 3X3MA 4M8AA 4A3CH 4R8IA 1OXUA 4A3BB 3MAQA 4QIWE 3E9IA 4F88A 4NXNL 1I50B 4M1UB 3WOFA 3HOZH 4DV2Q 3I4NG 3S1QH 4B3SQ 4NXML 3HOVG 1L1OA 3HKZG 3ULPA 1LTBD 1V43A 4A3MH 1AN8A 4R4TA 5C4XG 1VQOA 3T13A 2LS01 2ZM6L 3SR1A 3BJUA 2F0QA 3H0GH 5I6YA 4CGYB 1E22A 3H3VC 4A3CG 1DOKA 2CFMA 4HIMA 1UUPA 5T1GA 4HIDA 2ZJPA 3J81j 4LF6L 3S14H 2ZM6Q 3HOZG 2MUYA 1LTRD 4DR4L 2OQKA 3KLRA 1FJGL 2MO1A 2A6HD 1JT8A 4A3MG 2B2VC 3M3YH 1B3QA 3E5SA 2ZXRA 4DAMA 1BBUA 2MQHA 1FJGQ 1A62A 4ZYSA 2F3VA 1LTGD 2K32A 4V0BA 2Q2IA 4PMBA 3H0GG 2Y0SG 2JA6H 4WJWA 1Y69U 4OGQC 2X69A 1GVPA 5JPMC 2E2DC 4C1NI 2AKWB 2L1BA 3VR6A 2F0EA 2MGSA 1R9TB 1JMCA 1B8AA 3D3RA 4KY5A 5CBEE 1NR2A 3DWAA 1YEZA 4BBRG 3OW7A 4IPHA 1NR4A 3H6MA 2XWBB 1STYA 3GTLB 4LF4L 2JA5H 1SYDA 1BBXC 1CQFA 3NTHA 3TZDA 5DM63 4OX9L 1D1IA 4DK1A 4MN3A 4DAYA 1KD1C 2EE1A 2Z4IA 4DR6Q 4YWLA 3I91A 3RUZA 5KIXA 1FL0A 4OHJA 2PW5A 5LHY1 2R61A 4KKTA 3CPWA 3KDFB 5EPLA 5M3MB 3GTOH 4FVMA 5GAEC 4J15A 4HSVA 4AYBG 1UE6A 3I4NB 1OXTA 2JA5G 2XRSD 3A74A 3HOVB 3HKZB 4CDCC 2IJ0A 3PV0A 4DR2L 2HHHL 1E1TA 5EKKA 5C4XB 3OPOA 1G8ZD 5KRUA 4DNIA 3H3VI 3G48A 3K7AH 2YU9H 3VR5A 1YNNC 3NK9A 3M85A 1XYIA 1KC8C 3LGJA 4XT1B 4JPBW 3CMEA 3M4QA 4DR2Q 1HTLD 2MFIA 5C4JB 4RKBA 1WD0A 1EY5A 1UEAB 1C8CA 3IKJA 2J4XA 1EU4A 4PZ7A 3S1QB 5BR8Q 4C3IH 4LF7L 2OQ0A 2RDFA 3GD7A 4L5RC 1PH8A 2B3GA 4A3MB 3MA2B 2K33A 1B9NA 5IGFA 1CHPD 4XDXA 3K80C 3SK4A 5IGBA 1ICFB 4V190 4DUYL 1C0AA 1X3EA 4LF7Q 3R93A 2UUBQ 2VY3A 2OTJA 4DV1L 4NDXA 3TRZA 1LT5D 3TSSA 3H0GB 1L1OC 2V1CC 4DUYQ 5M3FB 5BN4A 4DKAC 4DV4L 2VUMH 1TKWB 1SNDA 1H9RA 3S14B 1W6KA 3QWNA 3K0YA 3NEMA 2KJXA 5IE8A 2IPKD 4C3IG 1EIGA 1Q3LA 1U4LA 4K14A 1I4RA 2K75A 2UXDQ 4LUOA 4FP5D 3VR4A 1EQRA 1TVXA 1D2BA 2VNUD 1FGBD 1SMYC 2OEOA 5CBAE 1QNUA 2JYOA 3CRKC 3LWEA 2JA6B 2TMPA 2VUMG 1FYCA 1S3OA 1N36L 1VQPA 1ASZA 1LO5D 4X66L 2L4NA 2KHSA 3CQZH 1PFMA 5IGEA 1FNWA 2D5DA 1OTCA 4NPSA 4X64L 2B63H 3DHQA 1QWYA 4EX5A 3RLOA 3TP5A 2OWOA 1N36Q 5LL6X 2YYZA 1TXYA 4X66Q 1LT3D 1A3UA 2E2HH 1YNND 2F0LA 1JJGA 4ABNA 3D0FA 3I56A 5JEAJ 4OO1G 1XNQL 3UI2A 2LKVA 1V1OA 1U4MA 2JA5B 1TWFH 1P8LA 4FYDA 1OO9B 1SYBA 4AQYQ 4KD4A 4CBVA 4BY1H 1TWAH 5IT9c 2BDOA 4GNXB 1RDPD 2JQOA 3D8GA 1SE8A 1PZID 1AE2A 3PO2H 1JCKB 2R92H 1ILPA 1VQLA 3E3XA 4P75A 1DOLA 4DGZA 5COYA 3GTOB 1SYGA 4K5VA 4DV3L 1D5ZC 5JJIA 1JWMD 4JI1L 3NBIA 1II3A 1D5MC 5A2QL
chains in the Genus database with same CATH topology
1Y8OB 4RA8A 3FPUB 1EYCA 3QIAA 2EZVA 2K1BA 2YU9B 2XWJB 3SK6A 3CKIB 3QOJA 3N6RA 1STEA 1FNUA 1SMYD 4XIGS 2B39A 4FXDA 5HGTA 3GV3A 2H1EA 5A2QE 2F0UA 3M7NA 4CJ1B 3V05A 3HZXA 1OXSC 1B50A 3FPPA 3L7ZC 4FNFA 4K8JA 3V96A 5JEAH 2VUMB 1JOQA 1IYUA 1Y1WB 2EY2A 1KDAA 3DEPA 3S9WA 3PUYA 1PZJD 2IX3A 2QF7A 3PMFA 3R3OA 2LFNA 3IL8A 1DD2A 2EXZA 3FMCA 5EJWA 5DEHA 5JPNC 2CVRA 1G291 2BA0A 2B8GA 2KCNA 3GV6A 3A55A 5KYIA 2IW3A 4RWSC 3CQZB 1QJOA 5IGDA 1IKLA 3OWEB 5IGGA 5I9OA 2HUGA 4ODGA 2NN6H 2B63B 1PXUA 1WTXA 2RA4A 4QUCA 2OXPA 2E2HB 2F03A 4DAPA 1HPCA 3OMCA 1HRJA 4KV6A 1DM0B 3W3AA 1NCVA 1A15A 2F0FA 4XYQA 1L0XB 1TWAB 1CTMA 1K8OA 2K01A 2KQ3A 1F77A 4QMGA 4G7ZC 4F8MA 4RGOS 2NN6G 1ILQA 4I65A 3PO2B 2RSOA 5ELBA 1Y8PB 3MXGA 2F0DA 1QCBD 5G3LF 5AFWA 1AP0A 1SE3A 4ZK9B 2BOSA 3VYUA 1I6VC 1YNJC 3OSOA 2NVQB 4U68A 4KTAA 5C4ZA 4G7OC 1TS4A 4G57A 1Z7TA 5EPKA 2XNAC 2Q8TA 3S2HB 1LABA 1S5CD 2RVLA 1EL0A 1CM9A 1HA6A 3D4RA 1T5EA 5I2YA 1DZ1A 3RZDB 5DM73 1MBYA 3DMUA 3MC0B 1SAPA 3TN2A 1ZYRC 3HOXB 5FK9C 1KLGD 3KK7A 2JA7B 2F0VA 3OIPA 4RAUC 1I3QB 3CRLC 1KDBA 4KI0A 5CV5A 3I8ZA 2I46A 2RQXA 2AQ3B 5E3FA 1PFBA 2LMCB 3TDQA 4C1NK 1MGSA 5C0XI 5ELEA 1WD1A 3RLFA 2KCCA 2TSSA 3FVQA 1LTAD 1IHZA 1YNJD 4PMCA 1ZKOA 5C3WA 2XIWA 1PRTF 4C3HG 1EQVA 3U9OA 1H9SB 1LT4D 3FKIB 3E0JA 1EEID 1HA5A 3EFXD 5NUCA 2J7ZA 2O4XA 2B2YA 2X6GA 2WKCA 3NE5B 3P20A 1AZQA 4K8IA 2NBFA 3I3CA 3BVGA 2DNCA 1ZYRD 2Q8RE 2K05A 4ZUJA 1MI2A 3GTGB 4DAVA 1H9MA 2PO4A 3E6ZX 1TY2A 1AZPA 4G7HC 4UAIA 1HUMA 1M4VA 1BCPF 1TWCB 4IURA 5LL6S 1OXXK 4C3JG 4I7ZC 1RTOA 1T5XD 2WACA 5JAVA 1SDFA 4MHEA 3A54A 4IQZA 1OXVA 4Q5VA 3GTMB 5E1FA 1S5BD 4XT3B 4Z9CB 3PIO3 1IYVA 2CW0C 4HCSA 4XQJA 3TZUA 1QG7A 5D65A 2L11A 3GP7A 1H9JA 5J22A 3D6CA 1JICA 4JK1C 5EPJA 2RDHA 3SXHA 1BXTA 4FF4A 2Z4HA 2F0OA 3A8JE 4OO1I 1KLUD 1WCMB 3J80L 2F3WA 1ONLA 1DJRD 1VCIA 3VYRA 2F0PA 2NZ1D 5JJZA 2BE5C 2JP1A 1TIID 3NPPA 2AQ2B 4LAAA 1O80A 1B44D 1PZKD 2KEDA 2OT2A 1Q12A 4A93B 3HEJA 1B53A 4DNTB 1IKMA 3T56B 1PRTC 4ZQ3A 4ZLTF 2XSCA 3Q6SA 3J80E 3OHXC 3C2PA 5C0XH 4WRDA 1PTOF 3T53B 1ESFA 2G9HD 3K5OA 1LTID 2EJGC 4KJNA 4QB4A 2PZTA 5J39A 3H94A 3S1NB 1HTPA 1BNZA 1RKNA 4C3JB 2QDBA 3QOLA 4R9WA 1CZGA 2PNRC 2EJFC 2CW0D 5C0XG 3Q22A 4RGNA 2EYHA 2XVSA 1O78A 2B2YC 3DM1A 5C5MA 4KK7A 3TP8A 3KF8A 1BCPC 1CI3M 4HN7A 1X3QA 5I6WA 3IFTA 3D6WA 2NTTA 3R2IA 3L9AX 2HDLA 3IFDA 1STGA 1CA6A 2BE5D 2Z8LA 1CT1D 1SYCA 3V2TA 1EZ8A 1EY4A 4L8JA 1B2TA 4FO2A 2CQAA 1LT6D 3I4LA 1PRTD 1F9PA 5KYLA 1GHKA 3HOZB 2JSOA 4KY7A 2AUJD 3BZDB 1XXGA 1F2MA 4O1NA 4Q0FA 4IUPA 2WV6D 1EY0A 1ZEQX 1ET9A 4KKUA 2Y0SB 5I2XA 4LJZC 2N55A 3T4AC 2HDMA 3S17B 3VA7A 1QILA 4YIJA 2AQ1B 1DONA 2D2CC 2SOBA 2FJ2A 4BWGB 3M3YB 1TY0A 2K7VA 1EIHA 4BBRB 2NN6I 4DF7A 5KEEA 4XYOA 4OO1H 1EY8A 1VMPA 3C46A 2M9VA 4GZYC 5CV9A 1VMCA 1BCPD 4XTCS 1PTOC 2A69C 3EQLC 1SNOA 3H09A 4IALA 1AFPA 2FMCA 2HQEA 1QE6A 3C1EA 4IUTA 5FOBB 1D5XC 1TR5A 2PQEA 4HEDA 5EBCA 4AYBB 1WTVA 2ZXPA 5C44B 2MHVA 3GQBA 3NWTA 4FXGC 3MXUA 5CORA 4IUUA 3I72A 2XN9C 4QUFA 3DUZA 4L6TB 3Q23A 4X3SA 2EYOA 3CHBD 1SEBD 5EGTA 3K7AB 1RCVD 2WINB 5FO8B 5EQ0A 3NTKA 5IODA 2E74C 5E4XA 5HURA 1XWEA 3L3OC 2R6GA 1PTOD 4C3IB 3PUWA 1ICWA 3K5LA 2M00A 1AEXA 2A69D 5BN5A 4KD3A 1Q90A 5CV4A 3P7JA 4IUQA 4P2CB 4K6DA 1I4QA 2MJ8A 2N88A 4A3GB 2DN8A 3K5MA 2ZT9C 4EGVA 3EROA 2R3ZA 1JC7A 3MWYW 3SDZA 2PZWA 2K28A 2R7ZB 4J8QA 1GUTA 2A73B 4N9PA 2L5TA 2M2LA 1JB3A 4PNYA 5JVG3 1F9RA 5D14A 2F0SA 2Q8IB 3FDTA 4OIJA 3VR3A 1GXDC 4CKEA 5M5WB 3ITPA 3CU7A 1EFID 3DWPA 1KTKA 1V1PA 2WKDA 2L55A 1X3PA 2BA1A 1TWFB 1TU2B 3A7LA 3HS0C 2NVXB 4ID6A 1NSNS 4BY1B 4K2LA 1STAA 1QNKA 4U673 1CZWA 1BQQT 2F0NA 1CQVA 2R92B 5FKAC 3QO2A 3HP3A 3J7YW 1Q1EA 3KBGA 4KMUC 1I4PA 3G6JB 5CGKA 4ULLA 2K5WA 4NP5A 2O5JC 2IX0A 1U4PA 3MEHA 3MVVA 3QB3A 2IWHA 2NVYB 1D1KA 2RKSA 1EWHA 4WORA 5T1IA 4IFDH 4E6IA 4Y7NB 2KECA 1MSHA 4KHVA 3ND9A 2O5IC 1ENCA 3H91A 3NTIA 4F87A 1AW7A 1D6EC 4X3TA 3URYA 4CKBA 3ND8A 4O42A 4S3SA 2QEJC 5CR3A 2PW7A 1JOKA 3LNNA 4IFDG 2B2UA 5IT9L 1EWCA 3HOUB 4A3FB 2KA7A 1DXMA 1QB5D 1A2UA 5CYUA 4C2MB 3LX0A 3X3NA 1PRTB 4JBWA 1PTOH 3K59A 4HTHA 1JR0D 1F9QA 2RSNA 4PV1C 1SYFA 1BR9A 2L9HA 4LK1C 5IT9E 3ZYYX 2D62A 4TRDA 1STHA 4EQPA 3OOCA 1O7ZA 1ESRA 3R2TA 2J0TD 1J8IA 2IL8A 2VB2X 2KVMA 1GUOA 3RZOB 1DCZA 1WTQA 3PUXA 1F2LA 2ICIA 1EY6A 4N9TA 1BO0A 1SJED 2G9DA 4RHSA 3P1HA 2L0CA 2NUCA 2F0JA 1RD9D 2A6EC 5IOCA 4ILWA 3Q0AA 2EJMA 1BDOA 3WOEA 5FO9B 2KUMA 1EYDA 1Y8NB 1JWSD 4KKSA 3BYTB 1RHPA 2VB3X 4A3IB 4FF2A 3DEOA 3FEWX 3NQTA 3WDNA 2DNEA 1C4QA 2F0HA 1B1ZA 2F0IA 3EVQA 5C0XJ 4MIUA 1GUGA 2EYMA 2ID0A 2PZUA 1FR3A 2EY1A 4H44C 4TQUS 5D3IB 2FINB 4BS9A 1GUSA 5I4DA 3AMUA 2SDFA 3OMGA 2B2TA 5IGCA 1SE2A 1EQTA 2F0KA 4DA2A 1B4OA 2DY7A 1B3AA 4HMIA 2O2LD 1K8MA 2Z1CA 1WVLA 4QCLA 1G91A 2DY8A 5M9OA 4DXFA 3A8KE 2F0GA 3BVMA 1Y1VB 1M8AA 2B2UC 3DXJC 2C5CA 4C3HB 1PTOB 1NAPA 4C56C 1R4PB 2HCIA 1G6ZA 5G3LD 1I4GA 1PLFA 3K58A 1CHQD 2A6ED 2JEBI 3MHBA 5JVH3 1EOTA 1C48A 4IUNA 1A3VA 3NXWA 3EJIA 3NWSA 4XXEA 1ZXTA 2KOLA 4RHRA 1GUNA 5FO7B 1EZ6A 2NB0A 2K6AA 3ONAB 4EQNA 3IAYA 3QG1A 5KNBA 1FNVA 3F2UA 4BY7B 1CA5A 1KABA 1KAAA 4NKLA 2L12A 1SJHD 3S16B 1BOSA 2VXWA 1JORA 5IIFA 1E2VA 4CJ0B 3P75A 3TBIB 4BA1I 2E2JB 1BUVT 3NUCA 3PO3B 4RGTA 2X6LA 1SNQA 4PQXA 1RF2D 2ICEC 5JOBA 4HAEA 2F0MA 1PYWD 3RMHA 1TS2A 5C3EB 4J6HA 3VA5A 3I4MB 3D4WA 1VF7A 3BVZA 2XRQD 4QIWB 1F9SA 1U4RA 3TP7A 4LMQD 5CV8A 3T51B 2SNMA 1WTRA 2F0TA 4K2KA 2F4IA 3HG9A 3SEBA 2KEEA 4RH6A 3J7AF 3GTKB 2QKIC 2WB1B 4DXGA 4A3KB 5EKLA 2K04A 2B2TC 3M4YA 1NUCA 3G7LA 2A68C 4B08A 4BBSB 1ENAA 4NW2A 1I4HA 3T16A 1JOOA 4H7BA 4EVOA 5C6AA 4A3JB 2NWGA 3MFGA 2EYFA 5K5PA 1HFGA 3TP6A 1MSGA 1LTSD 2FMMA 3D31A 2F1MA 1HQRD 2WP8J 3W2DA 3PIP3 2MPMA 3A7AB 1PFNA 2PMZB 5KNDA 3RD4A 3KLSX 5TSSA 3AU7A 1SNCA 4RCOA 4ZAIA 4J1MA 3LWUA 3MTSA 3OIQA 3MXNA 4KY6A 3K57A 1E2WA 3A56A 2I07B 1LV9A 2PPBC 3ERQA 1STNA 4F7XA 1WTOA 2WIIB 1MD2D 1JE4A 3O13A 2LY7A 3I90A 3BS1A 3EA6A 3HGBA 1GJXA 1SSOA 3NBIA 4IFDI 1EU3A 2K5DA 3I70A 3BDOA 3BDLA 2WAQB 4XQQA 2A68D 4ME5A 4A3DB 4BA2I 3SK8A 2FFKB 3NQIA 3K5NA 3SK5A 3VR2A 4KHZA 1A2TA 1S5ED 1LACA 1G2TA 1JQYD 1RTNA 5E4WC 5KNCA 1SBBB 2MP1A 1IW7C 3BG3A 1EY7A 1RODA 2EDGA 3GTPB 4DU9A 2ZXOA 1I6HB 1UAPA 3HOWB 3HRZC 4PMWA 4X3UA 3HOYB 3I73A 3S15B 4FF3A 1LTTD 5EKIA 2CHBD 1GHJA 3VYSA 1U9RA 1SE4A 2K03A 4K5XA 1TWGB 2HCCA 3KLSA 4X3KA 4CHTB 4B9WA 1BF4A 1Z6HA 1W6JA 2EPBA 1SFOB 3PUVA 4KN7C 4IUVA 3D4DA 1S5DD 4IFDJ 1HXYD 3C3LA 1IL8A 1R4QB 2NVTB 1I4XA 1E0BA 3GTQB 2B2WA 1JWUD 2FHTA 1ET6A 5CV6A 3J7AV 4ZUIA 1UNSA 5CMDA 4IN3A 3U9SA 2AUKA 2BDNA 4FXKC 3JAML 1V1PB 1DOMA 5J1ZA 2A5HA 3Q24A 4RCNA 4OIKA 2A74C 4ZKCB 2PCFB 4HCEA 1CK1A 3S1RB 1IW7D 5A35A 5JEAG 1ENFA 2IX1A 2JE6I 5D3DA 2EYJA 4KN4C 3MZ5A 1TS3A 4G4KA 4A3EB 5ISRA 2QILA 3A8IE 2EVBA 3NSWA 4DK0A 1F2YA 1CFMA 3JAME 4HR7B 3R8BA 5M5XB 1V8QA 1RJTA 2RBMA 1HHVA 4DNRB 1SYEA 5F2DA 3S1MB 2D9UA 3GO5A 1J9OA 3N52A 2C9OA 1HQMC 1TS5A 4H13C 4HMJA 1E2ZA 5K36H 2QCPX 2SEBD 3TMEA 3PUZA 4WFN3 1Q1BA 1PDQA 2EOTA 3QJYA 3M7GA 1B9MA 3M4OB 1LLRD 5BN3A 2B8FA 2E2IB 3K6OA 1TQOA 1EY9A 4OL7A 2JA8B 2EYLA 1A6XA 4B9XA 5CC4A 5K36G 4RFBA 3S2DB 2PYKA 3BYYB 5C3XA 2F0WA 2EYPA 1O7YA 1FD7D 2EY6A 3FRPB 4NMZA 2V4DA 5KGUA 4RGMA 2SNSA 2OF1A 4L63B 3BDCA 2BCOA 3SHLA 4IZ8A 3MFYA 2K5QA 1STBA 1XX8A 3SE0A 3KBXA 2B2VA 1EYAA 1GOZA 5FLXL 4R8NA 3J81L 1SNPA 3VYTA 4FF1A 2RDGA 4K6LA 2B2WC 2AWOA 2JXMB 5EBDA 5ELCA 1GUWA 1G2SA 4XQNA 4RKLA 1A3TA 4UDUC 1SXTA 1O7LA 2GA4B 1KNAA 2EY5A 3NHHA 5DNFA 1TWHB 5C4HA 4EQOA 3NP8A 1BCPB 3C1FA 5ELDA 4KJOA 2H4OA 1VF5C 5FLXE 4DFAA 3J81E 5I9PA 1H9SA 2AWNA 5M5YB 2ENBA 1WTPA 1HFNA 1VDZA 2NTSA 2R93B 1HUNA 1H9KA 3GTJB 1Z47A 4HSPA 1S4ZA 3MXPA 1SNMA 1PMRA 1WTWA 1S5FD 5C5LA 1Q8IA 1TT2A 1KDCA 2A6HC 4ZKBB 3OWFA 5ELFA 4CKCA 1ML0D 5CV7A 1EEFD 1KNEA 2NYZD 3KUPA 1DYQA 1HCZA 1F2ZA 2E76C 2E75C 4H0LC 4TKOB 3SVMA 1XTCD 1K83B 1L0YB 4TSSA 2IT1A 3NBHA 4ZRZA 4K5WA 3AB9A 5DAUA 1QOHA 2JEAI 4CJ2C 3DWQA 1X32A 4QF4A 4DN4M 3X3MA 4M8AA 4R8IA 1OXUA 4A3BB 3MAQA 4F88A 1I50B 4M1UB 3WOFA 1LTBD 1V43A 1AN8A 3T13A 2LS01 3SR1A 2F0QA 5I6YA 4CGYB 3H3VC 1DOKA 1UUPA 5T1GA 2MUYA 1LTRD 3KLRA 2A6HD 2B2VC 3E5SA 2ZXRA 4ZYSA 2F3VA 1LTGD 2K32A 4V0BA 4PMBA 4WJWA 1Y69U 4OGQC 2X69A 5JPMC 2E2DC 4C1NI 2L1BA 3VR6A 2F0EA 2MGSA 1R9TB 3D3RA 4KY5A 5CBEE 1NR2A 3DWAA 3OW7A 1NR4A 3H6MA 2XWBB 1STYA 3GTLB 1SYDA 1BBXC 1CQFA 3TZDA 5DM63 1D1IA 4DK1A 4MN3A 4DAYA 2EE1A 2Z4IA 3I91A 3RUZA 5KIXA 4OHJA 2PW5A 5LHY1 2R61A 4KKTA 5EPLA 5M3MB 4FVMA 4HSVA 3I4NB 1OXTA 2XRSD 3HOVB 3HKZB 2IJ0A 3PV0A 5EKKA 5C4XB 3OPOA 1G8ZD 5KRUA 3VR5A 1YNNC 3NK9A 3M85A 1XYIA 4XT1B 1HTLD 5C4JB 4RKBA 1WD0A 1EY5A 1UEAB 1C8CA 3IKJA 2J4XA 1EU4A 3S1QB 2RDFA 3GD7A 4A3MB 3MA2B 2K33A 1B9NA 5IGFA 1CHPD 4XDXA 3SK4A 5IGBA 4V190 3R93A 4NDXA 1LT5D 3TSSA 3H0GB 5M3FB 5BN4A 1TKWB 1SNDA 1H9RA 3S14B 1W6KA 3QWNA 3K0YA 2KJXA 2IPKD 4C3IG 1EIGA 1Q3LA 1U4LA 4K14A 1I4RA 4FP5D 3VR4A 1TVXA 1D2BA 2VNUD 1FGBD 1SMYC 2OEOA 5CBAE 1QNUA 2JYOA 3CRKC 3LWEA 2JA6B 2TMPA 1FYCA 1LO5D 2L4NA 2KHSA 1PFMA 5IGEA 1FNWA 2D5DA 3DHQA 1QWYA 3TP5A 5LL6X 2YYZA 1LT3D 1A3UA 1YNND 2F0LA 4ABNA 5JEAJ 4OO1G 3UI2A 2LKVA 1V1OA 1U4MA 2JA5B 4FYDA 1OO9B 1SYBA 4KD4A 4CBVA 2BDOA 1RDPD 3D8GA 1PZID 1JCKB 1ILPA 1DOLA 4DGZA 5COYA 3GTOB 1SYGA 4K5VA 1D5ZC 1JWMD 3NTHA 1II3A 1D5MC 5A2QL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6A A;  2FMC A;  2LFN A; 
#chains in the Genus database with same CATH topology
 1Y8O B;  4RA8 A;  3FPU B;  1EYC A;  3QIA A;  2EZV A;  5GRO A;  1K3B C;  3Q8D A;  3AFQ A;  4DV3 Q;  4BY1 G;  3S2H H;  2K1B A;  4JI1 Q;  4HIO A;  3ULJ A;  4Y7N H;  2YU9 B;  1LM0 A;  2KCM A;  2XWJ B;  3SK6 A;  3PO2 G;  3CKI B;  3QOJ A;  3N6R A;  2R92 G;  4JI3 L;  1STE A;  5H1S E;  4UHV A;  1FNU A;  4L5T A;  1SMY D;  4XIG S;  2B39 A;  4FXD A;  5HGT A;  3GV3 A;  3CCE A;  2H1E A;  5A2Q E;  2F0U A;  3M7N A;  3H3V H;  4CJ1 B;  4KLK A;  2RCN A;  3V05 A;  2JJQ A;  1DGS A;  3HZX A;  1OXS C;  2HQL A;  1B50 A;  3FPP A;  2UUA L;  1KL9 A;  2IY5 B;  2D0O A;  3L7Z C;  4FNF A;  4JC0 A;  4K8J A;  3V96 A;  2OCE A;  4MTK A;  4DPG A;  2JA7 H;  5JEA H;  3A5U A;  2VUM B;  1JOQ A;  2UUA Q;  1IYU A;  4C2M H;  3KF6 B;  1I3Q H;  2EY2 A;  1Y1W B;  1KDA A;  3U4V A;  1K73 C;  2ASB A;  3DEP A;  3K7U C;  3S9W A;  3PUY A;  1PZJ D;  2IX3 A;  2A19 A;  2QF7 A;  3PMF A;  4DUZ L;  3R3O A;  1KRT A;  2LFN A;  3AQQ A;  5FJ8 H;  4OWX B;  3IL8 A;  1DD2 A;  2EXZ A;  3FMC A;  5EJW A;  5DEH A;  5JPN C;  2CVR A;  1G29 1;  2BA0 A;  3PF5 A;  3UDI A;  3VDY A;  2JA7 G;  2B8G A;  2KCN A;  3GV6 A;  3A55 A;  5KYI A;  2IW3 A;  4RWS C;  3CQZ B;  1QJO A;  5IGD A;  1IKL A;  3OWE B;  1U0L A;  3NEL A;  2UUC Q;  5IGG A;  3UDF A;  2HUG A;  4ODG A;  2NN6 H;  5I9O A;  2B63 B;  1PXU A;  1H95 A;  1WTX A;  2RA4 A;  1IBL Q;  5FJ8 G;  3RZO H;  4QUC A;  2OXP A;  1VQF A;  1VQM A;  2E2H B;  4UP8 A;  1YVC A;  2Q2H A;  3FKI H;  1YIJ A;  2F03 A;  3OW2 A;  1WOC A;  2QEX A;  4DAP A;  1HPC A;  3OMC A;  1HRJ A;  4KV6 A;  1DM0 B;  3J7Z C;  5IYC H;  3W3A A;  1NCV A;  1A15 A;  4DV7 L;  2F0F A;  4XYQ A;  1AE3 A;  1L0X B;  1TWA B;  1CTM A;  4JI7 Q;  2QW7 A;  1K8O A;  2K01 A;  2KQ3 A;  3T1H L;  1F77 A;  4PG3 A;  4QMG A;  4G7Z C;  4F8M A;  4QJF A;  2NN6 G;  1ILQ A;  4RGO S;  4IOA A;  4I65 A;  3PO2 B;  2RSO A;  5ELB A;  1Y8P B;  2P5Z X;  3MXG A;  4GOP B;  2F0D A;  3GTG H;  1QCB D;  5G3L F;  5AFW A;  1AP0 A;  1SE3 A;  4ZK9 B;  2BOS A;  3VYU A;  3FKI G;  3CW2 C;  5JJK A;  1I6V C;  3EN2 A;  4B3R Q;  1YNJ C;  3OSO A;  2AHO B;  2NVQ B;  4U68 A;  4KTA A;  1YIT A;  1EQQ A;  4B3T L;  5C4Z A;  4QQB X;  1SLJ A;  5IYC G;  4POG A;  4G7O C;  1TS4 A;  4G57 A;  1Z7T A;  5EPK A;  4OXP A;  1N34 L;  3STB C;  3L2P A;  2XNA C;  3M9B A;  2Q8T A;  1TWC H;  3S2H B;  1LAB A;  1S5C D;  3OTO Q;  4LF5 L;  3I4O A;  2RVL A;  1N34 Q;  1EL0 A;  1CM9 A;  3ER0 A;  5L37 A;  1GD7 A;  1HA6 A;  3D4R A;  1T5E A;  3TRE A;  4LF5 Q;  5I2Y A;  1DZ1 A;  1EYG A;  4X65 L;  3RZD B;  5DM7 3;  3GTM H;  1KAW A;  1MBY A;  3DMU A;  3MC0 B;  1SAP A;  3TN2 A;  3FP9 A;  1ZYR C;  1X9N A;  3HOX B;  1VQN A;  1HJP A;  4O0A A;  5FK9 C;  3CCS A;  1KLG D;  3KK7 A;  2UU9 L;  4K0K Q;  2Z9H A;  2JA7 B;  1E7Z A;  2F0V A;  1IBK L;  4P73 A;  3OIP A;  4RAU C;  1I3Q B;  3CRL C;  3WWV A;  1KDB A;  4LUZ A;  1WCM H;  4KI0 A;  5CV5 A;  3I8Z A;  3H15 A;  2I46 A;  2Q2T A;  2RQX A;  2ZTC A;  1C9O A;  2AQ3 B;  3CCQ A;  5E3F A;  5LMU L;  1PFB A;  2LMC B;  3TDQ A;  4C1N K;  1MGS A;  5C0X I;  2Z6B A;  4DR5 L;  5IYD H;  1UWV A;  5ELE A;  1WD1 A;  4A93 H;  3RLF A;  1A63 A;  2ES2 A;  2KCC A;  2TSS A;  3FVQ A;  1LTA D;  4R4Q A;  1IHZ A;  3KYH C;  1YNJ D;  4O2D A;  4PMC A;  1JJC B;  1ZKO A;  1Y1V G;  1WCM G;  5C3W A;  1K8A C;  2XIW A;  3NEN A;  1PRT F;  3STB D;  4C3H G;  1EQV A;  3U9O A;  1H9S B;  2Q2U A;  1EIY B;  4JG2 A;  1PH6 A;  2I5H A;  1LT4 D;  4YCU A;  3FKI B;  3E0J A;  2YV5 A;  1EEI D;  5IYD G;  3PGZ A;  1HA5 A;  3EFX D;  5NUC A;  3S1N H;  1QUQ A;  2J7Z A;  2O4X A;  2B2Y A;  4WJ4 A;  3PQI A;  2X6G A;  2WKC A;  3NE5 B;  3P20 A;  1AZQ A;  4C3J H;  4K8I A;  2IHE A;  2NBF A;  3I3C A;  1SMX A;  3BVG A;  2DNC A;  1ZYR D;  2Q8R E;  2K05 A;  4ZUJ A;  1MI2 A;  1CKO A;  3GTG B;  3S16 H;  1PVO A;  4DAV A;  1H9M A;  2YTX A;  2E2J H;  2PO4 A;  3E6Z X;  3PO3 H;  1TY2 A;  1AZP A;  4G7H C;  4UAI A;  4JI4 Q;  1HUM A;  2K14 A;  1M4V A;  3NBH B;  1BCP F;  4DV5 Q;  1TWC B;  4IUR A;  5LL6 S;  5IWA L;  5AJ3 Q;  1OXX K;  4C3J G;  1AH9 A;  1WI5 A;  4I7Z C;  2QA4 A;  1K0S A;  1RTO A;  4JBM A;  1T5X D;  2WAC A;  1E3P A;  5JAV A;  1SDF A;  4MHE A;  2RHS B;  3RN5 A;  5IWA Q;  3A54 A;  4IQZ A;  1NTG A;  1OXV A;  4Q5V A;  3GTM B;  3PO3 G;  4I7A A;  5E1F A;  1L1O B;  1S5B D;  4XT3 B;  4Z9C B;  3PIO 3;  1IYV A;  1WTH A;  2CW0 C;  3HKZ E;  3F8T A;  1VQ5 A;  4HCS A;  4XQJ A;  3TZU A;  1Q8K A;  1QG7 A;  5D65 A;  4NXN Q;  2L11 A;  3GP7 A;  1H9J A;  5J22 A;  4X62 L;  4JI6 L;  3D6C A;  4NXM Q;  2MO0 A;  1JIC A;  3B6Y A;  4JK1 C;  2RDH A;  5EPJ A;  5IY0 A;  3SXH A;  1BXT A;  1VQG A;  4FF4 A;  4HJ8 A;  2Z4H A;  2F0O A;  4JI6 Q;  3A8J E;  4OO1 I;  1KLU D;  1WCM B;  3J80 L;  2F3W A;  1QVF A;  1ONL A;  3S17 H;  4A4I A;  1DJR D;  1K28 A;  1VCI A;  3VYR A;  4PZ8 A;  2F0P A;  2NZ1 D;  5JJZ A;  1MJE A;  2BE5 C;  2JP1 A;  3CMA A;  1TII D;  3NPP A;  2AQ2 B;  3ZJY C;  4LAA A;  3UDX A;  1O80 A;  1B44 D;  1PZK D;  2R7D A;  1E1O A;  4LF6 Q;  2KED A;  2OT2 A;  4BBR H;  2WB1 G;  4DR3 L;  1Q12 A;  4A93 B;  3HEJ A;  4DR4 Q;  3CCM A;  1B53 A;  4DNT B;  1IKM A;  4QY7 A;  3T56 B;  1PRT C;  4ZQ3 A;  1HR0 L;  4HJA A;  2Y0S E;  4ZLT F;  3CC4 A;  3W1G A;  4DR3 Q;  2NVQ H;  2XSC A;  3Q6S A;  4EQ5 A;  3J80 E;  3OHX C;  3C2P A;  5C0X H;  1XPO A;  4WRD A;  1PTO F;  3T53 B;  2K4K A;  3U50 C;  1X6O A;  1NJI C;  1QZH A;  1ESF A;  2G9H D;  2N3S A;  3K5O A;  1LTI D;  2EJG C;  3JAM i;  4KJN A;  4QB4 A;  2PZT A;  5J39 A;  3H94 A;  3S1N B;  1UE7 A;  4DAY B;  4CDE C;  1HTP A;  1BNZ A;  1RKN A;  4C3J B;  2QDB A;  3QOL A;  4R9W A;  1CZG A;  2PNR C;  2EJF C;  4LF4 Q;  2CW0 D;  5C0X G;  3Q22 A;  4RGN A;  4GKJ L;  2EYH A;  5C44 H;  2XVS A;  1O78 A;  2CH4 A;  2I0Q A;  4GN4 B;  4OX9 Q;  2B2Y C;  3DM1 A;  2MNA A;  5C5M A;  4KK7 A;  3TP8 A;  2R7F A;  3KF8 A;  1BCP C;  1CI3 M;  4HN7 A;  2ZJQ A;  1IYJ B;  1X3Q A;  5I6W A;  4AYB E;  2UXC L;  3IFT A;  1RIP A;  3D6W A;  1I94 L;  2NTT A;  3R2I A;  3L9A X;  3CP0 A;  2PQA B;  1MKH A;  3ULL A;  1EWI A;  2HDL A;  2HIV A;  3KJP A;  3IFD A;  2UXC Q;  4LFC L;  1STG A;  4GLA C;  1CA6 A;  3AYH B;  1I94 Q;  2BE5 D;  2Z8L A;  5C44 G;  1EUJ A;  1EOV A;  1CT1 D;  1IL2 A;  1SYC A;  2DJG C;  1EZ8 A;  3V2T A;  1EY4 A;  2KCT A;  4L8J A;  1B2T A;  4FO2 A;  2HHH Q;  2CQA A;  1LT6 D;  5J3B A;  4LFC Q;  3I4L A;  5GAG C;  3JAM c;  1PRT D;  1F9P A;  1HZC A;  5KYL A;  2WAQ G;  1GHK A;  3HOZ B;  1X56 A;  3HOW H;  2KHI A;  2JSO A;  2N8N A;  5IP9 H;  4KY7 A;  3HOY H;  2AUJ D;  1FVI A;  3BZD B;  1G6P A;  1XXG A;  1F2M A;  2DGY A;  3CCL A;  4O1N A;  3CF5 A;  4Q0F A;  1IZ6 A;  2WV6 D;  4IUP A;  1XTD A;  1EY0 A;  1VQD A;  3AEV A;  2UXB L;  2LXK A;  1WJJ A;  1ZEQ X;  4L5S A;  1ET9 A;  2JK8 A;  1X54 A;  2A1A A;  4KKU A;  2Y0S B;  3RR5 A;  5I2X A;  4LJZ C;  4LF9 L;  2UXB Q;  2N55 A;  3T4A C;  2HDM A;  4DV1 Q;  3S17 B;  4A3G H;  3VA7 A;  3HOW G;  4KHP L;  5IP9 G;  1QIL A;  4YIJ A;  2AQ1 B;  3HOY G;  2D2C C;  2LXJ A;  1DON A;  4LF9 Q;  2SOB A;  4DV4 Q;  2FJ2 A;  4JI5 L;  2R7Z H;  4BWG B;  3M3Y B;  1TY0 A;  2K7V A;  1EIH A;  4BBR B;  3MXN B;  2NN6 I;  4DF7 A;  5KEE A;  3CAM A;  4XYO A;  1EY8 A;  1VMP A;  3C46 A;  4OO1 H;  2M9V A;  2F4V L;  4GZY C;  5CV9 A;  4NB3 A;  1VMC A;  1BCP D;  4XTC S;  1PTO C;  3KJO A;  3M4P A;  4IOC A;  2A69 C;  3EQL C;  1SNO A;  5ELN A;  3H09 A;  4IAL A;  2F4V Q;  1AFP A;  5M5W H;  4N8X 1;  2FMC A;  2HQE A;  4A3G G;  3J81 i;  1QE6 A;  3C1E A;  4IUT A;  4APV A;  5FOB B;  2R7Z G;  1D5X C;  1TR5 A;  2PQE A;  3BZK A;  4HED A;  5EBC A;  4X64 Q;  1UE1 A;  2ATW A;  1SRU A;  3G4S A;  4AYB B;  1WTV A;  5JJL A;  2ZXP A;  4POF A;  4L5Q A;  2DUD A;  2NVX H;  1XNQ Q;  1VQH A;  4MNO A;  2BH8 A;  5C44 B;  2WFW A;  2MHV A;  4DR1 L;  3GQB A;  3NWT A;  4FXG C;  3MXU A;  5COR A;  4IUU A;  3U58 A;  3I72 A;  2K50 A;  1HNX L;  1E24 A;  1CKN A;  2XN9 C;  2RHQ B;  3RN2 A;  4DR1 Q;  4QUF A;  1PH9 A;  3DUZ A;  1HNX Q;  1XNR L;  3PIO A;  5DLQ E;  4L6T B;  3Q23 A;  4X3S A;  2EYO A;  2NVY H;  3CHB D;  1SEB D;  5EGT A;  3K7A B;  1RCV D;  2WIN B;  1XNR Q;  1LTL A;  5FO8 B;  5EQ0 A;  3NTK A;  5FLX c;  3J81 c;  5IOD A;  3F2B A;  3KLW A;  2E74 C;  5GQO A;  5E4X A;  5HUR A;  1XWE A;  1KHI A;  3L3O C;  2R6G A;  3QR8 A;  1GKH A;  4JI3 Q;  1PTO D;  4C3I B;  3PUW A;  1ICW A;  3K5L A;  2M00 A;  1AEX A;  1PHJ A;  2A69 D;  4IPG A;  4DV6 L;  3TS0 A;  4JV5 L;  1K0R A;  5BN5 A;  1KIX A;  4KD3 A;  1Q90 A;  5CV4 A;  3P7J A;  4IUQ A;  4P2C B;  3S2D H;  3DM3 A;  3HOU H;  4DV6 Q;  4K6D A;  4JV5 Q;  1LYL A;  4A3F H;  4YHH L;  1I4Q A;  2PNH A;  2MJ8 A;  1UE5 A;  2N88 A;  4DK3 C;  4A3G B;  4H02 A;  2DN8 A;  3K5M A;  2ZT9 C;  4EGV A;  3ERO A;  2R3Z A;  1JC7 A;  3MWY W;  3SDZ A;  2PZW A;  2K28 A;  2R7Z B;  2K5V A;  4J8Q A;  2CQO A;  1EIF A;  1PH3 A;  1GUT A;  1K3R A;  2A73 B;  4N9P A;  2L15 A;  4A75 A;  4OWT B;  2L5T A;  2M2L A;  1JB3 A;  4DUZ Q;  4JI8 L;  3HOU G;  4PNY A;  1VS0 A;  1F9R A;  5D14 A;  5JVG 3;  2F0S A;  4A3F G;  2Q8I B;  3FDT A;  4OIJ A;  2A8V A;  1QVG A;  3VR3 A;  1GXD C;  4CKE A;  5M5W B;  1CKM A;  1X55 A;  3ITP A;  3CU7 A;  1EFI D;  1HNZ L;  3DWP A;  1KTK A;  1V1P A;  2WKD A;  2QDL A;  2ZTE A;  4FDB A;  1PV4 A;  2L55 A;  4JBJ A;  1X3P A;  4R4I A;  1X65 A;  2BA1 A;  1TWF B;  4GS3 A;  1TU2 B;  2Z6K A;  3A7L A;  3HS0 C;  1KQS A;  2NVX B;  4ID6 A;  1NSN S;  4BY1 B;  4Y52 H;  2KBN A;  4K2L A;  2VQE L;  4ALP A;  1PH2 A;  1STA A;  1QNK A;  3SGI A;  5M5Y H;  4U67 3;  1CZW A;  1BQQ T;  2F0N A;  1CQV A;  4DV7 Q;  2R92 B;  5FKA C;  3UE0 A;  3QO2 A;  3K81 C;  3HP3 A;  3J7Y W;  1Q1E A;  3T1H Q;  3KBG A;  4KMU C;  1I4P A;  4A3I H;  3G6J B;  4JI2 L;  5CGK A;  4ULL A;  4IJL A;  2K5W A;  4NP5 A;  3TS2 A;  2O5J C;  3CC2 A;  2F52 A;  3T1Y L;  2IX0 A;  1B7Y B;  1U4P A;  3MEH A;  2OTL A;  3MVV A;  4JI2 Q;  3QB3 A;  3F1Z A;  2IWH A;  2NVY B;  3F2D A;  1D1K A;  2RKS A;  2CKZ B;  1EWH A;  4WOR A;  5T1I A;  4IFD H;  4E6I A;  4Y7N B;  2KEC A;  4B3T Q;  1HR0 W;  1MSH A;  2CWA A;  4KHV A;  3ND9 A;  2O5I C;  1ENC A;  3H91 A;  2K52 A;  3NTI A;  4F87 A;  3AFP A;  1AW7 A;  1D6E C;  4X3T A;  4A3I G;  3URY A;  4CKB A;  3ND8 A;  1QVC A;  4O42 A;  4S3S A;  2QEJ C;  1A0I A;  4B3M L;  1SN8 A;  2HIX A;  5CR3 A;  5HY6 A;  2PW7 A;  3RNU A;  3PCO B;  1CUK A;  1JOK A;  4JVZ A;  4X65 Q;  3LNN A;  4B3M Q;  4IFD G;  2B2U A;  2QGQ A;  2YTV A;  5IT9 L;  1EWC A;  3KFU A;  3HOU B;  1D8L A;  1J6Q A;  1XJV A;  1PA6 A;  1NBW A;  4DR7 L;  4A3F B;  2KA7 A;  1XMQ L;  1I50 H;  1DXM A;  1QB5 D;  1A2U A;  5CYU A;  4C2M B;  3LX0 A;  3X3N A;  1PRT B;  2NZH A;  1Y1V H;  2UU9 Q;  4JBW A;  4GLX A;  4DR7 Q;  4C3H H;  1PTO H;  3A5Z B;  3K59 A;  4HTH A;  1IBK Q;  1JR0 D;  1F9Q A;  2RSN A;  4PV1 C;  1SYF A;  1BR9 A;  2L9H A;  1YBY A;  4LK1 C;  3CXC A;  1X3F A;  5IT9 E;  1EFW A;  3ZYY X;  2D62 A;  3EIV A;  3I7F A;  4N8F A;  4TRD A;  1C7Y A;  5LMU Q;  1STH A;  4GLV B;  4EQP A;  4JYA L;  4RG1 A;  3OOC A;  1O7Z A;  1ESR A;  1VQK A;  3R2T A;  2J0T D;  4DR5 Q;  4YWK A;  4WJ3 M;  1VQA A;  1J8I A;  4JYA Q;  2IL8 A;  2VB2 X;  2KVM A;  1GUO A;  4OWW B;  3RZO B;  1DCZ A;  2KHJ A;  1WTQ A;  3PUX A;  1FGU A;  1VQ9 A;  1F2L A;  1SRO A;  1QUQ B;  4A3L H;  2ICI A;  4JBK A;  1EY6 A;  2G5D A;  4OEM B;  2B29 A;  4N9T A;  4QL5 A;  1BO0 A;  1SJE D;  2G9D A;  4RHS A;  3P1H A;  4BY7 H;  2L0C A;  2NUC A;  4LFA L;  1HH2 P;  4R1J A;  2F0J A;  1M90 C;  1RD9 D;  2A6E C;  5IOC A;  4ILW A;  3Q0A A;  2EJM A;  1BBW A;  1BDO A;  1YHB A;  3WOE A;  5FO9 B;  2KUM A;  2HT1 A;  1EYD A;  2Z6K C;  1Y8N B;  1JWS D;  4KKS A;  3BYT B;  1RHP A;  2VB3 X;  4A3L G;  4A3I B;  3DLL A;  4FF2 A;  3DEO A;  2XGT A;  3FEW X;  3NQT A;  3WDN A;  2DNE A;  3E9H A;  1C4Q A;  2F0H A;  1B1Z A;  2F0I A;  3EVQ A;  4BY7 G;  4QGU A;  5C0X J;  4MIU A;  1GUG A;  2EYM A;  2ID0 A;  2PZU A;  5C3E H;  3I4M H;  1N33 L;  1FR3 A;  3BZC A;  2EY1 A;  4H44 C;  4TQU S;  2RCF A;  5D3I B;  5M3M H;  2FIN B;  4OON A;  4BS9 A;  1KXL A;  1N33 Q;  2VQF L;  1GUS A;  5I4D A;  3AMU A;  2SDF A;  3OMG A;  1NY4 A;  4YY3 L;  2B2T A;  5IGC A;  1SE2 A;  1X3G A;  3BU2 A;  1EQT A;  2F0K A;  4DA2 A;  4HJ5 A;  1B4O A;  2VW9 A;  2DY7 A;  1B3A A;  4HMI A;  2O2L D;  2VQF Q;  1K8M A;  2I5M X;  3GTK H;  5C3E G;  2Z1C A;  4P71 A;  1WVL A;  1UEB A;  3I4M G;  1GM5 A;  4A3K H;  4QCL A;  1G91 A;  5C4J H;  2DY8 A;  1HZB A;  5M3M G;  1NMF A;  5M9O A;  3CC7 A;  4X62 Q;  4DXF A;  4BBS H;  1U5K A;  3A8K E;  2F0G A;  3BVM A;  1Y1V B;  1M8A A;  1Y14 B;  2B2U C;  3DXJ C;  2C5C A;  4C3H B;  1PTO B;  4JW0 A;  1ASY A;  1NAP A;  4C56 C;  4MZ9 A;  1R4P B;  1PFS A;  2HCI A;  1G6Z A;  5G3L D;  2GN5 A;  1I4G A;  4CDD C;  3I55 A;  1PLF A;  3K58 A;  1CHQ D;  2A6E D;  2JEB I;  4LWC A;  4A3J H;  4AIM A;  3MHB A;  1Z9F A;  5JVH 3;  2WB1 E;  3EBE A;  1IXR A;  1EOT A;  1C48 A;  4IUN A;  4CDF C;  4A3K G;  1LUZ A;  4IJH A;  5M3F H;  1A3V A;  3NXW A;  3EJI A;  4BBS G;  3NWS A;  2LSS A;  2VL6 A;  4XXE A;  1ZXT A;  1T9H A;  1N32 L;  2KOL A;  1HR0 Q;  3FHW A;  4RHR A;  5EAY A;  1A8V A;  1GUN A;  2PI2 A;  1EZ6 A;  5FO7 B;  5GAD C;  4A3J G;  2NB0 A;  1N32 Q;  2K6A A;  3ONA B;  4EQN A;  3IAY A;  5E7N A;  3QG1 A;  5KNB A;  1O7I A;  4JCV E;  1FNV A;  3MEF A;  5M3F G;  1S40 A;  4A76 A;  3F2U A;  4BY7 B;  1CA5 A;  1KAB A;  1KAA A;  4NKL A;  2PMZ E;  4UP9 A;  1GO3 E;  2N49 A;  2L12 A;  4UPA A;  1SJH D;  3S16 B;  1BOS A;  2VXW A;  2E8G A;  3KF8 B;  1JOR A;  5IIF A;  4JI0 L;  1E2V A;  4CJ0 B;  3P75 A;  4DR6 L;  3TBI B;  4BA1 I;  2E2J B;  1BUV T;  3NUC A;  3PO3 B;  4GKJ Q;  3S24 A;  2JA6 G;  4RGT A;  2X6L A;  4JI0 Q;  4A3D H;  1SNQ A;  4PQX A;  4DV0 L;  1RF2 D;  2ICE C;  5JOB A;  4HAE A;  2F0M A;  1PYW D;  3RMH A;  1TS2 A;  5C3E B;  4J6H A;  3VA5 A;  3I4M B;  3D4W A;  1VF7 A;  3BVZ A;  2XRQ D;  4DV0 Q;  1CSP A;  1VQC A;  4QIW B;  3GTP H;  1F9S A;  1BKB A;  3KDF A;  1U4R A;  3TP7 A;  1HZA A;  4LMQ D;  3CD6 A;  2WAQ E;  5CV8 A;  1YJN A;  4P72 A;  3T51 B;  1I6H H;  2SNM A;  1WTR A;  2F0T A;  4LNQ A;  4K2K A;  2F4I A;  1JJ2 A;  4A3D G;  3E0E A;  3HG9 A;  3SEB A;  1PYS B;  2KEE A;  2PQA A;  4RH6 A;  1PH4 A;  3S15 H;  3J7A F;  2E5L L;  3GTK B;  2ALY B;  2QKI C;  1J5E L;  2WB1 B;  4DXG A;  5BR8 L;  4A3K B;  5EKL A;  3W5O A;  1N9W A;  2K04 A;  2FXQ A;  2B2T C;  2D0P A;  3M4Y A;  1NUC A;  3G7L A;  3PSI A;  2A68 C;  1TWG H;  2E5L Q;  4B08 A;  4BBS B;  1J5E Q;  1MJC A;  1ENA A;  3F2C A;  4NW2 A;  2UUB L;  1I4H A;  3T16 A;  1SFO H;  1BVS A;  1JOO A;  4BXX H;  4H7B A;  1L2F A;  4EVO A;  5C6A A;  4A3J B;  1VQ7 A;  2NWG A;  3MFG A;  2EYF A;  5ELO A;  2NVT H;  4KHP Q;  1KRS A;  5K5P A;  1HFG A;  3TP6 A;  3GTQ H;  1MSG A;  1LTS D;  2NZO A;  2FMM A;  3D31 A;  3K8A A;  4JI5 Q;  2F1M A;  1HQR D;  1Y1W H;  2WP8 J;  3W2D A;  2BH2 A;  2UXD L;  3PIP 3;  2MPM A;  3A7A B;  1PFN A;  4RMF A;  2PMZ B;  4ZCK A;  4DK6 C;  5KND A;  3RD4 A;  3KLS X;  4HJ7 A;  5TSS A;  4BXX G;  3AU7 A;  1SNC A;  4RCO A;  4ZAI A;  4J1M A;  3LWU A;  3MTS A;  3CPF A;  4ME3 A;  4HIK A;  1NMG A;  3OIQ A;  3MXN A;  2Z0S A;  4KY6 A;  1Q81 C;  3K57 A;  1E2W A;  1WFQ A;  3S1R H;  3A56 A;  4YCW A;  2I07 B;  1LV9 A;  1Q7Y C;  3UE1 A;  2PPB C;  2ZTD A;  5FLM H;  1Y1W G;  1B70 B;  3ERQ A;  3G6E A;  1STN A;  2YTY A;  4F7X A;  1WTO A;  3JC6 6;  1HNW L;  2WII B;  1MD2 D;  4GKK L;  1JE4 A;  4A3E H;  3O13 A;  1K8G A;  5LMN W;  2LY7 A;  4AQY L;  3I90 A;  4AH6 A;  3BS1 A;  3EA6 A;  3HGB A;  1CKN B;  1GJX A;  1HNW Q;  1NE3 A;  4GKK Q;  1SSO A;  3J7A 5;  4LUV A;  5M5X H;  3HFZ B;  4IFD I;  1EU3 A;  2K5D A;  3I70 A;  3BDO A;  3G71 A;  3BDL A;  2WAQ B;  4XQQ A;  2A68 D;  3A0J A;  4ME5 A;  3S1M H;  4A3D B;  4BA2 I;  4LW1 A;  2VZA A;  3SK8 A;  2FFK B;  2F3I A;  3NQI A;  5FLM G;  2AMC B;  3K5N A;  1N8R C;  3SK5 A;  3VR2 A;  2B63 G;  4KHZ A;  1A2T A;  2K5N A;  1L0W A;  4GNX A;  4A3E G;  1S5E D;  1LAC A;  1G2T A;  1JQY D;  1RTN A;  5E4W C;  5KNC A;  1SBB B;  1V1Q A;  2MP1 A;  1VQB A;  1IW7 C;  3BG3 A;  1EY7 A;  1ROD A;  2EDG A;  3GTP B;  2JA9 A;  4DU9 A;  3M4O H;  1VQE A;  3CCJ A;  1VQI A;  2ZXO A;  2E2I H;  1I6H B;  1UAP A;  3HOW B;  2JA8 H;  3HRZ C;  4PMW A;  4X3U A;  3HOY B;  3I73 A;  1S72 A;  3S15 B;  4JOI A;  4FF3 A;  1LTT D;  5EKI A;  2JN4 A;  2CHB D;  1GHJ A;  3ERS X;  3VYS A;  1U9R A;  3KOJ A;  1SE4 A;  2K03 A;  4K5X A;  2CH4 W;  2CCZ A;  1TWG B;  2HCC A;  3KLS A;  3RZD H;  4X3K A;  1XMO L;  4CHT B;  1PYB A;  4B9W A;  1BF4 A;  1Z6H A;  1W6J A;  2EPB A;  1SFO B;  3PUV A;  2JA8 G;  4PZ6 A;  4KN7 C;  4IUV A;  3HOX H;  4IO9 A;  3D4D A;  4YHH Q;  1XMO Q;  1S5D D;  1CSQ A;  4IFD J;  1HXY D;  3C3L A;  1IL8 A;  1R4Q B;  3U4Z A;  4HJ9 A;  3RLN A;  2NVT B;  1I4X A;  1YI2 A;  1MIU A;  1E0B A;  3GTQ B;  2B2W A;  1JWU D;  1NNX A;  2FHT A;  1ET6 A;  5CV6 A;  4GN5 A;  3J7A V;  4ZUI A;  1WYD A;  1G51 A;  1UNS A;  5IYB H;  3CCV A;  3KF6 A;  5CMD A;  4IN3 A;  4MTN A;  4JI8 Q;  3U9S A;  2AUK A;  3J80 i;  2BDN A;  4FXK C;  3CCR A;  3JAM L;  1V1P B;  3HOX G;  1DOM A;  5J1Z A;  2A5H A;  3Q24 A;  4RCN A;  4OIK A;  2A74 C;  4YWM A;  4ZKC B;  2PCF B;  4OEL B;  1PH5 A;  2UUC L;  4HCE A;  1CK1 A;  3S1R B;  1IW7 D;  5A35 A;  5JEA G;  1W3S A;  1YHQ A;  1ENF A;  1IBL L;  2JE6 I;  2IX1 A;  1HNZ Q;  1TWH H;  1P16 A;  1XPU A;  5D3D A;  3ICE A;  2EYJ A;  4KN4 C;  3MZ5 A;  1TS3 A;  4R4C A;  4G4K A;  5IYB G;  4A3E B;  3L0O A;  5ISR A;  2QIL A;  3A8I E;  2EVB A;  2XTI A;  3NSW A;  4DK0 A;  1F2Y A;  1CFM A;  3JAM E;  4HR7 B;  1HZ9 A;  3R8B A;  4JI7 L;  5M5X B;  2EQS A;  2R93 H;  1VQ8 A;  1V8Q A;  1RJT A;  2RBM A;  3GTJ H;  3IRB A;  2VQE Q;  1HHV A;  4DNR B;  1SYE A;  2I5L X;  5F2D A;  3S1M B;  2D9U A;  3GO5 A;  1J9O A;  3N52 A;  2C9O A;  1HQM C;  1TS5 A;  4H13 C;  4HMJ A;  1K9M C;  1E2Z A;  4B3R L;  3W1B A;  5K36 H;  2QCP X;  2SEB D;  3TME A;  3T1Y Q;  3PUZ A;  2EXD A;  4WFN 3;  4GOP A;  3J80 c;  1Q1B A;  1PDQ A;  2EOT A;  4IPC A;  3QJY A;  3M7G A;  2R93 G;  1B9M A;  3OTO L;  3M4O B;  1LLR D;  2GVA A;  5BN3 A;  4UY8 C;  1K83 H;  2B8F A;  2E2I B;  2HD3 A;  3K6O A;  4GNX C;  1TQO A;  1EY9 A;  4OL7 A;  2JA8 B;  2EYL A;  1A6X A;  4B9X A;  5CC4 A;  1VQ6 A;  3TEH B;  1PH7 A;  3CCU A;  5K36 G;  5GAH C;  1YZ6 A;  4RFB A;  3S2D B;  2K5H A;  2PYK A;  3BYY B;  5C3X A;  4P74 A;  2F0W A;  2EYP A;  1O7Y A;  1FD7 D;  3GDE A;  2EY6 A;  3FRP B;  2GVB A;  4A3B H;  4NMZ A;  2V4D A;  5KGU A;  5LMN L;  4R4O A;  4JOI C;  4RGM A;  4TVA B;  3OYY A;  3PIP A;  2SNS A;  2OF1 A;  4L63 B;  4K0K L;  3BDC A;  1Q46 A;  4GN3 B;  1Q82 C;  5LMN Q;  1XMQ Q;  2BCO A;  3SHL A;  4IZ8 A;  3PF4 A;  3MFY A;  5IP7 H;  2K5Q A;  1STB A;  1XX8 A;  3SE0 A;  3KBX A;  2B2V A;  4IPD A;  1EYA A;  1GOZ A;  1Q86 C;  4A3B G;  5FLX L;  1VQ4 A;  4R8N A;  3J81 L;  1SNP A;  3VYT A;  3I2Z A;  4FF1 A;  2RDG A;  4K6L A;  2RF4 A;  2KEN A;  4UP7 A;  4YCV A;  2B2W C;  1YJ9 A;  2VS1 A;  2AWO A;  1SR3 A;  2JXM B;  5EBD A;  5ELC A;  1GUW A;  1G2S A;  5HGQ A;  4XQN A;  4RKL A;  4LFB L;  1A3T A;  4UDU C;  1SXT A;  2ZJR A;  1O7L A;  2GA4 B;  1M1K C;  1KNA A;  2EY5 A;  3NHH A;  5IP7 G;  3HKS A;  2N78 A;  5DNF A;  1TWH B;  5C4H A;  4LFB Q;  4EQO A;  3NP8 A;  1RL2 A;  1BCP B;  3C1F A;  5ELD A;  2H5X A;  4KJO A;  2H4O A;  1VF5 C;  5FLX E;  4DFA A;  3J81 E;  1MHW C;  1XPR A;  2EIF A;  4LF8 L;  1YNX A;  1R9T H;  1V9P A;  5I9P A;  1YHA A;  1H9S A;  2AWN A;  2PI2 E;  5M5Y B;  2ENB A;  1WTP A;  1HFN A;  1W2B A;  1JB7 A;  1VDZ A;  2NTS A;  2CWP A;  2R93 B;  1HUN A;  4LFA Q;  1H9K A;  3GTJ B;  4LF8 Q;  4A93 G;  1Z47 A;  2DJF C;  4HSP A;  3GTL H;  1S4Z A;  3MXP A;  1SNM A;  1PMR A;  1WTW A;  1S5F D;  5C5L A;  1IBM L;  1Q8I A;  1TT2 A;  1KDC A;  2A6H C;  3OWF A;  5ELF A;  4CKC A;  4ZKB B;  1ML0 D;  5CV7 A;  2IHF A;  1EEF D;  1KNE A;  4JI4 L;  2NYZ D;  3KUP A;  1DYQ A;  3UDG A;  1HCZ A;  1IBM Q;  1F2Z A;  1JE5 A;  2E76 C;  4DV5 L;  2E75 C;  5AJ3 L;  4H0L C;  4TKO B;  3K0X A;  3SVM A;  1XTC D;  1K83 B;  1L0Y B;  3I4N H;  4TSS A;  2IT1 A;  3HOV H;  3NBH A;  4ZRZ A;  1YJW A;  1VQJ A;  1I5F A;  4K5W A;  5C4X H;  4GOP C;  1D7Q A;  2C35 B;  3AB9 A;  1QZG A;  5DAU A;  3TQY A;  1QOH A;  2JEA I;  4YY3 Q;  4CJ2 C;  3DWQ A;  4DV2 L;  1PH1 A;  1X32 A;  4X6A H;  4QF4 A;  4B3S L;  4DN4 M;  3X3M A;  4M8A A;  4A3C H;  4R8I A;  1OXU A;  4A3B B;  3MAQ A;  4QIW E;  3E9I A;  4F88 A;  4NXN L;  1I50 B;  4M1U B;  3WOF A;  3HOZ H;  4DV2 Q;  3I4N G;  3S1Q H;  4B3S Q;  4NXM L;  3HOV G;  1L1O A;  3HKZ G;  3ULP A;  1LTB D;  1V43 A;  4A3M H;  1AN8 A;  4R4T A;  5C4X G;  1VQO A;  3T13 A;  2LS0 1;  2ZM6 L;  3SR1 A;  3BJU A;  2F0Q A;  3H0G H;  5I6Y A;  4CGY B;  1E22 A;  3H3V C;  4A3C G;  1DOK A;  2CFM A;  4HIM A;  1UUP A;  5T1G A;  4HID A;  2ZJP A;  3J81 j;  4LF6 L;  3S14 H;  2ZM6 Q;  3HOZ G;  2MUY A;  1LTR D;  4DR4 L;  2OQK A;  3KLR A;  1FJG L;  2MO1 A;  2A6H D;  1JT8 A;  4A3M G;  2B2V C;  3M3Y H;  1B3Q A;  3E5S A;  2ZXR A;  4DAM A;  1BBU A;  2MQH A;  1FJG Q;  1A62 A;  4ZYS A;  2F3V A;  1LTG D;  2K32 A;  4V0B A;  2Q2I A;  4PMB A;  3H0G G;  2Y0S G;  2JA6 H;  4WJW A;  1Y69 U;  4OGQ C;  2X69 A;  1GVP A;  5JPM C;  2E2D C;  4C1N I;  2AKW B;  2L1B A;  3VR6 A;  2F0E A;  2MGS A;  1R9T B;  1JMC A;  1B8A A;  3D3R A;  4KY5 A;  5CBE E;  1NR2 A;  3DWA A;  1YEZ A;  4BBR G;  3OW7 A;  4IPH A;  1NR4 A;  3H6M A;  2XWB B;  1STY A;  3GTL B;  4LF4 L;  2JA5 H;  1SYD A;  1BBX C;  1CQF A;  3NTH A;  3TZD A;  5DM6 3;  4OX9 L;  1D1I A;  4DK1 A;  4MN3 A;  4DAY A;  1KD1 C;  2EE1 A;  2Z4I A;  4DR6 Q;  4YWL A;  3I91 A;  3RUZ A;  5KIX A;  1FL0 A;  4OHJ A;  2PW5 A;  5LHY 1;  2R61 A;  4KKT A;  3CPW A;  3KDF B;  5EPL A;  5M3M B;  3GTO H;  4FVM A;  5GAE C;  4J15 A;  4HSV A;  4AYB G;  1UE6 A;  3I4N B;  1OXT A;  2JA5 G;  2XRS D;  3A74 A;  3HOV B;  3HKZ B;  4CDC C;  2IJ0 A;  3PV0 A;  4DR2 L;  2HHH L;  1E1T A;  5EKK A;  5C4X B;  3OPO A;  1G8Z D;  5KRU A;  4DNI A;  3H3V I;  3G48 A;  3K7A H;  2YU9 H;  3VR5 A;  1YNN C;  3NK9 A;  3M85 A;  1XYI A;  1KC8 C;  3LGJ A;  4XT1 B;  4JPB W;  3CME A;  3M4Q A;  4DR2 Q;  1HTL D;  2MFI A;  5C4J B;  4RKB A;  1WD0 A;  1EY5 A;  1UEA B;  1C8C A;  3IKJ A;  2J4X A;  1EU4 A;  4PZ7 A;  3S1Q B;  5BR8 Q;  4C3I H;  4LF7 L;  2OQ0 A;  2RDF A;  3GD7 A;  4L5R C;  1PH8 A;  2B3G A;  4A3M B;  3MA2 B;  2K33 A;  1B9N A;  5IGF A;  1CHP D;  4XDX A;  3K80 C;  3SK4 A;  5IGB A;  1ICF B;  4V19 0;  4DUY L;  1C0A A;  1X3E A;  4LF7 Q;  3R93 A;  2UUB Q;  2VY3 A;  2OTJ A;  4DV1 L;  4NDX A;  3TRZ A;  1LT5 D;  3TSS A;  3H0G B;  1L1O C;  2V1C C;  4DUY Q;  5M3F B;  5BN4 A;  4DKA C;  4DV4 L;  2VUM H;  1TKW B;  1SND A;  1H9R A;  3S14 B;  1W6K A;  3QWN A;  3K0Y A;  3NEM A;  2KJX A;  5IE8 A;  2IPK D;  4C3I G;  1EIG A;  1Q3L A;  1U4L A;  4K14 A;  1I4R A;  2K75 A;  2UXD Q;  4LUO A;  4FP5 D;  3VR4 A;  1EQR A;  1TVX A;  1D2B A;  2VNU D;  1FGB D;  1SMY C;  2OEO A;  5CBA E;  1QNU A;  2JYO A;  3CRK C;  3LWE A;  2JA6 B;  2TMP A;  2VUM G;  1FYC A;  1S3O A;  1N36 L;  1VQP A;  1ASZ A;  1LO5 D;  4X66 L;  2L4N A;  2KHS A;  3CQZ H;  1PFM A;  5IGE A;  1FNW A;  2D5D A;  1OTC A;  4NPS A;  4X64 L;  2B63 H;  3DHQ A;  1QWY A;  4EX5 A;  3RLO A;  3TP5 A;  2OWO A;  1N36 Q;  5LL6 X;  2YYZ A;  1TXY A;  4X66 Q;  1LT3 D;  1A3U A;  2E2H H;  1YNN D;  2F0L A;  1JJG A;  4ABN A;  3D0F A;  3I56 A;  5JEA J;  4OO1 G;  1XNQ L;  3UI2 A;  2LKV A;  1V1O A;  1U4M A;  2JA5 B;  1TWF H;  1P8L A;  4FYD A;  1OO9 B;  1SYB A;  4AQY Q;  4KD4 A;  4CBV A;  4BY1 H;  1TWA H;  5IT9 c;  2BDO A;  4GNX B;  1RDP D;  2JQO A;  3D8G A;  1SE8 A;  1PZI D;  1AE2 A;  3PO2 H;  1JCK B;  2R92 H;  1ILP A;  1VQL A;  3E3X A;  4P75 A;  1DOL A;  4DGZ A;  5COY A;  3GTO B;  1SYG A;  4K5V A;  4DV3 L;  1D5Z C;  5JJI A;  1JWM D;  4JI1 L;  3NBI A;  1II3 A;  1D5M C;  5A2Q L; 
#chains in the Genus database with same CATH homology
 1Y8O B;  4RA8 A;  3FPU B;  1EYC A;  3QIA A;  2EZV A;  2K1B A;  2YU9 B;  2XWJ B;  3SK6 A;  3CKI B;  3QOJ A;  3N6R A;  1STE A;  1FNU A;  1SMY D;  4XIG S;  2B39 A;  4FXD A;  5HGT A;  3GV3 A;  2H1E A;  5A2Q E;  2F0U A;  3M7N A;  4CJ1 B;  3V05 A;  3HZX A;  1OXS C;  1B50 A;  3FPP A;  3L7Z C;  4FNF A;  4K8J A;  3V96 A;  5JEA H;  2VUM B;  1JOQ A;  1IYU A;  1Y1W B;  2EY2 A;  1KDA A;  3DEP A;  3S9W A;  3PUY A;  1PZJ D;  2IX3 A;  2QF7 A;  3PMF A;  3R3O A;  2LFN A;  3IL8 A;  1DD2 A;  2EXZ A;  3FMC A;  5EJW A;  5DEH A;  5JPN C;  2CVR A;  1G29 1;  2BA0 A;  2B8G A;  2KCN A;  3GV6 A;  3A55 A;  5KYI A;  2IW3 A;  4RWS C;  3CQZ B;  1QJO A;  5IGD A;  1IKL A;  3OWE B;  5IGG A;  5I9O A;  2HUG A;  4ODG A;  2NN6 H;  2B63 B;  1PXU A;  1WTX A;  2RA4 A;  4QUC A;  2OXP A;  2E2H B;  2F03 A;  4DAP A;  1HPC A;  3OMC A;  1HRJ A;  4KV6 A;  1DM0 B;  3W3A A;  1NCV A;  1A15 A;  2F0F A;  4XYQ A;  1L0X B;  1TWA B;  1CTM A;  1K8O A;  2K01 A;  2KQ3 A;  1F77 A;  4QMG A;  4G7Z C;  4F8M A;  4RGO S;  2NN6 G;  1ILQ A;  4I65 A;  3PO2 B;  2RSO A;  5ELB A;  1Y8P B;  3MXG A;  2F0D A;  1QCB D;  5G3L F;  5AFW A;  1AP0 A;  1SE3 A;  4ZK9 B;  2BOS A;  3VYU A;  1I6V C;  1YNJ C;  3OSO A;  2NVQ B;  4U68 A;  4KTA A;  5C4Z A;  4G7O C;  1TS4 A;  4G57 A;  1Z7T A;  5EPK A;  2XNA C;  2Q8T A;  3S2H B;  1LAB A;  1S5C D;  2RVL A;  1EL0 A;  1CM9 A;  1HA6 A;  3D4R A;  1T5E A;  5I2Y A;  1DZ1 A;  3RZD B;  5DM7 3;  1MBY A;  3DMU A;  3MC0 B;  1SAP A;  3TN2 A;  1ZYR C;  3HOX B;  5FK9 C;  1KLG D;  3KK7 A;  2JA7 B;  2F0V A;  3OIP A;  4RAU C;  1I3Q B;  3CRL C;  1KDB A;  4KI0 A;  5CV5 A;  3I8Z A;  2I46 A;  2RQX A;  2AQ3 B;  5E3F A;  1PFB A;  2LMC B;  3TDQ A;  4C1N K;  1MGS A;  5C0X I;  5ELE A;  1WD1 A;  3RLF A;  2KCC A;  2TSS A;  3FVQ A;  1LTA D;  1IHZ A;  1YNJ D;  4PMC A;  1ZKO A;  5C3W A;  2XIW A;  1PRT F;  4C3H G;  1EQV A;  3U9O A;  1H9S B;  1LT4 D;  3FKI B;  3E0J A;  1EEI D;  1HA5 A;  3EFX D;  5NUC A;  2J7Z A;  2O4X A;  2B2Y A;  2X6G A;  2WKC A;  3NE5 B;  3P20 A;  1AZQ A;  4K8I A;  2NBF A;  3I3C A;  3BVG A;  2DNC A;  1ZYR D;  2Q8R E;  2K05 A;  4ZUJ A;  1MI2 A;  3GTG B;  4DAV A;  1H9M A;  2PO4 A;  3E6Z X;  1TY2 A;  1AZP A;  4G7H C;  4UAI A;  1HUM A;  1M4V A;  1BCP F;  1TWC B;  4IUR A;  5LL6 S;  1OXX K;  4C3J G;  4I7Z C;  1RTO A;  1T5X D;  2WAC A;  5JAV A;  1SDF A;  4MHE A;  3A54 A;  4IQZ A;  1OXV A;  4Q5V A;  3GTM B;  5E1F A;  1S5B D;  4XT3 B;  4Z9C B;  3PIO 3;  1IYV A;  2CW0 C;  4HCS A;  4XQJ A;  3TZU A;  1QG7 A;  5D65 A;  2L11 A;  3GP7 A;  1H9J A;  5J22 A;  3D6C A;  1JIC A;  4JK1 C;  5EPJ A;  2RDH A;  3SXH A;  1BXT A;  4FF4 A;  2Z4H A;  2F0O A;  3A8J E;  4OO1 I;  1KLU D;  1WCM B;  3J80 L;  2F3W A;  1ONL A;  1DJR D;  1VCI A;  3VYR A;  2F0P A;  2NZ1 D;  5JJZ A;  2BE5 C;  2JP1 A;  1TII D;  3NPP A;  2AQ2 B;  4LAA A;  1O80 A;  1B44 D;  1PZK D;  2KED A;  2OT2 A;  1Q12 A;  4A93 B;  3HEJ A;  1B53 A;  4DNT B;  1IKM A;  3T56 B;  1PRT C;  4ZQ3 A;  4ZLT F;  2XSC A;  3Q6S A;  3J80 E;  3OHX C;  3C2P A;  5C0X H;  4WRD A;  1PTO F;  3T53 B;  1ESF A;  2G9H D;  3K5O A;  1LTI D;  2EJG C;  4KJN A;  4QB4 A;  2PZT A;  5J39 A;  3H94 A;  3S1N B;  1HTP A;  1BNZ A;  1RKN A;  4C3J B;  2QDB A;  3QOL A;  4R9W A;  1CZG A;  2PNR C;  2EJF C;  2CW0 D;  5C0X G;  3Q22 A;  4RGN A;  2EYH A;  2XVS A;  1O78 A;  2B2Y C;  3DM1 A;  5C5M A;  4KK7 A;  3TP8 A;  3KF8 A;  1BCP C;  1CI3 M;  4HN7 A;  1X3Q A;  5I6W A;  3IFT A;  3D6W A;  2NTT A;  3R2I A;  3L9A X;  2HDL A;  3IFD A;  1STG A;  1CA6 A;  2BE5 D;  2Z8L A;  1CT1 D;  1SYC A;  3V2T A;  1EZ8 A;  1EY4 A;  4L8J A;  1B2T A;  4FO2 A;  2CQA A;  1LT6 D;  3I4L A;  1PRT D;  1F9P A;  5KYL A;  1GHK A;  3HOZ B;  2JSO A;  4KY7 A;  2AUJ D;  3BZD B;  1XXG A;  1F2M A;  4O1N A;  4Q0F A;  4IUP A;  2WV6 D;  1EY0 A;  1ZEQ X;  1ET9 A;  4KKU A;  2Y0S B;  5I2X A;  4LJZ C;  2N55 A;  3T4A C;  2HDM A;  3S17 B;  3VA7 A;  1QIL A;  4YIJ A;  2AQ1 B;  1DON A;  2D2C C;  2SOB A;  2FJ2 A;  4BWG B;  3M3Y B;  1TY0 A;  2K7V A;  1EIH A;  4BBR B;  2NN6 I;  4DF7 A;  5KEE A;  4XYO A;  4OO1 H;  1EY8 A;  1VMP A;  3C46 A;  2M9V A;  4GZY C;  5CV9 A;  1VMC A;  1BCP D;  4XTC S;  1PTO C;  2A69 C;  3EQL C;  1SNO A;  3H09 A;  4IAL A;  1AFP A;  2FMC A;  2HQE A;  1QE6 A;  3C1E A;  4IUT A;  5FOB B;  1D5X C;  1TR5 A;  2PQE A;  4HED A;  5EBC A;  4AYB B;  1WTV A;  2ZXP A;  5C44 B;  2MHV A;  3GQB A;  3NWT A;  4FXG C;  3MXU A;  5COR A;  4IUU A;  3I72 A;  2XN9 C;  4QUF A;  3DUZ A;  4L6T B;  3Q23 A;  4X3S A;  2EYO A;  3CHB D;  1SEB D;  5EGT A;  3K7A B;  1RCV D;  2WIN B;  5FO8 B;  5EQ0 A;  3NTK A;  5IOD A;  2E74 C;  5E4X A;  5HUR A;  1XWE A;  3L3O C;  2R6G A;  1PTO D;  4C3I B;  3PUW A;  1ICW A;  3K5L A;  2M00 A;  1AEX A;  2A69 D;  5BN5 A;  4KD3 A;  1Q90 A;  5CV4 A;  3P7J A;  4IUQ A;  4P2C B;  4K6D A;  1I4Q A;  2MJ8 A;  2N88 A;  4A3G B;  2DN8 A;  3K5M A;  2ZT9 C;  4EGV A;  3ERO A;  2R3Z A;  1JC7 A;  3MWY W;  3SDZ A;  2PZW A;  2K28 A;  2R7Z B;  4J8Q A;  1GUT A;  2A73 B;  4N9P A;  2L5T A;  2M2L A;  1JB3 A;  4PNY A;  5JVG 3;  1F9R A;  5D14 A;  2F0S A;  2Q8I B;  3FDT A;  4OIJ A;  3VR3 A;  1GXD C;  4CKE A;  5M5W B;  3ITP A;  3CU7 A;  1EFI D;  3DWP A;  1KTK A;  1V1P A;  2WKD A;  2L55 A;  1X3P A;  2BA1 A;  1TWF B;  1TU2 B;  3A7L A;  3HS0 C;  2NVX B;  4ID6 A;  1NSN S;  4BY1 B;  4K2L A;  1STA A;  1QNK A;  4U67 3;  1CZW A;  1BQQ T;  2F0N A;  1CQV A;  2R92 B;  5FKA C;  3QO2 A;  3HP3 A;  3J7Y W;  1Q1E A;  3KBG A;  4KMU C;  1I4P A;  3G6J B;  5CGK A;  4ULL A;  2K5W A;  4NP5 A;  2O5J C;  2IX0 A;  1U4P A;  3MEH A;  3MVV A;  3QB3 A;  2IWH A;  2NVY B;  1D1K A;  2RKS A;  1EWH A;  4WOR A;  5T1I A;  4IFD H;  4E6I A;  4Y7N B;  2KEC A;  1MSH A;  4KHV A;  3ND9 A;  2O5I C;  1ENC A;  3H91 A;  3NTI A;  4F87 A;  1AW7 A;  1D6E C;  4X3T A;  3URY A;  4CKB A;  3ND8 A;  4O42 A;  4S3S A;  2QEJ C;  5CR3 A;  2PW7 A;  1JOK A;  3LNN A;  4IFD G;  2B2U A;  5IT9 L;  1EWC A;  3HOU B;  4A3F B;  2KA7 A;  1DXM A;  1QB5 D;  1A2U A;  5CYU A;  4C2M B;  3LX0 A;  3X3N A;  1PRT B;  4JBW A;  1PTO H;  3K59 A;  4HTH A;  1JR0 D;  1F9Q A;  2RSN A;  4PV1 C;  1SYF A;  1BR9 A;  2L9H A;  4LK1 C;  5IT9 E;  3ZYY X;  2D62 A;  4TRD A;  1STH A;  4EQP A;  3OOC A;  1O7Z A;  1ESR A;  3R2T A;  2J0T D;  1J8I A;  2IL8 A;  2VB2 X;  2KVM A;  1GUO A;  3RZO B;  1DCZ A;  1WTQ A;  3PUX A;  1F2L A;  2ICI A;  1EY6 A;  4N9T A;  1BO0 A;  1SJE D;  2G9D A;  4RHS A;  3P1H A;  2L0C A;  2NUC A;  2F0J A;  1RD9 D;  2A6E C;  5IOC A;  4ILW A;  3Q0A A;  2EJM A;  1BDO A;  3WOE A;  5FO9 B;  2KUM A;  1EYD A;  1Y8N B;  1JWS D;  4KKS A;  3BYT B;  1RHP A;  2VB3 X;  4A3I B;  4FF2 A;  3DEO A;  3FEW X;  3NQT A;  3WDN A;  2DNE A;  1C4Q A;  2F0H A;  1B1Z A;  2F0I A;  3EVQ A;  5C0X J;  4MIU A;  1GUG A;  2EYM A;  2ID0 A;  2PZU A;  1FR3 A;  2EY1 A;  4H44 C;  4TQU S;  5D3I B;  2FIN B;  4BS9 A;  1GUS A;  5I4D A;  3AMU A;  2SDF A;  3OMG A;  2B2T A;  5IGC A;  1SE2 A;  1EQT A;  2F0K A;  4DA2 A;  1B4O A;  2DY7 A;  1B3A A;  4HMI A;  2O2L D;  1K8M A;  2Z1C A;  1WVL A;  4QCL A;  1G91 A;  2DY8 A;  5M9O A;  4DXF A;  3A8K E;  2F0G A;  3BVM A;  1Y1V B;  1M8A A;  2B2U C;  3DXJ C;  2C5C A;  4C3H B;  1PTO B;  1NAP A;  4C56 C;  1R4P B;  2HCI A;  1G6Z A;  5G3L D;  1I4G A;  1PLF A;  3K58 A;  1CHQ D;  2A6E D;  2JEB I;  3MHB A;  5JVH 3;  1EOT A;  1C48 A;  4IUN A;  1A3V A;  3NXW A;  3EJI A;  3NWS A;  4XXE A;  1ZXT A;  2KOL A;  4RHR A;  1GUN A;  5FO7 B;  1EZ6 A;  2NB0 A;  2K6A A;  3ONA B;  4EQN A;  3IAY A;  3QG1 A;  5KNB A;  1FNV A;  3F2U A;  4BY7 B;  1CA5 A;  1KAB A;  1KAA A;  4NKL A;  2L12 A;  1SJH D;  3S16 B;  1BOS A;  2VXW A;  1JOR A;  5IIF A;  1E2V A;  4CJ0 B;  3P75 A;  3TBI B;  4BA1 I;  2E2J B;  1BUV T;  3NUC A;  3PO3 B;  4RGT A;  2X6L A;  1SNQ A;  4PQX A;  1RF2 D;  2ICE C;  5JOB A;  4HAE A;  2F0M A;  1PYW D;  3RMH A;  1TS2 A;  5C3E B;  4J6H A;  3VA5 A;  3I4M B;  3D4W A;  1VF7 A;  3BVZ A;  2XRQ D;  4QIW B;  1F9S A;  1U4R A;  3TP7 A;  4LMQ D;  5CV8 A;  3T51 B;  2SNM A;  1WTR A;  2F0T A;  4K2K A;  2F4I A;  3HG9 A;  3SEB A;  2KEE A;  4RH6 A;  3J7A F;  3GTK B;  2QKI C;  2WB1 B;  4DXG A;  4A3K B;  5EKL A;  2K04 A;  2B2T C;  3M4Y A;  1NUC A;  3G7L A;  2A68 C;  4B08 A;  4BBS B;  1ENA A;  4NW2 A;  1I4H A;  3T16 A;  1JOO A;  4H7B A;  4EVO A;  5C6A A;  4A3J B;  2NWG A;  3MFG A;  2EYF A;  5K5P A;  1HFG A;  3TP6 A;  1MSG A;  1LTS D;  2FMM A;  3D31 A;  2F1M A;  1HQR D;  2WP8 J;  3W2D A;  3PIP 3;  2MPM A;  3A7A B;  1PFN A;  2PMZ B;  5KND A;  3RD4 A;  3KLS X;  5TSS A;  3AU7 A;  1SNC A;  4RCO A;  4ZAI A;  4J1M A;  3LWU A;  3MTS A;  3OIQ A;  3MXN A;  4KY6 A;  3K57 A;  1E2W A;  3A56 A;  2I07 B;  1LV9 A;  2PPB C;  3ERQ A;  1STN A;  4F7X A;  1WTO A;  2WII B;  1MD2 D;  1JE4 A;  3O13 A;  2LY7 A;  3I90 A;  3BS1 A;  3EA6 A;  3HGB A;  1GJX A;  1SSO A;  3NBI A;  4IFD I;  1EU3 A;  2K5D A;  3I70 A;  3BDO A;  3BDL A;  2WAQ B;  4XQQ A;  2A68 D;  4ME5 A;  4A3D B;  4BA2 I;  3SK8 A;  2FFK B;  3NQI A;  3K5N A;  3SK5 A;  3VR2 A;  4KHZ A;  1A2T A;  1S5E D;  1LAC A;  1G2T A;  1JQY D;  1RTN A;  5E4W C;  5KNC A;  1SBB B;  2MP1 A;  1IW7 C;  3BG3 A;  1EY7 A;  1ROD A;  2EDG A;  3GTP B;  4DU9 A;  2ZXO A;  1I6H B;  1UAP A;  3HOW B;  3HRZ C;  4PMW A;  4X3U A;  3HOY B;  3I73 A;  3S15 B;  4FF3 A;  1LTT D;  5EKI A;  2CHB D;  1GHJ A;  3VYS A;  1U9R A;  1SE4 A;  2K03 A;  4K5X A;  1TWG B;  2HCC A;  3KLS A;  4X3K A;  4CHT B;  4B9W A;  1BF4 A;  1Z6H A;  1W6J A;  2EPB A;  1SFO B;  3PUV A;  4KN7 C;  4IUV A;  3D4D A;  1S5D D;  4IFD J;  1HXY D;  3C3L A;  1IL8 A;  1R4Q B;  2NVT B;  1I4X A;  1E0B A;  3GTQ B;  2B2W A;  1JWU D;  2FHT A;  1ET6 A;  5CV6 A;  3J7A V;  4ZUI A;  1UNS A;  5CMD A;  4IN3 A;  3U9S A;  2AUK A;  2BDN A;  4FXK C;  3JAM L;  1V1P B;  1DOM A;  5J1Z A;  2A5H A;  3Q24 A;  4RCN A;  4OIK A;  2A74 C;  4ZKC B;  2PCF B;  4HCE A;  1CK1 A;  3S1R B;  1IW7 D;  5A35 A;  5JEA G;  1ENF A;  2IX1 A;  2JE6 I;  5D3D A;  2EYJ A;  4KN4 C;  3MZ5 A;  1TS3 A;  4G4K A;  4A3E B;  5ISR A;  2QIL A;  3A8I E;  2EVB A;  3NSW A;  4DK0 A;  1F2Y A;  1CFM A;  3JAM E;  4HR7 B;  3R8B A;  5M5X B;  1V8Q A;  1RJT A;  2RBM A;  1HHV A;  4DNR B;  1SYE A;  5F2D A;  3S1M B;  2D9U A;  3GO5 A;  1J9O A;  3N52 A;  2C9O A;  1HQM C;  1TS5 A;  4H13 C;  4HMJ A;  1E2Z A;  5K36 H;  2QCP X;  2SEB D;  3TME A;  3PUZ A;  4WFN 3;  1Q1B A;  1PDQ A;  2EOT A;  3QJY A;  3M7G A;  1B9M A;  3M4O B;  1LLR D;  5BN3 A;  2B8F A;  2E2I B;  3K6O A;  1TQO A;  1EY9 A;  4OL7 A;  2JA8 B;  2EYL A;  1A6X A;  4B9X A;  5CC4 A;  5K36 G;  4RFB A;  3S2D B;  2PYK A;  3BYY B;  5C3X A;  2F0W A;  2EYP A;  1O7Y A;  1FD7 D;  2EY6 A;  3FRP B;  4NMZ A;  2V4D A;  5KGU A;  4RGM A;  2SNS A;  2OF1 A;  4L63 B;  3BDC A;  2BCO A;  3SHL A;  4IZ8 A;  3MFY A;  2K5Q A;  1STB A;  1XX8 A;  3SE0 A;  3KBX A;  2B2V A;  1EYA A;  1GOZ A;  5FLX L;  4R8N A;  3J81 L;  1SNP A;  3VYT A;  4FF1 A;  2RDG A;  4K6L A;  2B2W C;  2AWO A;  2JXM B;  5EBD A;  5ELC A;  1GUW A;  1G2S A;  4XQN A;  4RKL A;  1A3T A;  4UDU C;  1SXT A;  1O7L A;  2GA4 B;  1KNA A;  2EY5 A;  3NHH A;  5DNF A;  1TWH B;  5C4H A;  4EQO A;  3NP8 A;  1BCP B;  3C1F A;  5ELD A;  4KJO A;  2H4O A;  1VF5 C;  5FLX E;  4DFA A;  3J81 E;  5I9P A;  1H9S A;  2AWN A;  5M5Y B;  2ENB A;  1WTP A;  1HFN A;  1VDZ A;  2NTS A;  2R93 B;  1HUN A;  1H9K A;  3GTJ B;  1Z47 A;  4HSP A;  1S4Z A;  3MXP A;  1SNM A;  1PMR A;  1WTW A;  1S5F D;  5C5L A;  1Q8I A;  1TT2 A;  1KDC A;  2A6H C;  4ZKB B;  3OWF A;  5ELF A;  4CKC A;  1ML0 D;  5CV7 A;  1EEF D;  1KNE A;  2NYZ D;  3KUP A;  1DYQ A;  1HCZ A;  1F2Z A;  2E76 C;  2E75 C;  4H0L C;  4TKO B;  3SVM A;  1XTC D;  1K83 B;  1L0Y B;  4TSS A;  2IT1 A;  3NBH A;  4ZRZ A;  4K5W A;  3AB9 A;  5DAU A;  1QOH A;  2JEA I;  4CJ2 C;  3DWQ A;  1X32 A;  4QF4 A;  4DN4 M;  3X3M A;  4M8A A;  4R8I A;  1OXU A;  4A3B B;  3MAQ A;  4F88 A;  1I50 B;  4M1U B;  3WOF A;  1LTB D;  1V43 A;  1AN8 A;  3T13 A;  2LS0 1;  3SR1 A;  2F0Q A;  5I6Y A;  4CGY B;  3H3V C;  1DOK A;  1UUP A;  5T1G A;  2MUY A;  1LTR D;  3KLR A;  2A6H D;  2B2V C;  3E5S A;  2ZXR A;  4ZYS A;  2F3V A;  1LTG D;  2K32 A;  4V0B A;  4PMB A;  4WJW A;  1Y69 U;  4OGQ C;  2X69 A;  5JPM C;  2E2D C;  4C1N I;  2L1B A;  3VR6 A;  2F0E A;  2MGS A;  1R9T B;  3D3R A;  4KY5 A;  5CBE E;  1NR2 A;  3DWA A;  3OW7 A;  1NR4 A;  3H6M A;  2XWB B;  1STY A;  3GTL B;  1SYD A;  1BBX C;  1CQF A;  3TZD A;  5DM6 3;  1D1I A;  4DK1 A;  4MN3 A;  4DAY A;  2EE1 A;  2Z4I A;  3I91 A;  3RUZ A;  5KIX A;  4OHJ A;  2PW5 A;  5LHY 1;  2R61 A;  4KKT A;  5EPL A;  5M3M B;  4FVM A;  4HSV A;  3I4N B;  1OXT A;  2XRS D;  3HOV B;  3HKZ B;  2IJ0 A;  3PV0 A;  5EKK A;  5C4X B;  3OPO A;  1G8Z D;  5KRU A;  3VR5 A;  1YNN C;  3NK9 A;  3M85 A;  1XYI A;  4XT1 B;  1HTL D;  5C4J B;  4RKB A;  1WD0 A;  1EY5 A;  1UEA B;  1C8C A;  3IKJ A;  2J4X A;  1EU4 A;  3S1Q B;  2RDF A;  3GD7 A;  4A3M B;  3MA2 B;  2K33 A;  1B9N A;  5IGF A;  1CHP D;  4XDX A;  3SK4 A;  5IGB A;  4V19 0;  3R93 A;  4NDX A;  1LT5 D;  3TSS A;  3H0G B;  5M3F B;  5BN4 A;  1TKW B;  1SND A;  1H9R A;  3S14 B;  1W6K A;  3QWN A;  3K0Y A;  2KJX A;  2IPK D;  4C3I G;  1EIG A;  1Q3L A;  1U4L A;  4K14 A;  1I4R A;  4FP5 D;  3VR4 A;  1TVX A;  1D2B A;  2VNU D;  1FGB D;  1SMY C;  2OEO A;  5CBA E;  1QNU A;  2JYO A;  3CRK C;  3LWE A;  2JA6 B;  2TMP A;  1FYC A;  1LO5 D;  2L4N A;  2KHS A;  1PFM A;  5IGE A;  1FNW A;  2D5D A;  3DHQ A;  1QWY A;  3TP5 A;  5LL6 X;  2YYZ A;  1LT3 D;  1A3U A;  1YNN D;  2F0L A;  4ABN A;  5JEA J;  4OO1 G;  3UI2 A;  2LKV A;  1V1O A;  1U4M A;  2JA5 B;  4FYD A;  1OO9 B;  1SYB A;  4KD4 A;  4CBV A;  2BDO A;  1RDP D;  3D8G A;  1PZI D;  1JCK B;  1ILP A;  1DOL A;  4DGZ A;  5COY A;  3GTO B;  1SYG A;  4K5V A;  1D5Z C;  1JWM D;  3NTH A;  1II3 A;  1D5M C;  5A2Q L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...