2LFOA

Nmr structure of cl-babp/ss complexed with glycochenodeoxycholic and glycocholic acids
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
b'AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVCKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, liver
publication title A disulfide bridge allows for site-selective binding in liver bile acid binding protein thereby stabilising the orientation of key amino acid side chains.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Lipid binding protein
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2lfoA00
4NP1A 4ZR2A 1DC9A 2K23A 5HBSA 4YCEA 3UEVA 2FT9A 1AQBA 4AW8A 4OS3A 5BVSA 3AKNA 1T0VA 3D97A 3FW5A 4YGHA 5HCCC 4IB6A 3TGAA 3STKA 3QKGA 1NP4A 1X8QA 3FMZA 2HZRA 4MVLA 1YWCA 2ACOA 4XMGA 4ZJ0A 4ZGUA 2LBAA 1DF3A 1QABE 1HMSA 1TVQA 1U0XA 3BU9A 1OEKA 3EBKA 5FFHA 3WJEA 2HNXA 3NP1A 1SY2A 4GH7A 1YUPA 5HTEA 1A3YA 3FA8A 3GAQA 2Q9SA 1OBQA 3C77X 1YWDA 2CBRA 4YDAA 2WQ9A 1VYFA 3STNA 1ZRYA 5HZ9A 4ZH6A 1KOIA 3RZYA 4EFGA 5EDBA 3VG2A 3FA7A 3ZUOA 2CZUA 1LPJA 1ZNEA 1FELA 4IB7A 1B8EA 1CBIA 1LIFA 3IFBA 1DFVA 5F7GA 3APUA 5B29A 1GGLA 1GX8A 5C0NA 1ERBA 2JU7A 4NNSA 1IKJA 1EW3A 4LZVA 2WUTA 3BSZE 4AYHA 1A57A 3WXQA 1QFVA 2RCTA 3O19A 3TF6A 1DZKA 2AT0X 1RLBE 2EU7X 2XKLA 2RQ0A 4YFRA 5LJCA 1GT1A 3FEKA 2L67A 2RCQA 4EEJA 2CBSA 1YP6A 4Y0RA 4YMYA 5IO7A 4I9SA 1GX9A 5HZ8A 4YBUA 2AKQA 2G79A 2HMBA 4A60A 1ICNA 1HMRA 3HK1A 2KTDA 5K06A 1SY0A 2E4JA 3I17A 1B0OA 2OZQA 4ORSA 4GNYA 5BVTA 1OEJA 1SXXA 1OPAA 3FR4A 4IAWA 3CQRA 5KICA 3B2LA 1PM1X 5HZQA 3NPOA 4QAEA 3P6DA 2Q39A 1SXYA 2AT3X 1H91A 4I3CA 4ODDA 3FA6A 5LJBA 3BS2A 1PBOA 4XMFA 1LIEA 1T8VA 1JV4A 2A13A 1HQPA 4QZTA 2WSJA 4ZHHA 4A1YA 1DZMA 1LICA 1X8UA 5JR8A 1E00A 4MVKA 2PY1A 2G7BA 4QGVA 5IO5A 1L6MA 1EALA 4TQ2A 1NGLA 3U0DA 2AT6X 4XMDA 2OVDA 3VG5A 4OMWA 2LB6A 3KFFA 3VG3A 3EMMA 1BBPA 1SXUA 4EDEA 5EZ2A 1ACDA 1ML7A 1UZ2X 1SXWA 2R74A 4NLIA 3F9DA 2K62A 1IIUA 2AT5X 1IFBA 1MDCA 4QYPA 1BEBA 2LBVA 5LKEA 1GKAB 1AB0A 2MO5A 3WJCA 4I3DA 4N7CA 2BLGA 2ACPX 1BRPA 3NR3A 4R0BA 3B2IA 5L8IA 2JU3A 4AZNA 1ZNDA 3APVA 1DZJA 2FWVA 3EBWA 5BVQA 1QY2A 3PP6A 2CM9A 1P6PA 3CWKA 3NQ9A 3PEDA 5AQ6A 1CRBA 1QFTA 2HZQA 2FRSA 5H8TA 4YGGA 4NLJA 4ZHDA 1FEMA 2GC9A 3BX8A 2QOSC 2WQAE 4ORRA 3BY0A 1KQXA 4ORXA 2HYSA 1JJJA 3C78X 3HWFA 4ORUA 2CM4A 4M7MA 2Q2PA 1MX7A 3B2KA 3ZUIA 3FENA 3KQ0A 2NNEA 1JJXA 1LFOA 3BLGA 1KT6A 2ANSA 1B4MA 2IFBA 5F6BA 1FENA 4YGZA 1GT5A 2YG2A 3CBSA 2FS6A 1I4UA 1ZNGA 2GJ5A 2Q2MA 2WEXA 4XMHA 1ERXA 1HBQA 1JBHA 1RBPA 3B2JA 2NNQA 3WJFA 1KT4A 1EIOA 1YWAA 2DM5A 3I0AA 3C76X 5LJGA 1TOWA 1TOUA 1A18A 4GETA 4EXZA 4ORYA 1CBSA 4Y0PA 3UEUA 1ALBA 4YBPA 1FTPA 3P6FA 3O2YA 1EPAA 1U17A 2X46A 3HWEA 1IKEA 1IFCA 3FEPA 3B2HA 1S44A 2QO6A 1PMPA 2JU8A 3BDRA 3FW4A 4I3BA 1QY1A 1YIVA 4IAXA 4ZCBA 2A2GA 3IA8A 4GNWA 1MVGA 3FR5A 4YKMA 5H9LA 1DZPA 1FDQA 2AMMX 1Z24A 4Y0SA 5H9KA 4ALOA 3BX7A 3P6HA 2OVEA 4ALBA 1EUOA 2L5PA 2Q4NA 2OFRX 1BRQA 4K19A 4TLJA 3P6EA 1CJ5A 1UREA 2R73A 1X8PA 3JS1A 4M6SA 3WBGA 2KT4B 3APXA 5HWZA 1HN2A 3KZAA 3VG7A 1EPBA 1KT5A 3L4RA 3EM0A 1KGLA 1NP1A 4KIIA 3S26A 2WEWA 4XMEA 4UU2A 2F73A 5F6ZA 1BSOA 5HAEA 2W2FA 5HCEC 4LKTA 2W2BA 3BRNA 4TNNA 4DQ4A 4ZH9A 2LFOA 3P6GA 1G7NA 3CBCA 4NYRA 4NYQA 3NQ3A 4YFPA 1OEEA 3SAOA 5HZ6A 1D2UA 2AT8X 4CK4A 5LJHA 2XSTA 1I06A 5LJEA 1ZNLA 5D4AA 1X71A 2W2AA 2CZTA 4QZUA 4IMOA 5HA0A 1OBPA 1B56A 4BVMA 4ORWA 2NNDA 1KZWA 4IB8A 2LKKA 3MVFA 4HPAA 3D96A 4AZOA 3DTQA 4HPCA 3STMX 4I9RA 3NADA 2L68A 1LIDA 1EQDA 1XKIA 1LF7A 3ELZA 1T68X 4HPBA 1KT7A 5HA1A 5EPQA 3VG6A 3PPTA 3G7XA 1X89A 1ZNKA 4IMNA 2JN3A 4D6AA 5HTDA 2QO5A 4WFUA 4XMCA 1N0SA 1HBPA 3KFIA 3DSZA 1BJ7A 4ES7A 4GE1A 3WJGA 2ASNX 2G78A 2GTFX 4YDBA 2QO4A 4YKOA 5H9AA 1FE3A 3OJYC 5D45A 3ZQ3A 4ZHGA 1SY1A 3EYCA 3U9PC 1KZXA 1OBUA 4A1HA 3CQNA 1I04A 1BSQA 3KFGA 5D48A 1QY0A 3HWGA 4TJZA 4MVIA 5CE4A 2O62A 1BM5A 4N7DA 1EXSA 2A3FX 3D95A 5L8NA 1QG5A 3PECA 4IB9A 3UEWA 1LNMA 1U18A 4YH0A 3RSWA 1X8OA 4ZHFA 1GM6A 1O1UA 1GXAA 4TKHA 1CBRA 4HPDA 1BSYA 1YWBA 3AKMA 1G74A 4GKCA 4OMXA 1GT3A 4OS0A 2OFMX 2MM3A 4RUNA 5L8OA 1R0UA 2FLJA 3UEXA 1MX8A 1BLRA 1KT3A 4QYNA 3TGCA 3BU1A 3FLLA 3WVMA 5F1EA 4Y0QA 5EEEA 3FELA 1EIIA 1I05A 3CMPA 4AZRA 1MUPA 5EDCA 1IW2A 1BWYA 2JOZA 1E5PA 5FENA 4WFVA 4HFOA 1LIBA 4PSQA 3P6CA 1A2DA 1ADLA 1JYDA 4QGWA 1VPRA 3T1DA 1O1VA 2A2UA 3NX1A 1SA8A 5EEDA 5KHPA 3TZSA 2X45A 1S7DA 3JSQA 4BQUA 1AVGI 3K3LA 4O9SA 4OS8A 3APWA 4ZHCA 3PH5A 1DV9A 2WR6A 3FA9A 5LJDA 1G85A 1PEEA 5LJKA 5B27A 5HZ5A 1O8VA 3Q6LA 3VG4A 4UU3A 3MBTA 1S2PA 1KXOA 3HWDA 4IBAA 1G5WA 5DPQA 1QWDA 3WJBA 2L9CA 3PH6A 3KFHA 1E02A 4LZUA 3U03A 5FAZA 5H9NA 2NP1A 1LKEA 2WWPA 3ELXA 4DQ3A 2RA6A 4TKJA 2FTBA 1VYGA 3O22A 2P8GA 1XCAA 1GKAA 1OPBA 5HCDC 1QQSA 4LKPA 3FR2A 1SY3A 2FR3A 4AZQA 1X8NA 4BOEA 1AELA 3F8AA 3NX2A 5F58A 5IO6A 2FS7A 4A8ZA 2QM9A 4TKBA 5LKFA 4AZMA 4D6BA 4ZFXA 2HLVA 2POAA 1JZUA 1YP7A 1HMTA 3WJDA 4WBKA 4YFQA 5D8JA 4GRJA 2OVAA 5DG4A 3TGBA 3CR6A 1TXLA 4QGXA 1D3SA 4NNTA 5D47A 1E06A 4RUUA 2N93A 1GT4A 3FIQA 4ARHA 2MJIA 2A0AA 4YCHA 1ICMA 2RD7C 1KQWA 4AZPA 5KIDA 1ZNHA 2AH7X 2R56A 2FR2A 1TW4A 1JYJA 2AL0X 2ALLX 1CBQA
chains in the Genus database with same CATH superfamily
4NP1A 1JMXA 4ZR2A 3RBYA 1DC9A 2RTLA 2VFBA 2K23A 1RSTB 4U8UN 4C5PA 5HBSA 1I78A 4YCEA 3VHIA 1VWLB 3UEVA 1LCWA 2FT9A 3MX7A 1AQBA 3P24A 3PK2A 4ML7B 4OS3A 2RTRB 3AKNA 1T0VA 1VWPB 5BVSA 3D97A 2RTQB 1SWSA 3FW5A 5IXGA 4YGHA 5BYPA 1JIWI 2BT9A 1AVDA 5HCCC 4IB6A 4CDDA 1HXLA 3TGAA 3STKA 3FIDA 5H9AA 3QKGA 1NP4A 2C1SA 2RTKA 2Z4IA 1X8QA 3FMZA 2HZRA 3S5XA 4MVLA 1YWCA 3OD9A 3RY1A 4CV7A 2ACOA 4XMGA 4ZJ0A 4CSBA 4ZGUA 5F2BA 2LBAA 4DCBA 1DF3A 1QABE 2WPUA 1HMSA 1TVQA 1U0XA 3BU9A 1OEKA 4JGLA 2ZAIA 1SWOA 3EBKA 3RE6A 5FFHA 3WJEA 3WZNA 2HNXA 3NP1A 1SY2A 4GH7A 1YUPA 5HTEA 1A3YA 1N9MA 3FA8A 3MM0A 3GAQA 2Q9SA 1OBQA 3C77X 1YWDA 2CBRA 4YDAA 2WQ9A 1VWMB 1FJ1E 1VYFA 3STNA 3WYQA 4BCSA 1N9YA 2I5ZO 1ZRYA 5HZ9A 4ZH6A 4IABA 1KOIA 3RZYA 4EFGA 4GK9A 5EDBA 3VG2A 1HQQA 3FA7A 3SZHA 3ZUOA 4BX6B 2CZUA 1LPJA 1MK5A 1ZNEA 1FELA 2Y3EA 4IB7A 4CPHB 1B8EA 1CBIA 1LIFA 3IFBA 1DFVA 4Y5DA 3APUA 4LQZA 5F7GA 5IRAA 3ZZVA 5B29A 1I9HA 2G5LA 1GGLA 1DF8A 1GX8A 4COTA 5C0NA 1ERBA 1SWFA 2JU7A 2X55A 1IKJA 1EW3A 4LZVA 2WUTA 3BSZE 4NNSA 4AYHA 1A57A 2M4LA 3WXQA 1QFVA 2RCTA 3EW1A 3O19A 3RKGA 3TF6A 1DZKA 2AT0X 1RLBE 2EU7X 1N4JA 2FGSA 2RQ0A 2XKLA 4U8UO 4YFRA 3RY2A 5CHKA 2C1QA 5FQ7E 5LJCA 4QRLA 1SWEA 1GT1A 3FEKA 2L67A 2RCQA 4EEJA 3X00A 2CBSA 1YP6A 4Y0RA 4YMYA 5IO7A 4I9SA 1GX9A 1MM9A 5HZ8A 2YMSA 2RTOB 4YBUA 2AKQA 2G79A 2HMBA 4A60A 1ICNA 1HMRA 1Y9LA 3AEHA 3HK1A 2Y3FA 2KTDA 2OF9A 5K06A 2BSZA 1SY0A 2E4JA 3I17A 3ZW0B 1B0OA 2OZQA 4ORSA 4GNYA 5BVTA 5LJHA 1OEJA 1SXXA 1OPAA 2ZAGA 5L8OA 3FR4A 4CPFA 3VGWA 2MF6A 4QQ1A 4IAWA 3CQRA 5KICA 3B2LA 1PM1X 5HZQA 3HOLA 2VDFA 2BS5A 3SOTA 3NPOA 1SWQA 4QAEA 3P6DA 2Q39A 2VFCA 1SXYA 4BGFA 4U8UM 3RDMA 2AT3X 1H91A 4CDCA 4I3CA 3RE5A 1WBIA 4Z27A 4ODDA 3P02A 3FA6A 2G8CO 2IZAA 5LJBA 1AVEA 3BS2A 1PBOA 4XMFA 1LIEA 2IZBA 4FBVA 1VYOA 1T8VA 4GGZA 4O3XB 2FHNX 3H3IA 4MVEA 1JV4A 2A13A 1HQPA 3CKFA 4QZTA 2OL6O 2WSJA 4ZHHA 1SWRA 4A1YA 1DZMA 1LICA 1X8UA 5JR8A 1E00A 1WUBA 2IZGB 4MVKA 2PY1A 2G7BA 4QGVA 5IO5A 4CDFA 2IZLB 1L6MA 1EALA 4TQ2A 1NGLA 4KC8A 2AT6X 4O4SA 5JD2A 4XMDA 4B55A 2OVDA 1SWLA 4OMWA 2LB6A 3KFFA 3LHNA 3VG3A 1VWEB 3EMMA 3VG5A 1BBPA 1NQNA 1SXUA 4EDEA 1VWDB 5EZ2A 3SLJA 1ACDA 1ML7A 1UZ2X 1Y55X 2X56A 1SLEB 1SXWA 2R74A 4NLIA 2MWHA 5B5GA 3F9DA 2A5CA 2K62A 2OFBA 1IIUA 2OL8O 2AT5X 4O3WA 4KT5A 1N43A 1VWQB 1IFBA 2OVSA 1MDCA 2RTHB 4QYPA 1BEBA 2LBVA 1SLGB 4MISA 2IZJA 5LKEA 1GKAB 1AB0A 2MO5A 3WJCA 4I3DA 4N7CA 5B10O 2BLGA 2ACPX 1BRPA 3NR3A 1SLFB 4R0BA 3B2IA 4O4OA 3ZW1B 4EKVA 5L8IA 2JU3A 4L3RA 2PI3O 4AZNA 1ZNDA 3APVA 1DZJA 4WHIA 2FWVA 4EQAC 1VWRB 3EBWA 4Y59A 2FKJA 5BVQA 1QY2A 2Z4HA 4BX7A 3PP6A 1RXKA 2OL7A 3FDCA 1VWKB 4BX5B 2CM9A 1P6PA 1SWUA 2GTLN 3CWKA 3NQ9A 3PEDA 3WYPA 1RXJA 5AQ6A 1CRBA 1QFTA 2HZQA 1Y0GA 2FRSA 5H8TA 3SZIA 4GJSA 4YGGA 4NLJA 4ZHDA 1FEMA 2GC9A 2KD2A 3BX8A 2QOSC 2WQAE 4ORRA 3BY0A 4ZGFA 1KQXA 4ORXA 2HYSA 1JJJA 2AF5A 1JQPA 3C78X 3HWFA 1SRGA 4ORUA 2CM4A 4M7MA 2Q2PA 1MX7A 3B2KA 2DJGA 4KC7A 1HXZA 3FENA 3ZUIA 4Z28A 3KQ0A 1Y9TA 2NNEA 1JJXA 1LFOA 3BLGA 1KT6A 1SWKA 2ANSA 2RTMA 2X4MA 5K67A 2IFBA 1B4MA 5F6BA 1FENA 4YGZA 4GZVA 1GT5A 4OELA 2YG2A 1SMPI 3CBSA 4GUZA 4OKAA 2FS6A 1K24A 1I4UA 1ZNGA 2A8GA 2GJ5A 2Q2MA 3U0DA 2WEXA 1LCVA 4XMHA 1STSB 2C4IA 5CYBA 1ERXA 2X8SA 1HBQA 1VWGB 1JBHA 1RBPA 3S60A 3B2JA 2NNQA 3WJFA 1KT4A 1EIOA 1JJUA 1Y53X 1YWAA 2DM5A 1NC9A 3C76X 3I0AA 1TOWA 1TOUA 5LJGA 1A18A 4GETA 4EXZA 1N7YA 4ORYA 1CBSA 4Y0PA 3HTYA 3UEUA 1ALBA 4Z2OA 1JMZA 4YBPA 1FTPA 5B5FA 3P6FA 3O2YA 1EPAA 3KVNA 2RTGB 3OBLA 1PBYA 1U17A 2F09A 2X46A 3HWEA 1IKEA 1KL5A 1IFCA 4DNEA 3LV4A 3FEPA 3LTWA 4NV8A 1VWOB 3B2HA 1S44A 2KTSA 1PMPA 2QO6A 3PQSA 2F01A 2JU8A 3BDRA 3FW4A 4I3BA 1QY1A 1YIVA 1VWIB 4IAXA 4ZCBA 2A2GA 3IA8A 4FBOA 4GNWA 1MVGA 3FR5A 4YKMA 3UAQA 5H9LA 1DZPA 1FDQA 2AMMX 1Z24A 4Y0SA 5H9KA 2OF8A 3BX7A 3N91A 2IZDB 3HPEA 3P6HA 4ALOA 1IJ8A 2OVEA 1EUOA 3GE2A 4ALBA 2OY1O 2L5PA 2Q4NA 2OFRX 4GD9A 1BRQA 2RTAA 1HY2A 3NQKA 4K19A 2GH7A 4TLJA 3P6EA 3WZPA 1CJ5A 3HOEA 1UREA 3RWXA 2R73A 1LCZA 2UYWA 5IRWA 1X8PA 3JS1A 2HKDA 4ID2A 4M6SA 3WBGA 1SRFA 2KT4B 3APXA 5HWZA 1HN2A 3KZAA 3VG7A 1EPBA 1KT5A 1SWGA 3L4RA 3EM0A 2OY7A 1KGLA 1NP1A 4KIIA 3S26A 1Y52X 2WEWA 4XMEA 4UU2A 4I95A 2F73A 1NQMA 1BSOA 1STRB 5F6ZA 5HAEA 2W2FA 3EC5A 4LKTA 5HCEC 2W2BA 3BRNA 4TNNA 4FQBB 4DQ4A 2RTJA 4ZH9A 1MOYA 2LFOA 3P6GA 1G7NA 2QMIA 3CBCA 4NYQA 2X32A 3NQ3A 4NYRA 3V8UA 4YFPA 1OEEA 4NV7A 3SAOA 1D2UA 2AT8X 4CK4A 4Z2PA 5HZ6A 2XSTA 2RTIB 3VE1A 5AEOA 1I06A 1GX3A 5LJEA 1SWBA 1VWNB 1ZNLA 1SLDB 1MEPA 4IRWA 5D4AA 1KFFA 1X71A 1RAVA 2W2AA 2JGSA 2CZTA 2RTDB 4QZUA 2RTPB 4IMOA 1SWJA 5HA0A 1OBPA 2AVIA 4GDZA 4JO6A 1RXHA 1B56A 4BVMA 2MHDA 4ORWA 2NNDA 1KZWA 3VHMA 2IZKA 4IB8A 2LKKA 3MVFA 2I5VO 3D96A 4HPAA 4AZOA 3DTQA 4HPCA 3STMX 4I9RA 3NADA 1SRIA 2L68A 4PJ2A 3VU1A 1LIDA 1EQDA 1W4TA 1XKIA 3Q34A 3RDUA 1LF7A 3ELZA 1T68X 1LDQA 4HPBA 1KT7A 4QNIA 4CPEA 5HA1A 5EPQA 3VG6A 3PPTA 3G7XA 1SWHA 1X89A 1ZNKA 2IZCB 4GDAA 4GU8A 1LDOA 3ZW2A 4IMNA 2JN3A 2Y32A 1NDJA 4D6AA 5HTDA 2QO5A 1PTSA 4WFUA 4XMCA 1N0SA 2RTFB 4O4UA 1HBPA 3CKGA 3KFIA 2CAMA 3DSZA 1BJ7A 4ES7A 4JHQA 3WZOA 4GE1A 2A5BA 3WJGA 2ASNX 3JQOA 5B2AO 1OSPO 1VWHB 2G78A 2GTFX 4GGTA 2QO4A 4YDBA 4YKOA 1FE3A 1LUQA 1SWPA 3OJYC 5D45A 3ZQ3A 4ZHGA 1SRJA 1SY1A 3EYCA 3U9PC 1KZXA 1OBUA 4A1HA 3CQNA 3ZI8A 4BX6A 1I04A 1BSQA 3KFGA 5D48A 1QY0A 2LA7A 3HWGA 2IZFB 4L1NA 4MVIA 4NW4A 4TJZA 5K68A 4CPHA 2O62A 5CE4A 1BM5A 2FKGA 4N7DA 1EXSA 2OYBO 2OY5O 3SZJA 4Z6JA 2X8FA 2A3FX 2IZHB 3D95A 4BJ8A 5L8NA 1QG5A 3F6ZB 3PECA 4IB9A 3RDSA 3UEWA 1LNMA 5AJCA 4FBRA 4FGIB 3D4RA 1U18A 4YH0A 3RSWA 4O3YA 1X8OA 3RDQA 1EI5A 1GM6A 3SLTA 4AW8A 4ZHFA 1O1UA 4MEEA 1GXAA 4TKHA 1VWJB 1CBRA 4BX7B 2BHVA 4GJVA 1BSYA 4HPDA 4KH8A 1YWBA 3AKMA 1G74A 4GKCA 4OMXA 1GT3A 2JMBA 2OFMX 2MM3A 4OS0A 4RUNA 1R0UA 2FLJA 1NBXA 1MX8A 3UEXA 1KT3A 1BLRA 4QYNA 3TGCA 4INNA 1SREA 2X8TA 3RDOA 5CSEA 3BU1A 1STPA 3FLLA 3WVMA 5F1EA 4Y0QA 5EEEA 1SWTA 3FELA 3ZW0A 1EIIA 1I05A 3CMPA 3T2WA 4AZRA 1MUPA 5EDCA 1IW2A 1BWYA 2JOZA 1E5PA 2QOMA 4KCAA 3VHHA 5FENA 4WFVA 5L3YA 4HFOA 1LIBA 2RN4A 1KL4A 3P6CA 4PSQA 1A2DA 1ADLA 1JYDA 1SWDA 2OFAA 4GGRA 4QGWA 1VPRA 3T1DA 1O1VA 2A2UA 3NX1A 1SA8A 1VWAB 2GTLO 1K3BA 4JNJA 5EEDA 5KHPA 3TZSA 2X45A 1S7DA 3JSQA 3VE2A 1W6FA 4BQUA 4Z2VA 1AVGI 3K3LA 4BBOA 5FQ6E 2BS6A 4ON1A 4HWMA 4U9CA 3SLOA 3VPJE 4O9SA 2RTBB 4OS8A 3WOVA 3APWA 4ZHCA 3PH5A 1VWFB 1DV9A 2WR6A 3FA9A 5LJDA 4CDEA 4YVBA 1G85A 1E2TA 2QCBA 1PEEA 5LJKA 5B27A 4U46A 5HZ5A 5B11O 3E3CA 1O8VA 3Q6LA 1KL3A 3VG4A 4UU3A 5AJBA 1UYNX 3MBTA 1S2PA 1KXOA 2IZEB 3HWDA 4IBAA 1G5WA 5DPQA 2FHLA 1QWDA 2BC3A 3QQ2A 3EW2A 4O3ZA 2ZSCA 1SWAA 3S5VA 3WJBA 4I60A 2GTLM 2L9CA 3PH6A 1VWCB 4CPIA 3KFHA 1E02A 3PQUA 4LZUA 3U03A 5FAZA 5H9NA 2NP1A 1LKEA 2WWPA 3ELXA 4DQ3A 4MIRA 2RA6A 4TKJA 1RSUB 2FTBA 3T6LA 1SWNA 1VYGA 3O22A 2P8GA 1XCAA 1GKAA 1OPBA 4O4XA 5HCDC 1QQSA 4LKPA 3FR2A 1SY3A 2KW1A 2FR3A 4AZQA 1LELA 1X8NA 3ZW1A 2JW1A 2X34A 2OY8A 4BOEA 1AELA 3F8AA 3NX2A 5F58A 5IO6A 1SRHA 2FS7A 4A8ZA 2QM9A 4TKBA 4O49A 5LKFA 4AZMA 4D6BA 4ZFXA 3NBXX 2HLVA 2RTCB 5B3MO 2POAA 1SWCA 2UZ2A 1JZUA 3T6FA 1YP7A 4BX5A 1HMTA 5FQ8E 3WJDA 4WBKA 3AUMO 4YFQA 5D8JA 4GRJA 2OVAA 2RTNB 5DG4A 3RDXA 3TGBA 3WZQA 3CR6A 1TXLA 4QGXA 4U3QA 3ZWEA 1D3SA 3D9WA 4NNTA 5D47A 1E06A 1VWBB 4RUUA 2N93A 1W5RA 2DJFA 1GT4A 3FIQA 1UYOX 3OE3A 4I6SA 4ARHA 2MJIA 2A0AA 4YCHA 3PDFA 1ICMA 2RD7C 1KQWA 5IRUA 3T2XA 4AZPA 5KIDA 2RTEB 1ZNHA 3MG5A 2AH7X 2R56A 2FR2A 1TW4A 1JYJA 2AL0X 2ALLX 4OEMA 2IZIA 1CBQA 3FYFA
chains in the Genus database with same CATH topology
4NP1A 4ZR2A 3RBYA 1DC9A 2K23A 4U8UN 5HBSA 4YCEA 3UEVA 2FT9A 3MX7A 1AQBA 3P24A 4ML7B 4AW8A 4OS3A 5BVSA 3AKNA 1T0VA 3D97A 3FW5A 4YGHA 5BYPA 1JIWI 2BT9A 5HCCC 4IB6A 3TGAA 3STKA 3QKGA 1NP4A 2Z4IA 1X8QA 3FMZA 2HZRA 3S5XA 4MVLA 1YWCA 3OD9A 4CV7A 2ACOA 4XMGA 4ZJ0A 4CSBA 4ZGUA 2LBAA 1DF3A 1QABE 1HMSA 1TVQA 1U0XA 3BU9A 1OEKA 4JGLA 2ZAIA 3EBKA 5FFHA 3WJEA 2HNXA 3NP1A 1SY2A 4GH7A 1YUPA 5HTEA 1A3YA 3FA8A 3GAQA 2Q9SA 1OBQA 3C77X 1YWDA 2CBRA 4YDAA 2WQ9A 1VYFA 3STNA 1ZRYA 5HZ9A 4ZH6A 4IABA 1KOIA 3RZYA 4EFGA 4GK9A 5EDBA 3VG2A 3FA7A 3ZUOA 2CZUA 1LPJA 1ZNEA 1FELA 4IB7A 1B8EA 1CBIA 1LIFA 3IFBA 1DFVA 5F7GA 3APUA 4LQZA 3ZZVA 5B29A 1GGLA 1GX8A 5C0NA 4COTA 1ERBA 2JU7A 4NNSA 1IKJA 1EW3A 4LZVA 2WUTA 3BSZE 4AYHA 1A57A 2M4LA 3WXQA 1QFVA 2RCTA 3O19A 3RKGA 3TF6A 1DZKA 2AT0X 1RLBE 2EU7X 4U8UO 2XKLA 2RQ0A 4YFRA 5FQ7E 5LJCA 4QRLA 1GT1A 3FEKA 2L67A 2RCQA 4EEJA 2CBSA 1YP6A 4Y0RA 4YMYA 5IO7A 4I9SA 1GX9A 5HZ8A 2YMSA 4YBUA 2AKQA 2G79A 2HMBA 4A60A 1ICNA 1HMRA 1Y9LA 3HK1A 2KTDA 5K06A 1SY0A 2E4JA 3I17A 3ZW0B 1B0OA 2OZQA 4ORSA 4GNYA 5BVTA 1OEJA 1SXXA 1OPAA 2ZAGA 5L8OA 3FR4A 4QQ1A 4IAWA 3CQRA 5KICA 3B2LA 1PM1X 5HZQA 3HOLA 2BS5A 3SOTA 3NPOA 4QAEA 3P6DA 2Q39A 1SXYA 4U8UM 2AT3X 1H91A 4I3CA 4ODDA 3P02A 3FA6A 5LJBA 3BS2A 1PBOA 4XMFA 1LIEA 4O3XB 4FBVA 1T8VA 3H3IA 4MVEA 1JV4A 2A13A 1HQPA 4QZTA 2WSJA 4ZHHA 4A1YA 1DZMA 1LICA 1X8UA 5JR8A 1E00A 4MVKA 2PY1A 2G7BA 4QGVA 5IO5A 1L6MA 1EALA 4TQ2A 1NGLA 4KC8A 2AT6X 4O4SA 3U0DA 4XMDA 2OVDA 3VG5A 4OMWA 2LB6A 3KFFA 3LHNA 3VG3A 3EMMA 1BBPA 1SXUA 4EDEA 5EZ2A 1ACDA 1ML7A 1UZ2X 1SXWA 2R74A 4NLIA 2MWHA 3F9DA 2K62A 1IIUA 2AT5X 4O3WA 4KT5A 1IFBA 2OVSA 1MDCA 4QYPA 1BEBA 2LBVA 4MISA 5LKEA 1GKAB 1AB0A 2MO5A 3WJCA 4I3DA 4N7CA 2BLGA 2ACPX 1BRPA 3NR3A 4R0BA 3B2IA 4O4OA 3ZW1B 5L8IA 2JU3A 4L3RA 4AZNA 1ZNDA 3APVA 1DZJA 4WHIA 2FWVA 4EQAC 3EBWA 5BVQA 1QY2A 2Z4HA 3PP6A 2CM9A 1P6PA 2GTLN 3CWKA 3NQ9A 3PEDA 5AQ6A 1CRBA 1QFTA 2HZQA 2FRSA 5H8TA 4YGGA 4NLJA 4ZHDA 1FEMA 2GC9A 2KD2A 3BX8A 2QOSC 2WQAE 4ORRA 3BY0A 4ZGFA 1KQXA 4ORXA 2HYSA 1JJJA 3C78X 3HWFA 4ORUA 2CM4A 4M7MA 2Q2PA 1MX7A 3B2KA 4KC7A 3ZUIA 3FENA 3KQ0A 1Y9TA 2NNEA 1JJXA 1LFOA 3BLGA 1KT6A 2ANSA 1B4MA 2IFBA 5F6BA 1FENA 4YGZA 4GZVA 1GT5A 2YG2A 1SMPI 3CBSA 2FS6A 1I4UA 1ZNGA 2GJ5A 2Q2MA 2WEXA 4XMHA 5CYBA 1ERXA 2X8SA 1HBQA 1JBHA 1RBPA 3S60A 3B2JA 2NNQA 3WJFA 1KT4A 1EIOA 1YWAA 2DM5A 3I0AA 3C76X 5LJGA 1TOWA 1TOUA 1A18A 4GETA 4EXZA 4ORYA 1CBSA 4Y0PA 3HTYA 3UEUA 1ALBA 4YBPA 1FTPA 3P6FA 3O2YA 1EPAA 3OBLA 1U17A 2F09A 2X46A 3HWEA 1IKEA 1IFCA 3LV4A 3FEPA 3B2HA 1S44A 2KTSA 1PMPA 2QO6A 3PQSA 2JU8A 3BDRA 3FW4A 4I3BA 1QY1A 1YIVA 4IAXA 4ZCBA 2A2GA 3IA8A 4FBOA 4GNWA 1MVGA 3FR5A 4YKMA 3UAQA 5H9LA 1DZPA 1FDQA 2AMMX 1Z24A 4Y0SA 5H9KA 4ALOA 3BX7A 3N91A 3P6HA 2OVEA 3GE2A 1EUOA 4ALBA 2L5PA 2Q4NA 2OFRX 1BRQA 3NQKA 4K19A 4TLJA 3P6EA 1CJ5A 3HOEA 1UREA 3RWXA 2R73A 1X8PA 3JS1A 4ID2A 4M6SA 3WBGA 2KT4B 3APXA 5HWZA 1HN2A 3KZAA 3VG7A 1EPBA 1KT5A 3L4RA 3EM0A 1KGLA 1NP1A 4KIIA 3S26A 2WEWA 4XMEA 4UU2A 4I95A 2F73A 5F6ZA 1BSOA 5HAEA 2W2FA 5HCEC 4LKTA 2W2BA 3BRNA 4TNNA 4FQBB 4DQ4A 4ZH9A 2LFOA 3P6GA 1G7NA 2QMIA 3CBCA 4NYQA 3NQ3A 4NYRA 3V8UA 4YFPA 1OEEA 3SAOA 5HZ6A 1D2UA 2AT8X 4CK4A 5LJHA 2XSTA 3VE1A 5AEOA 1I06A 5LJEA 1ZNLA 5D4AA 1X71A 2W2AA 2CZTA 4QZUA 4IMOA 5HA0A 1OBPA 4GDZA 1B56A 4BVMA 2MHDA 4ORWA 2NNDA 1KZWA 4IB8A 2LKKA 3MVFA 4HPAA 3D96A 4AZOA 3DTQA 4HPCA 3STMX 4I9RA 3NADA 2L68A 4PJ2A 3VU1A 1LIDA 1EQDA 1XKIA 1LF7A 3ELZA 1T68X 4HPBA 1KT7A 4QNIA 5HA1A 5EPQA 3VG6A 3PPTA 3G7XA 1X89A 1ZNKA 4GU8A 3ZW2A 4IMNA 2JN3A 4D6AA 5HTDA 2QO5A 4WFUA 4XMCA 1N0SA 4O4UA 1HBPA 3KFIA 3DSZA 1BJ7A 4ES7A 4GE1A 3WJGA 2ASNX 3JQOA 2G78A 2GTFX 4YDBA 2QO4A 4YKOA 5H9AA 1FE3A 3OJYC 5D45A 3ZQ3A 4ZHGA 1SY1A 3EYCA 3U9PC 1KZXA 1OBUA 4A1HA 3CQNA 3ZI8A 1I04A 1BSQA 3KFGA 5D48A 1QY0A 2LA7A 3HWGA 4NW4A 4L1NA 4MVIA 4TJZA 5CE4A 2O62A 1BM5A 4N7DA 1EXSA 2X8FA 2A3FX 3D95A 5L8NA 1QG5A 3F6ZB 3PECA 4IB9A 3UEWA 1LNMA 5AJCA 4FBRA 4FGIB 3D4RA 1U18A 4YH0A 3RSWA 4O3YA 1X8OA 4ZHFA 1EI5A 1GM6A 1O1UA 1GXAA 4TKHA 1CBRA 2BHVA 4HPDA 1BSYA 4KH8A 1YWBA 3AKMA 1G74A 4GKCA 4OMXA 1GT3A 2JMBA 2OFMX 2MM3A 4OS0A 4RUNA 1R0UA 2FLJA 3UEXA 1MX8A 1BLRA 1KT3A 4QYNA 3TGCA 4INNA 2X8TA 3BU1A 3FLLA 3WVMA 5F1EA 4Y0QA 5EEEA 3ZW0A 3FELA 1EIIA 1I05A 3CMPA 4AZRA 1MUPA 5EDCA 1IW2A 1BWYA 2JOZA 1E5PA 4KCAA 5FENA 4WFVA 4HFOA 1LIBA 2RN4A 4PSQA 3P6CA 1A2DA 1ADLA 1JYDA 4QGWA 1VPRA 3T1DA 1O1VA 2A2UA 3NX1A 1SA8A 2GTLO 5EEDA 5KHPA 3TZSA 2X45A 1S7DA 3JSQA 3VE2A 4BQUA 1AVGI 3K3LA 5FQ6E 2BS6A 4ON1A 4HWMA 4U9CA 3VPJE 4O9SA 4OS8A 3WOVA 3APWA 4ZHCA 3PH5A 1DV9A 2WR6A 3FA9A 5LJDA 1G85A 1PEEA 5LJKA 5B27A 5HZ5A 3E3CA 1O8VA 3Q6LA 3VG4A 4UU3A 5AJBA 3MBTA 1S2PA 1KXOA 3HWDA 4IBAA 1G5WA 5DPQA 1QWDA 4O3ZA 3WJBA 3S5VA 2GTLM 2L9CA 3PH6A 3KFHA 1E02A 3PQUA 4LZUA 3U03A 5FAZA 5H9NA 2NP1A 1LKEA 2WWPA 3ELXA 4DQ3A 4MIRA 2RA6A 4TKJA 2FTBA 1VYGA 3O22A 2P8GA 1XCAA 1GKAA 1OPBA 4O4XA 5HCDC 1QQSA 4LKPA 3FR2A 1SY3A 2KW1A 2FR3A 4AZQA 1X8NA 3ZW1A 2JW1A 4BOEA 1AELA 3F8AA 3NX2A 5F58A 5IO6A 2FS7A 4A8ZA 2QM9A 4TKBA 4O49A 5LKFA 4AZMA 4D6BA 4ZFXA 3NBXX 2HLVA 2POAA 1JZUA 1YP7A 1HMTA 5FQ8E 3WJDA 4WBKA 4YFQA 5D8JA 4GRJA 2OVAA 5DG4A 3TGBA 3CR6A 1TXLA 4QGXA 4U3QA 3ZWEA 1D3SA 4NNTA 5D47A 1E06A 4RUUA 2N93A 1GT4A 3FIQA 3OE3A 4I6SA 4ARHA 2MJIA 2A0AA 4YCHA 1ICMA 2RD7C 1KQWA 4AZPA 5KIDA 1ZNHA 2AH7X 2R56A 2FR2A 1TW4A 1JYJA 2AL0X 2ALLX 1CBQA 3FYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NP1 A;  4ZR2 A;  1DC9 A;  2K23 A;  5HBS A;  4YCE A;  3UEV A;  2FT9 A;  1AQB A;  4AW8 A;  4OS3 A;  5BVS A;  3AKN A;  1T0V A;  3D97 A;  3FW5 A;  4YGH A;  5HCC C;  4IB6 A;  3TGA A;  3STK A;  3QKG A;  1NP4 A;  1X8Q A;  3FMZ A;  2HZR A;  4MVL A;  1YWC A;  2ACO A;  4XMG A;  4ZJ0 A;  4ZGU A;  2LBA A;  1DF3 A;  1QAB E;  1HMS A;  1TVQ A;  1U0X A;  3BU9 A;  1OEK A;  3EBK A;  5FFH A;  3WJE A;  2HNX A;  3NP1 A;  1SY2 A;  4GH7 A;  1YUP A;  5HTE A;  1A3Y A;  3FA8 A;  3GAQ A;  2Q9S A;  1OBQ A;  3C77 X;  1YWD A;  2CBR A;  4YDA A;  2WQ9 A;  1VYF A;  3STN A;  1ZRY A;  5HZ9 A;  4ZH6 A;  1KOI A;  3RZY A;  4EFG A;  5EDB A;  3VG2 A;  3FA7 A;  3ZUO A;  2CZU A;  1LPJ A;  1ZNE A;  1FEL A;  4IB7 A;  1B8E A;  1CBI A;  1LIF A;  3IFB A;  1DFV A;  5F7G A;  3APU A;  5B29 A;  1GGL A;  1GX8 A;  5C0N A;  1ERB A;  2JU7 A;  4NNS A;  1IKJ A;  1EW3 A;  4LZV A;  2WUT A;  3BSZ E;  4AYH A;  1A57 A;  3WXQ A;  1QFV A;  2RCT A;  3O19 A;  3TF6 A;  1DZK A;  2AT0 X;  1RLB E;  2EU7 X;  2XKL A;  2RQ0 A;  4YFR A;  5LJC A;  1GT1 A;  3FEK A;  2L67 A;  2RCQ A;  4EEJ A;  2CBS A;  1YP6 A;  4Y0R A;  4YMY A;  5IO7 A;  4I9S A;  1GX9 A;  5HZ8 A;  4YBU A;  2AKQ A;  2G79 A;  2HMB A;  4A60 A;  1ICN A;  1HMR A;  3HK1 A;  2KTD A;  5K06 A;  1SY0 A;  2E4J A;  3I17 A;  1B0O A;  2OZQ A;  4ORS A;  4GNY A;  5BVT A;  1OEJ A;  1SXX A;  1OPA A;  3FR4 A;  4IAW A;  3CQR A;  5KIC A;  3B2L A;  1PM1 X;  5HZQ A;  3NPO A;  4QAE A;  3P6D A;  2Q39 A;  1SXY A;  2AT3 X;  1H91 A;  4I3C A;  4ODD A;  3FA6 A;  5LJB A;  3BS2 A;  1PBO A;  4XMF A;  1LIE A;  1T8V A;  1JV4 A;  2A13 A;  1HQP A;  4QZT A;  2WSJ A;  4ZHH A;  4A1Y A;  1DZM A;  1LIC A;  1X8U A;  5JR8 A;  1E00 A;  4MVK A;  2PY1 A;  2G7B A;  4QGV A;  5IO5 A;  1L6M A;  1EAL A;  4TQ2 A;  1NGL A;  3U0D A;  2AT6 X;  4XMD A;  2OVD A;  3VG5 A;  4OMW A;  2LB6 A;  3KFF A;  3VG3 A;  3EMM A;  1BBP A;  1SXU A;  4EDE A;  5EZ2 A;  1ACD A;  1ML7 A;  1UZ2 X;  1SXW A;  2R74 A;  4NLI A;  3F9D A;  2K62 A;  1IIU A;  2AT5 X;  1IFB A;  1MDC A;  4QYP A;  1BEB A;  2LBV A;  5LKE A;  1GKA B;  1AB0 A;  2MO5 A;  3WJC A;  4I3D A;  4N7C A;  2BLG A;  2ACP X;  1BRP A;  3NR3 A;  4R0B A;  3B2I A;  5L8I A;  2JU3 A;  4AZN A;  1ZND A;  3APV A;  1DZJ A;  2FWV A;  3EBW A;  5BVQ A;  1QY2 A;  3PP6 A;  2CM9 A;  1P6P A;  3CWK A;  3NQ9 A;  3PED A;  5AQ6 A;  1CRB A;  1QFT A;  2HZQ A;  2FRS A;  5H8T A;  4YGG A;  4NLJ A;  4ZHD A;  1FEM A;  2GC9 A;  3BX8 A;  2QOS C;  2WQA E;  4ORR A;  3BY0 A;  1KQX A;  4ORX A;  2HYS A;  1JJJ A;  3C78 X;  3HWF A;  4ORU A;  2CM4 A;  4M7M A;  2Q2P A;  1MX7 A;  3B2K A;  3ZUI A;  3FEN A;  3KQ0 A;  2NNE A;  1JJX A;  1LFO A;  3BLG A;  1KT6 A;  2ANS A;  1B4M A;  2IFB A;  5F6B A;  1FEN A;  4YGZ A;  1GT5 A;  2YG2 A;  3CBS A;  2FS6 A;  1I4U A;  1ZNG A;  2GJ5 A;  2Q2M A;  2WEX A;  4XMH A;  1ERX A;  1HBQ A;  1JBH A;  1RBP A;  3B2J A;  2NNQ A;  3WJF A;  1KT4 A;  1EIO A;  1YWA A;  2DM5 A;  3I0A A;  3C76 X;  5LJG A;  1TOW A;  1TOU A;  1A18 A;  4GET A;  4EXZ A;  4ORY A;  1CBS A;  4Y0P A;  3UEU A;  1ALB A;  4YBP A;  1FTP A;  3P6F A;  3O2Y A;  1EPA A;  1U17 A;  2X46 A;  3HWE A;  1IKE A;  1IFC A;  3FEP A;  3B2H A;  1S44 A;  2QO6 A;  1PMP A;  2JU8 A;  3BDR A;  3FW4 A;  4I3B A;  1QY1 A;  1YIV A;  4IAX A;  4ZCB A;  2A2G A;  3IA8 A;  4GNW A;  1MVG A;  3FR5 A;  4YKM A;  5H9L A;  1DZP A;  1FDQ A;  2AMM X;  1Z24 A;  4Y0S A;  5H9K A;  4ALO A;  3BX7 A;  3P6H A;  2OVE A;  4ALB A;  1EUO A;  2L5P A;  2Q4N A;  2OFR X;  1BRQ A;  4K19 A;  4TLJ A;  3P6E A;  1CJ5 A;  1URE A;  2R73 A;  1X8P A;  3JS1 A;  4M6S A;  3WBG A;  2KT4 B;  3APX A;  5HWZ A;  1HN2 A;  3KZA A;  3VG7 A;  1EPB A;  1KT5 A;  3L4R A;  3EM0 A;  1KGL A;  1NP1 A;  4KII A;  3S26 A;  2WEW A;  4XME A;  4UU2 A;  2F73 A;  5F6Z A;  1BSO A;  5HAE A;  2W2F A;  5HCE C;  4LKT A;  2W2B A;  3BRN A;  4TNN A;  4DQ4 A;  4ZH9 A;  2LFO A;  3P6G A;  1G7N A;  3CBC A;  4NYR A;  4NYQ A;  3NQ3 A;  4YFP A;  1OEE A;  3SAO A;  5HZ6 A;  1D2U A;  2AT8 X;  4CK4 A;  5LJH A;  2XST A;  1I06 A;  5LJE A;  1ZNL A;  5D4A A;  1X71 A;  2W2A A;  2CZT A;  4QZU A;  4IMO A;  5HA0 A;  1OBP A;  1B56 A;  4BVM A;  4ORW A;  2NND A;  1KZW A;  4IB8 A;  2LKK A;  3MVF A;  4HPA A;  3D96 A;  4AZO A;  3DTQ A;  4HPC A;  3STM X;  4I9R A;  3NAD A;  2L68 A;  1LID A;  1EQD A;  1XKI A;  1LF7 A;  3ELZ A;  1T68 X;  4HPB A;  1KT7 A;  5HA1 A;  5EPQ A;  3VG6 A;  3PPT A;  3G7X A;  1X89 A;  1ZNK A;  4IMN A;  2JN3 A;  4D6A A;  5HTD A;  2QO5 A;  4WFU A;  4XMC A;  1N0S A;  1HBP A;  3KFI A;  3DSZ A;  1BJ7 A;  4ES7 A;  4GE1 A;  3WJG A;  2ASN X;  2G78 A;  2GTF X;  4YDB A;  2QO4 A;  4YKO A;  5H9A A;  1FE3 A;  3OJY C;  5D45 A;  3ZQ3 A;  4ZHG A;  1SY1 A;  3EYC A;  3U9P C;  1KZX A;  1OBU A;  4A1H A;  3CQN A;  1I04 A;  1BSQ A;  3KFG A;  5D48 A;  1QY0 A;  3HWG A;  4TJZ A;  4MVI A;  5CE4 A;  2O62 A;  1BM5 A;  4N7D A;  1EXS A;  2A3F X;  3D95 A;  5L8N A;  1QG5 A;  3PEC A;  4IB9 A;  3UEW A;  1LNM A;  1U18 A;  4YH0 A;  3RSW A;  1X8O A;  4ZHF A;  1GM6 A;  1O1U A;  1GXA A;  4TKH A;  1CBR A;  4HPD A;  1BSY A;  1YWB A;  3AKM A;  1G74 A;  4GKC A;  4OMX A;  1GT3 A;  4OS0 A;  2OFM X;  2MM3 A;  4RUN A;  5L8O A;  1R0U A;  2FLJ A;  3UEX A;  1MX8 A;  1BLR A;  1KT3 A;  4QYN A;  3TGC A;  3BU1 A;  3FLL A;  3WVM A;  5F1E A;  4Y0Q A;  5EEE A;  3FEL A;  1EII A;  1I05 A;  3CMP A;  4AZR A;  1MUP A;  5EDC A;  1IW2 A;  1BWY A;  2JOZ A;  1E5P A;  5FEN A;  4WFV A;  4HFO A;  1LIB A;  4PSQ A;  3P6C A;  1A2D A;  1ADL A;  1JYD A;  4QGW A;  1VPR A;  3T1D A;  1O1V A;  2A2U A;  3NX1 A;  1SA8 A;  5EED A;  5KHP A;  3TZS A;  2X45 A;  1S7D A;  3JSQ A;  4BQU A;  1AVG I;  3K3L A;  4O9S A;  4OS8 A;  3APW A;  4ZHC A;  3PH5 A;  1DV9 A;  2WR6 A;  3FA9 A;  5LJD A;  1G85 A;  1PEE A;  5LJK A;  5B27 A;  5HZ5 A;  1O8V A;  3Q6L A;  3VG4 A;  4UU3 A;  3MBT A;  1S2P A;  1KXO A;  3HWD A;  4IBA A;  1G5W A;  5DPQ A;  1QWD A;  3WJB A;  2L9C A;  3PH6 A;  3KFH A;  1E02 A;  4LZU A;  3U03 A;  5FAZ A;  5H9N A;  2NP1 A;  1LKE A;  2WWP A;  3ELX A;  4DQ3 A;  2RA6 A;  4TKJ A;  2FTB A;  1VYG A;  3O22 A;  2P8G A;  1XCA A;  1GKA A;  1OPB A;  5HCD C;  1QQS A;  4LKP A;  3FR2 A;  1SY3 A;  2FR3 A;  4AZQ A;  1X8N A;  4BOE A;  1AEL A;  3F8A A;  3NX2 A;  5F58 A;  5IO6 A;  2FS7 A;  4A8Z A;  2QM9 A;  4TKB A;  5LKF A;  4AZM A;  4D6B A;  4ZFX A;  2HLV A;  2POA A;  1JZU A;  1YP7 A;  1HMT A;  3WJD A;  4WBK A;  4YFQ A;  5D8J A;  4GRJ A;  2OVA A;  5DG4 A;  3TGB A;  3CR6 A;  1TXL A;  4QGX A;  1D3S A;  4NNT A;  5D47 A;  1E06 A;  4RUU A;  2N93 A;  1GT4 A;  3FIQ A;  4ARH A;  2MJI A;  2A0A A;  4YCH A;  1ICM A;  2RD7 C;  1KQW A;  4AZP A;  5KID A;  1ZNH A;  2AH7 X;  2R56 A;  2FR2 A;  1TW4 A;  1JYJ A;  2AL0 X;  2ALL X;  1CBQ A; 
#chains in the Genus database with same CATH topology
 4NP1 A;  1JMX A;  4ZR2 A;  3RBY A;  1DC9 A;  2RTL A;  2VFB A;  2K23 A;  1RST B;  4U8U N;  4C5P A;  5HBS A;  1I78 A;  4YCE A;  3VHI A;  1VWL B;  3UEV A;  1LCW A;  2FT9 A;  3MX7 A;  1AQB A;  3P24 A;  3PK2 A;  4ML7 B;  4OS3 A;  2RTR B;  3AKN A;  1T0V A;  1VWP B;  5BVS A;  3D97 A;  2RTQ B;  1SWS A;  3FW5 A;  5IXG A;  4YGH A;  5BYP A;  1JIW I;  2BT9 A;  1AVD A;  5HCC C;  4IB6 A;  4CDD A;  1HXL A;  3TGA A;  3STK A;  3FID A;  5H9A A;  3QKG A;  1NP4 A;  2C1S A;  2RTK A;  2Z4I A;  1X8Q A;  3FMZ A;  2HZR A;  3S5X A;  4MVL A;  1YWC A;  3OD9 A;  3RY1 A;  4CV7 A;  2ACO A;  4XMG A;  4ZJ0 A;  4CSB A;  4ZGU A;  5F2B A;  2LBA A;  4DCB A;  1DF3 A;  1QAB E;  2WPU A;  1HMS A;  1TVQ A;  1U0X A;  3BU9 A;  1OEK A;  4JGL A;  2ZAI A;  1SWO A;  3EBK A;  3RE6 A;  5FFH A;  3WJE A;  3WZN A;  2HNX A;  3NP1 A;  1SY2 A;  4GH7 A;  1YUP A;  5HTE A;  1A3Y A;  1N9M A;  3FA8 A;  3MM0 A;  3GAQ A;  2Q9S A;  1OBQ A;  3C77 X;  1YWD A;  2CBR A;  4YDA A;  2WQ9 A;  1VWM B;  1FJ1 E;  1VYF A;  3STN A;  3WYQ A;  4BCS A;  1N9Y A;  2I5Z O;  1ZRY A;  5HZ9 A;  4ZH6 A;  4IAB A;  1KOI A;  3RZY A;  4EFG A;  4GK9 A;  5EDB A;  3VG2 A;  1HQQ A;  3FA7 A;  3SZH A;  3ZUO A;  4BX6 B;  2CZU A;  1LPJ A;  1MK5 A;  1ZNE A;  1FEL A;  2Y3E A;  4IB7 A;  4CPH B;  1B8E A;  1CBI A;  1LIF A;  3IFB A;  1DFV A;  4Y5D A;  3APU A;  4LQZ A;  5F7G A;  5IRA A;  3ZZV A;  5B29 A;  1I9H A;  2G5L A;  1GGL A;  1DF8 A;  1GX8 A;  4COT A;  5C0N A;  1ERB A;  1SWF A;  2JU7 A;  2X55 A;  1IKJ A;  1EW3 A;  4LZV A;  2WUT A;  3BSZ E;  4NNS A;  4AYH A;  1A57 A;  2M4L A;  3WXQ A;  1QFV A;  2RCT A;  3EW1 A;  3O19 A;  3RKG A;  3TF6 A;  1DZK A;  2AT0 X;  1RLB E;  2EU7 X;  1N4J A;  2FGS A;  2RQ0 A;  2XKL A;  4U8U O;  4YFR A;  3RY2 A;  5CHK A;  2C1Q A;  5FQ7 E;  5LJC A;  4QRL A;  1SWE A;  1GT1 A;  3FEK A;  2L67 A;  2RCQ A;  4EEJ A;  3X00 A;  2CBS A;  1YP6 A;  4Y0R A;  4YMY A;  5IO7 A;  4I9S A;  1GX9 A;  1MM9 A;  5HZ8 A;  2YMS A;  2RTO B;  4YBU A;  2AKQ A;  2G79 A;  2HMB A;  4A60 A;  1ICN A;  1HMR A;  1Y9L A;  3AEH A;  3HK1 A;  2Y3F A;  2KTD A;  2OF9 A;  5K06 A;  2BSZ A;  1SY0 A;  2E4J A;  3I17 A;  3ZW0 B;  1B0O A;  2OZQ A;  4ORS A;  4GNY A;  5BVT A;  5LJH A;  1OEJ A;  1SXX A;  1OPA A;  2ZAG A;  5L8O A;  3FR4 A;  4CPF A;  3VGW A;  2MF6 A;  4QQ1 A;  4IAW A;  3CQR A;  5KIC A;  3B2L A;  1PM1 X;  5HZQ A;  3HOL A;  2VDF A;  2BS5 A;  3SOT A;  3NPO A;  1SWQ A;  4QAE A;  3P6D A;  2Q39 A;  2VFC A;  1SXY A;  4BGF A;  4U8U M;  3RDM A;  2AT3 X;  1H91 A;  4CDC A;  4I3C A;  3RE5 A;  1WBI A;  4Z27 A;  4ODD A;  3P02 A;  3FA6 A;  2G8C O;  2IZA A;  5LJB A;  1AVE A;  3BS2 A;  1PBO A;  4XMF A;  1LIE A;  2IZB A;  4FBV A;  1VYO A;  1T8V A;  4GGZ A;  4O3X B;  2FHN X;  3H3I A;  4MVE A;  1JV4 A;  2A13 A;  1HQP A;  3CKF A;  4QZT A;  2OL6 O;  2WSJ A;  4ZHH A;  1SWR A;  4A1Y A;  1DZM A;  1LIC A;  1X8U A;  5JR8 A;  1E00 A;  1WUB A;  2IZG B;  4MVK A;  2PY1 A;  2G7B A;  4QGV A;  5IO5 A;  4CDF A;  2IZL B;  1L6M A;  1EAL A;  4TQ2 A;  1NGL A;  4KC8 A;  2AT6 X;  4O4S A;  5JD2 A;  4XMD A;  4B55 A;  2OVD A;  1SWL A;  4OMW A;  2LB6 A;  3KFF A;  3LHN A;  3VG3 A;  1VWE B;  3EMM A;  3VG5 A;  1BBP A;  1NQN A;  1SXU A;  4EDE A;  1VWD B;  5EZ2 A;  3SLJ A;  1ACD A;  1ML7 A;  1UZ2 X;  1Y55 X;  2X56 A;  1SLE B;  1SXW A;  2R74 A;  4NLI A;  2MWH A;  5B5G A;  3F9D A;  2A5C A;  2K62 A;  2OFB A;  1IIU A;  2OL8 O;  2AT5 X;  4O3W A;  4KT5 A;  1N43 A;  1VWQ B;  1IFB A;  2OVS A;  1MDC A;  2RTH B;  4QYP A;  1BEB A;  2LBV A;  1SLG B;  4MIS A;  2IZJ A;  5LKE A;  1GKA B;  1AB0 A;  2MO5 A;  3WJC A;  4I3D A;  4N7C A;  5B10 O;  2BLG A;  2ACP X;  1BRP A;  3NR3 A;  1SLF B;  4R0B A;  3B2I A;  4O4O A;  3ZW1 B;  4EKV A;  5L8I A;  2JU3 A;  4L3R A;  2PI3 O;  4AZN A;  1ZND A;  3APV A;  1DZJ A;  4WHI A;  2FWV A;  4EQA C;  1VWR B;  3EBW A;  4Y59 A;  2FKJ A;  5BVQ A;  1QY2 A;  2Z4H A;  4BX7 A;  3PP6 A;  1RXK A;  2OL7 A;  3FDC A;  1VWK B;  4BX5 B;  2CM9 A;  1P6P A;  1SWU A;  2GTL N;  3CWK A;  3NQ9 A;  3PED A;  3WYP A;  1RXJ A;  5AQ6 A;  1CRB A;  1QFT A;  2HZQ A;  1Y0G A;  2FRS A;  5H8T A;  3SZI A;  4GJS A;  4YGG A;  4NLJ A;  4ZHD A;  1FEM A;  2GC9 A;  2KD2 A;  3BX8 A;  2QOS C;  2WQA E;  4ORR A;  3BY0 A;  4ZGF A;  1KQX A;  4ORX A;  2HYS A;  1JJJ A;  2AF5 A;  1JQP A;  3C78 X;  3HWF A;  1SRG A;  4ORU A;  2CM4 A;  4M7M A;  2Q2P A;  1MX7 A;  3B2K A;  2DJG A;  4KC7 A;  1HXZ A;  3FEN A;  3ZUI A;  4Z28 A;  3KQ0 A;  1Y9T A;  2NNE A;  1JJX A;  1LFO A;  3BLG A;  1KT6 A;  1SWK A;  2ANS A;  2RTM A;  2X4M A;  5K67 A;  2IFB A;  1B4M A;  5F6B A;  1FEN A;  4YGZ A;  4GZV A;  1GT5 A;  4OEL A;  2YG2 A;  1SMP I;  3CBS A;  4GUZ A;  4OKA A;  2FS6 A;  1K24 A;  1I4U A;  1ZNG A;  2A8G A;  2GJ5 A;  2Q2M A;  3U0D A;  2WEX A;  1LCV A;  4XMH A;  1STS B;  2C4I A;  5CYB A;  1ERX A;  2X8S A;  1HBQ A;  1VWG B;  1JBH A;  1RBP A;  3S60 A;  3B2J A;  2NNQ A;  3WJF A;  1KT4 A;  1EIO A;  1JJU A;  1Y53 X;  1YWA A;  2DM5 A;  1NC9 A;  3C76 X;  3I0A A;  1TOW A;  1TOU A;  5LJG A;  1A18 A;  4GET A;  4EXZ A;  1N7Y A;  4ORY A;  1CBS A;  4Y0P A;  3HTY A;  3UEU A;  1ALB A;  4Z2O A;  1JMZ A;  4YBP A;  1FTP A;  5B5F A;  3P6F A;  3O2Y A;  1EPA A;  3KVN A;  2RTG B;  3OBL A;  1PBY A;  1U17 A;  2F09 A;  2X46 A;  3HWE A;  1IKE A;  1KL5 A;  1IFC A;  4DNE A;  3LV4 A;  3FEP A;  3LTW A;  4NV8 A;  1VWO B;  3B2H A;  1S44 A;  2KTS A;  1PMP A;  2QO6 A;  3PQS A;  2F01 A;  2JU8 A;  3BDR A;  3FW4 A;  4I3B A;  1QY1 A;  1YIV A;  1VWI B;  4IAX A;  4ZCB A;  2A2G A;  3IA8 A;  4FBO A;  4GNW A;  1MVG A;  3FR5 A;  4YKM A;  3UAQ A;  5H9L A;  1DZP A;  1FDQ A;  2AMM X;  1Z24 A;  4Y0S A;  5H9K A;  2OF8 A;  3BX7 A;  3N91 A;  2IZD B;  3HPE A;  3P6H A;  4ALO A;  1IJ8 A;  2OVE A;  1EUO A;  3GE2 A;  4ALB A;  2OY1 O;  2L5P A;  2Q4N A;  2OFR X;  4GD9 A;  1BRQ A;  2RTA A;  1HY2 A;  3NQK A;  4K19 A;  2GH7 A;  4TLJ A;  3P6E A;  3WZP A;  1CJ5 A;  3HOE A;  1URE A;  3RWX A;  2R73 A;  1LCZ A;  2UYW A;  5IRW A;  1X8P A;  3JS1 A;  2HKD A;  4ID2 A;  4M6S A;  3WBG A;  1SRF A;  2KT4 B;  3APX A;  5HWZ A;  1HN2 A;  3KZA A;  3VG7 A;  1EPB A;  1KT5 A;  1SWG A;  3L4R A;  3EM0 A;  2OY7 A;  1KGL A;  1NP1 A;  4KII A;  3S26 A;  1Y52 X;  2WEW A;  4XME A;  4UU2 A;  4I95 A;  2F73 A;  1NQM A;  1BSO A;  1STR B;  5F6Z A;  5HAE A;  2W2F A;  3EC5 A;  4LKT A;  5HCE C;  2W2B A;  3BRN A;  4TNN A;  4FQB B;  4DQ4 A;  2RTJ A;  4ZH9 A;  1MOY A;  2LFO A;  3P6G A;  1G7N A;  2QMI A;  3CBC A;  4NYQ A;  2X32 A;  3NQ3 A;  4NYR A;  3V8U A;  4YFP A;  1OEE A;  4NV7 A;  3SAO A;  1D2U A;  2AT8 X;  4CK4 A;  4Z2P A;  5HZ6 A;  2XST A;  2RTI B;  3VE1 A;  5AEO A;  1I06 A;  1GX3 A;  5LJE A;  1SWB A;  1VWN B;  1ZNL A;  1SLD B;  1MEP A;  4IRW A;  5D4A A;  1KFF A;  1X71 A;  1RAV A;  2W2A A;  2JGS A;  2CZT A;  2RTD B;  4QZU A;  2RTP B;  4IMO A;  1SWJ A;  5HA0 A;  1OBP A;  2AVI A;  4GDZ A;  4JO6 A;  1RXH A;  1B56 A;  4BVM A;  2MHD A;  4ORW A;  2NND A;  1KZW A;  3VHM A;  2IZK A;  4IB8 A;  2LKK A;  3MVF A;  2I5V O;  3D96 A;  4HPA A;  4AZO A;  3DTQ A;  4HPC A;  3STM X;  4I9R A;  3NAD A;  1SRI A;  2L68 A;  4PJ2 A;  3VU1 A;  1LID A;  1EQD A;  1W4T A;  1XKI A;  3Q34 A;  3RDU A;  1LF7 A;  3ELZ A;  1T68 X;  1LDQ A;  4HPB A;  1KT7 A;  4QNI A;  4CPE A;  5HA1 A;  5EPQ A;  3VG6 A;  3PPT A;  3G7X A;  1SWH A;  1X89 A;  1ZNK A;  2IZC B;  4GDA A;  4GU8 A;  1LDO A;  3ZW2 A;  4IMN A;  2JN3 A;  2Y32 A;  1NDJ A;  4D6A A;  5HTD A;  2QO5 A;  1PTS A;  4WFU A;  4XMC A;  1N0S A;  2RTF B;  4O4U A;  1HBP A;  3CKG A;  3KFI A;  2CAM A;  3DSZ A;  1BJ7 A;  4ES7 A;  4JHQ A;  3WZO A;  4GE1 A;  2A5B A;  3WJG A;  2ASN X;  3JQO A;  5B2A O;  1OSP O;  1VWH B;  2G78 A;  2GTF X;  4GGT A;  2QO4 A;  4YDB A;  4YKO A;  1FE3 A;  1LUQ A;  1SWP A;  3OJY C;  5D45 A;  3ZQ3 A;  4ZHG A;  1SRJ A;  1SY1 A;  3EYC A;  3U9P C;  1KZX A;  1OBU A;  4A1H A;  3CQN A;  3ZI8 A;  4BX6 A;  1I04 A;  1BSQ A;  3KFG A;  5D48 A;  1QY0 A;  2LA7 A;  3HWG A;  2IZF B;  4L1N A;  4MVI A;  4NW4 A;  4TJZ A;  5K68 A;  4CPH A;  2O62 A;  5CE4 A;  1BM5 A;  2FKG A;  4N7D A;  1EXS A;  2OYB O;  2OY5 O;  3SZJ A;  4Z6J A;  2X8F A;  2A3F X;  2IZH B;  3D95 A;  4BJ8 A;  5L8N A;  1QG5 A;  3F6Z B;  3PEC A;  4IB9 A;  3RDS A;  3UEW A;  1LNM A;  5AJC A;  4FBR A;  4FGI B;  3D4R A;  1U18 A;  4YH0 A;  3RSW A;  4O3Y A;  1X8O A;  3RDQ A;  1EI5 A;  1GM6 A;  3SLT A;  4AW8 A;  4ZHF A;  1O1U A;  4MEE A;  1GXA A;  4TKH A;  1VWJ B;  1CBR A;  4BX7 B;  2BHV A;  4GJV A;  1BSY A;  4HPD A;  4KH8 A;  1YWB A;  3AKM A;  1G74 A;  4GKC A;  4OMX A;  1GT3 A;  2JMB A;  2OFM X;  2MM3 A;  4OS0 A;  4RUN A;  1R0U A;  2FLJ A;  1NBX A;  1MX8 A;  3UEX A;  1KT3 A;  1BLR A;  4QYN A;  3TGC A;  4INN A;  1SRE A;  2X8T A;  3RDO A;  5CSE A;  3BU1 A;  1STP A;  3FLL A;  3WVM A;  5F1E A;  4Y0Q A;  5EEE A;  1SWT A;  3FEL A;  3ZW0 A;  1EII A;  1I05 A;  3CMP A;  3T2W A;  4AZR A;  1MUP A;  5EDC A;  1IW2 A;  1BWY A;  2JOZ A;  1E5P A;  2QOM A;  4KCA A;  3VHH A;  5FEN A;  4WFV A;  5L3Y A;  4HFO A;  1LIB A;  2RN4 A;  1KL4 A;  3P6C A;  4PSQ A;  1A2D A;  1ADL A;  1JYD A;  1SWD A;  2OFA A;  4GGR A;  4QGW A;  1VPR A;  3T1D A;  1O1V A;  2A2U A;  3NX1 A;  1SA8 A;  1VWA B;  2GTL O;  1K3B A;  4JNJ A;  5EED A;  5KHP A;  3TZS A;  2X45 A;  1S7D A;  3JSQ A;  3VE2 A;  1W6F A;  4BQU A;  4Z2V A;  1AVG I;  3K3L A;  4BBO A;  5FQ6 E;  2BS6 A;  4ON1 A;  4HWM A;  4U9C A;  3SLO A;  3VPJ E;  4O9S A;  2RTB B;  4OS8 A;  3WOV A;  3APW A;  4ZHC A;  3PH5 A;  1VWF B;  1DV9 A;  2WR6 A;  3FA9 A;  5LJD A;  4CDE A;  4YVB A;  1G85 A;  1E2T A;  2QCB A;  1PEE A;  5LJK A;  5B27 A;  4U46 A;  5HZ5 A;  5B11 O;  3E3C A;  1O8V A;  3Q6L A;  1KL3 A;  3VG4 A;  4UU3 A;  5AJB A;  1UYN X;  3MBT A;  1S2P A;  1KXO A;  2IZE B;  3HWD A;  4IBA A;  1G5W A;  5DPQ A;  2FHL A;  1QWD A;  2BC3 A;  3QQ2 A;  3EW2 A;  4O3Z A;  2ZSC A;  1SWA A;  3S5V A;  3WJB A;  4I60 A;  2GTL M;  2L9C A;  3PH6 A;  1VWC B;  4CPI A;  3KFH A;  1E02 A;  3PQU A;  4LZU A;  3U03 A;  5FAZ A;  5H9N A;  2NP1 A;  1LKE A;  2WWP A;  3ELX A;  4DQ3 A;  4MIR A;  2RA6 A;  4TKJ A;  1RSU B;  2FTB A;  3T6L A;  1SWN A;  1VYG A;  3O22 A;  2P8G A;  1XCA A;  1GKA A;  1OPB A;  4O4X A;  5HCD C;  1QQS A;  4LKP A;  3FR2 A;  1SY3 A;  2KW1 A;  2FR3 A;  4AZQ A;  1LEL A;  1X8N A;  3ZW1 A;  2JW1 A;  2X34 A;  2OY8 A;  4BOE A;  1AEL A;  3F8A A;  3NX2 A;  5F58 A;  5IO6 A;  1SRH A;  2FS7 A;  4A8Z A;  2QM9 A;  4TKB A;  4O49 A;  5LKF A;  4AZM A;  4D6B A;  4ZFX A;  3NBX X;  2HLV A;  2RTC B;  5B3M O;  2POA A;  1SWC A;  2UZ2 A;  1JZU A;  3T6F A;  1YP7 A;  4BX5 A;  1HMT A;  5FQ8 E;  3WJD A;  4WBK A;  3AUM O;  4YFQ A;  5D8J A;  4GRJ A;  2OVA A;  2RTN B;  5DG4 A;  3RDX A;  3TGB A;  3WZQ A;  3CR6 A;  1TXL A;  4QGX A;  4U3Q A;  3ZWE A;  1D3S A;  3D9W A;  4NNT A;  5D47 A;  1E06 A;  1VWB B;  4RUU A;  2N93 A;  1W5R A;  2DJF A;  1GT4 A;  3FIQ A;  1UYO X;  3OE3 A;  4I6S A;  4ARH A;  2MJI A;  2A0A A;  4YCH A;  3PDF A;  1ICM A;  2RD7 C;  1KQW A;  5IRU A;  3T2X A;  4AZP A;  5KID A;  2RTE B;  1ZNH A;  3MG5 A;  2AH7 X;  2R56 A;  2FR2 A;  1TW4 A;  1JYJ A;  2AL0 X;  2ALL X;  4OEM A;  2IZI A;  1CBQ A;  3FYF A; 
#chains in the Genus database with same CATH homology
 4NP1 A;  4ZR2 A;  3RBY A;  1DC9 A;  2K23 A;  4U8U N;  5HBS A;  4YCE A;  3UEV A;  2FT9 A;  3MX7 A;  1AQB A;  3P24 A;  4ML7 B;  4AW8 A;  4OS3 A;  5BVS A;  3AKN A;  1T0V A;  3D97 A;  3FW5 A;  4YGH A;  5BYP A;  1JIW I;  2BT9 A;  5HCC C;  4IB6 A;  3TGA A;  3STK A;  3QKG A;  1NP4 A;  2Z4I A;  1X8Q A;  3FMZ A;  2HZR A;  3S5X A;  4MVL A;  1YWC A;  3OD9 A;  4CV7 A;  2ACO A;  4XMG A;  4ZJ0 A;  4CSB A;  4ZGU A;  2LBA A;  1DF3 A;  1QAB E;  1HMS A;  1TVQ A;  1U0X A;  3BU9 A;  1OEK A;  4JGL A;  2ZAI A;  3EBK A;  5FFH A;  3WJE A;  2HNX A;  3NP1 A;  1SY2 A;  4GH7 A;  1YUP A;  5HTE A;  1A3Y A;  3FA8 A;  3GAQ A;  2Q9S A;  1OBQ A;  3C77 X;  1YWD A;  2CBR A;  4YDA A;  2WQ9 A;  1VYF A;  3STN A;  1ZRY A;  5HZ9 A;  4ZH6 A;  4IAB A;  1KOI A;  3RZY A;  4EFG A;  4GK9 A;  5EDB A;  3VG2 A;  3FA7 A;  3ZUO A;  2CZU A;  1LPJ A;  1ZNE A;  1FEL A;  4IB7 A;  1B8E A;  1CBI A;  1LIF A;  3IFB A;  1DFV A;  5F7G A;  3APU A;  4LQZ A;  3ZZV A;  5B29 A;  1GGL A;  1GX8 A;  5C0N A;  4COT A;  1ERB A;  2JU7 A;  4NNS A;  1IKJ A;  1EW3 A;  4LZV A;  2WUT A;  3BSZ E;  4AYH A;  1A57 A;  2M4L A;  3WXQ A;  1QFV A;  2RCT A;  3O19 A;  3RKG A;  3TF6 A;  1DZK A;  2AT0 X;  1RLB E;  2EU7 X;  4U8U O;  2XKL A;  2RQ0 A;  4YFR A;  5FQ7 E;  5LJC A;  4QRL A;  1GT1 A;  3FEK A;  2L67 A;  2RCQ A;  4EEJ A;  2CBS A;  1YP6 A;  4Y0R A;  4YMY A;  5IO7 A;  4I9S A;  1GX9 A;  5HZ8 A;  2YMS A;  4YBU A;  2AKQ A;  2G79 A;  2HMB A;  4A60 A;  1ICN A;  1HMR A;  1Y9L A;  3HK1 A;  2KTD A;  5K06 A;  1SY0 A;  2E4J A;  3I17 A;  3ZW0 B;  1B0O A;  2OZQ A;  4ORS A;  4GNY A;  5BVT A;  1OEJ A;  1SXX A;  1OPA A;  2ZAG A;  5L8O A;  3FR4 A;  4QQ1 A;  4IAW A;  3CQR A;  5KIC A;  3B2L A;  1PM1 X;  5HZQ A;  3HOL A;  2BS5 A;  3SOT A;  3NPO A;  4QAE A;  3P6D A;  2Q39 A;  1SXY A;  4U8U M;  2AT3 X;  1H91 A;  4I3C A;  4ODD A;  3P02 A;  3FA6 A;  5LJB A;  3BS2 A;  1PBO A;  4XMF A;  1LIE A;  4O3X B;  4FBV A;  1T8V A;  3H3I A;  4MVE A;  1JV4 A;  2A13 A;  1HQP A;  4QZT A;  2WSJ A;  4ZHH A;  4A1Y A;  1DZM A;  1LIC A;  1X8U A;  5JR8 A;  1E00 A;  4MVK A;  2PY1 A;  2G7B A;  4QGV A;  5IO5 A;  1L6M A;  1EAL A;  4TQ2 A;  1NGL A;  4KC8 A;  2AT6 X;  4O4S A;  3U0D A;  4XMD A;  2OVD A;  3VG5 A;  4OMW A;  2LB6 A;  3KFF A;  3LHN A;  3VG3 A;  3EMM A;  1BBP A;  1SXU A;  4EDE A;  5EZ2 A;  1ACD A;  1ML7 A;  1UZ2 X;  1SXW A;  2R74 A;  4NLI A;  2MWH A;  3F9D A;  2K62 A;  1IIU A;  2AT5 X;  4O3W A;  4KT5 A;  1IFB A;  2OVS A;  1MDC A;  4QYP A;  1BEB A;  2LBV A;  4MIS A;  5LKE A;  1GKA B;  1AB0 A;  2MO5 A;  3WJC A;  4I3D A;  4N7C A;  2BLG A;  2ACP X;  1BRP A;  3NR3 A;  4R0B A;  3B2I A;  4O4O A;  3ZW1 B;  5L8I A;  2JU3 A;  4L3R A;  4AZN A;  1ZND A;  3APV A;  1DZJ A;  4WHI A;  2FWV A;  4EQA C;  3EBW A;  5BVQ A;  1QY2 A;  2Z4H A;  3PP6 A;  2CM9 A;  1P6P A;  2GTL N;  3CWK A;  3NQ9 A;  3PED A;  5AQ6 A;  1CRB A;  1QFT A;  2HZQ A;  2FRS A;  5H8T A;  4YGG A;  4NLJ A;  4ZHD A;  1FEM A;  2GC9 A;  2KD2 A;  3BX8 A;  2QOS C;  2WQA E;  4ORR A;  3BY0 A;  4ZGF A;  1KQX A;  4ORX A;  2HYS A;  1JJJ A;  3C78 X;  3HWF A;  4ORU A;  2CM4 A;  4M7M A;  2Q2P A;  1MX7 A;  3B2K A;  4KC7 A;  3ZUI A;  3FEN A;  3KQ0 A;  1Y9T A;  2NNE A;  1JJX A;  1LFO A;  3BLG A;  1KT6 A;  2ANS A;  1B4M A;  2IFB A;  5F6B A;  1FEN A;  4YGZ A;  4GZV A;  1GT5 A;  2YG2 A;  1SMP I;  3CBS A;  2FS6 A;  1I4U A;  1ZNG A;  2GJ5 A;  2Q2M A;  2WEX A;  4XMH A;  5CYB A;  1ERX A;  2X8S A;  1HBQ A;  1JBH A;  1RBP A;  3S60 A;  3B2J A;  2NNQ A;  3WJF A;  1KT4 A;  1EIO A;  1YWA A;  2DM5 A;  3I0A A;  3C76 X;  5LJG A;  1TOW A;  1TOU A;  1A18 A;  4GET A;  4EXZ A;  4ORY A;  1CBS A;  4Y0P A;  3HTY A;  3UEU A;  1ALB A;  4YBP A;  1FTP A;  3P6F A;  3O2Y A;  1EPA A;  3OBL A;  1U17 A;  2F09 A;  2X46 A;  3HWE A;  1IKE A;  1IFC A;  3LV4 A;  3FEP A;  3B2H A;  1S44 A;  2KTS A;  1PMP A;  2QO6 A;  3PQS A;  2JU8 A;  3BDR A;  3FW4 A;  4I3B A;  1QY1 A;  1YIV A;  4IAX A;  4ZCB A;  2A2G A;  3IA8 A;  4FBO A;  4GNW A;  1MVG A;  3FR5 A;  4YKM A;  3UAQ A;  5H9L A;  1DZP A;  1FDQ A;  2AMM X;  1Z24 A;  4Y0S A;  5H9K A;  4ALO A;  3BX7 A;  3N91 A;  3P6H A;  2OVE A;  3GE2 A;  1EUO A;  4ALB A;  2L5P A;  2Q4N A;  2OFR X;  1BRQ A;  3NQK A;  4K19 A;  4TLJ A;  3P6E A;  1CJ5 A;  3HOE A;  1URE A;  3RWX A;  2R73 A;  1X8P A;  3JS1 A;  4ID2 A;  4M6S A;  3WBG A;  2KT4 B;  3APX A;  5HWZ A;  1HN2 A;  3KZA A;  3VG7 A;  1EPB A;  1KT5 A;  3L4R A;  3EM0 A;  1KGL A;  1NP1 A;  4KII A;  3S26 A;  2WEW A;  4XME A;  4UU2 A;  4I95 A;  2F73 A;  5F6Z A;  1BSO A;  5HAE A;  2W2F A;  5HCE C;  4LKT A;  2W2B A;  3BRN A;  4TNN A;  4FQB B;  4DQ4 A;  4ZH9 A;  2LFO A;  3P6G A;  1G7N A;  2QMI A;  3CBC A;  4NYQ A;  3NQ3 A;  4NYR A;  3V8U A;  4YFP A;  1OEE A;  3SAO A;  5HZ6 A;  1D2U A;  2AT8 X;  4CK4 A;  5LJH A;  2XST A;  3VE1 A;  5AEO A;  1I06 A;  5LJE A;  1ZNL A;  5D4A A;  1X71 A;  2W2A A;  2CZT A;  4QZU A;  4IMO A;  5HA0 A;  1OBP A;  4GDZ A;  1B56 A;  4BVM A;  2MHD A;  4ORW A;  2NND A;  1KZW A;  4IB8 A;  2LKK A;  3MVF A;  4HPA A;  3D96 A;  4AZO A;  3DTQ A;  4HPC A;  3STM X;  4I9R A;  3NAD A;  2L68 A;  4PJ2 A;  3VU1 A;  1LID A;  1EQD A;  1XKI A;  1LF7 A;  3ELZ A;  1T68 X;  4HPB A;  1KT7 A;  4QNI A;  5HA1 A;  5EPQ A;  3VG6 A;  3PPT A;  3G7X A;  1X89 A;  1ZNK A;  4GU8 A;  3ZW2 A;  4IMN A;  2JN3 A;  4D6A A;  5HTD A;  2QO5 A;  4WFU A;  4XMC A;  1N0S A;  4O4U A;  1HBP A;  3KFI A;  3DSZ A;  1BJ7 A;  4ES7 A;  4GE1 A;  3WJG A;  2ASN X;  3JQO A;  2G78 A;  2GTF X;  4YDB A;  2QO4 A;  4YKO A;  5H9A A;  1FE3 A;  3OJY C;  5D45 A;  3ZQ3 A;  4ZHG A;  1SY1 A;  3EYC A;  3U9P C;  1KZX A;  1OBU A;  4A1H A;  3CQN A;  3ZI8 A;  1I04 A;  1BSQ A;  3KFG A;  5D48 A;  1QY0 A;  2LA7 A;  3HWG A;  4NW4 A;  4L1N A;  4MVI A;  4TJZ A;  5CE4 A;  2O62 A;  1BM5 A;  4N7D A;  1EXS A;  2X8F A;  2A3F X;  3D95 A;  5L8N A;  1QG5 A;  3F6Z B;  3PEC A;  4IB9 A;  3UEW A;  1LNM A;  5AJC A;  4FBR A;  4FGI B;  3D4R A;  1U18 A;  4YH0 A;  3RSW A;  4O3Y A;  1X8O A;  4ZHF A;  1EI5 A;  1GM6 A;  1O1U A;  1GXA A;  4TKH A;  1CBR A;  2BHV A;  4HPD A;  1BSY A;  4KH8 A;  1YWB A;  3AKM A;  1G74 A;  4GKC A;  4OMX A;  1GT3 A;  2JMB A;  2OFM X;  2MM3 A;  4OS0 A;  4RUN A;  1R0U A;  2FLJ A;  3UEX A;  1MX8 A;  1BLR A;  1KT3 A;  4QYN A;  3TGC A;  4INN A;  2X8T A;  3BU1 A;  3FLL A;  3WVM A;  5F1E A;  4Y0Q A;  5EEE A;  3ZW0 A;  3FEL A;  1EII A;  1I05 A;  3CMP A;  4AZR A;  1MUP A;  5EDC A;  1IW2 A;  1BWY A;  2JOZ A;  1E5P A;  4KCA A;  5FEN A;  4WFV A;  4HFO A;  1LIB A;  2RN4 A;  4PSQ A;  3P6C A;  1A2D A;  1ADL A;  1JYD A;  4QGW A;  1VPR A;  3T1D A;  1O1V A;  2A2U A;  3NX1 A;  1SA8 A;  2GTL O;  5EED A;  5KHP A;  3TZS A;  2X45 A;  1S7D A;  3JSQ A;  3VE2 A;  4BQU A;  1AVG I;  3K3L A;  5FQ6 E;  2BS6 A;  4ON1 A;  4HWM A;  4U9C A;  3VPJ E;  4O9S A;  4OS8 A;  3WOV A;  3APW A;  4ZHC A;  3PH5 A;  1DV9 A;  2WR6 A;  3FA9 A;  5LJD A;  1G85 A;  1PEE A;  5LJK A;  5B27 A;  5HZ5 A;  3E3C A;  1O8V A;  3Q6L A;  3VG4 A;  4UU3 A;  5AJB A;  3MBT A;  1S2P A;  1KXO A;  3HWD A;  4IBA A;  1G5W A;  5DPQ A;  1QWD A;  4O3Z A;  3WJB A;  3S5V A;  2GTL M;  2L9C A;  3PH6 A;  3KFH A;  1E02 A;  3PQU A;  4LZU A;  3U03 A;  5FAZ A;  5H9N A;  2NP1 A;  1LKE A;  2WWP A;  3ELX A;  4DQ3 A;  4MIR A;  2RA6 A;  4TKJ A;  2FTB A;  1VYG A;  3O22 A;  2P8G A;  1XCA A;  1GKA A;  1OPB A;  4O4X A;  5HCD C;  1QQS A;  4LKP A;  3FR2 A;  1SY3 A;  2KW1 A;  2FR3 A;  4AZQ A;  1X8N A;  3ZW1 A;  2JW1 A;  4BOE A;  1AEL A;  3F8A A;  3NX2 A;  5F58 A;  5IO6 A;  2FS7 A;  4A8Z A;  2QM9 A;  4TKB A;  4O49 A;  5LKF A;  4AZM A;  4D6B A;  4ZFX A;  3NBX X;  2HLV A;  2POA A;  1JZU A;  1YP7 A;  1HMT A;  5FQ8 E;  3WJD A;  4WBK A;  4YFQ A;  5D8J A;  4GRJ A;  2OVA A;  5DG4 A;  3TGB A;  3CR6 A;  1TXL A;  4QGX A;  4U3Q A;  3ZWE A;  1D3S A;  4NNT A;  5D47 A;  1E06 A;  4RUU A;  2N93 A;  1GT4 A;  3FIQ A;  3OE3 A;  4I6S A;  4ARH A;  2MJI A;  2A0A A;  4YCH A;  1ICM A;  2RD7 C;  1KQW A;  4AZP A;  5KID A;  1ZNH A;  2AH7 X;  2R56 A;  2FR2 A;  1TW4 A;  1JYJ A;  2AL0 X;  2ALL X;  1CBQ A;  3FYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...