2LFSA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer; a219f variant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
b'STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
total genus 42
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfsA00
4JYCA 4QPJA 4JAVA 3ZRVA 5B1OA 4U7NA 3P32A 4JASA 3NXSA 2FTKA 4BIZA 4FMTA 3ZRXA 4U7OA 3D36A 4JAUA 4MTXA 5B1NA 2LFSA 3ZRWB 3MD0A 5IDJA 4KP4A 4BIUA 3A0RA 4LC1A 4JYBA 3DGEA 4QPKA 4GCZA 4ZKIA 4FPPA 3TK1A 2P67A 4GT1A 3ZCCA 2QM7A 4MT8A 2WWWA 5C93A 2LFRA 2QM8A 3ZRWA 2C2AA 1JOYA 1F51A 1IXMA 4I5SA 4Q20A
chains in the Genus database with same CATH superfamily
5LYJA 5LHGA 4MVZA 3BAAA 4KXRA 4LWSA 5LP6C 4H44B 1HWYA 3L70H 4YJ3A 4I50A 1EM1A 4CH6A 1M93A 1J95A 5BXZA 2FL4A 4E4EA 1S5HC 5J2TA 2NN4A 2WWWA 5HFLA 4D7TA 3JALA 4UFZA 1KECA 5KUKA 2UUBB 3RYFA 1OCZB 3OMIB 4DV7O 2PGGA 1AVMA 3W7WA 1Q6IA 1I08A 3RBZA 4PA4A 3E2EA 3CS5A 2F4VB 2N04A 1Q86W 2EILB 3IC7A 1SQPH 1NS1A 4TUYB 4ZOLB 1H8HG 3E22B 4DR4B 3L73H 1OJHA 5TISZ 2IU3A 2IBZH 5C8YB 1WAZA 4R6ZA 4JYBA 4LF6B 1NTZH 4GKJO 3C3SA 4L87A 3KKYA 1X4TA 4O4HB 1NTMH 4UUJC 1XBLA 5CB4B 1XL6A 2ODMA 3LDEA 1L1FA 1GO3F 1SQGA 2EILC 3JCZA 2YUAA 2QWRB 1GM8A 3LSSA 4DV6O 4X1KB 3UKMA 4LH6A 4OGQB 2XASA 1YF2A 3B8MA 5LOVB 3BCCH 1DK1A 3CWBH 1RM1C 4LBEC 1IBKB 2FB5A 2YIDA 3P30A 3JATA 2IW5A 3W7SA 1I7FA 3GWKC 4WF9V 5LGTA 4NXNO 1IBMB 1YIJV 5CA0B 4FLTA 1YITV 5JWPA 2DWEC 1KQSU 1JOYA 3F5TA 4O4JA 1O9HA 3WB1A 4Q20A 3HKDB 3JASA 2ZIMA 4DV7B 3ZS8C 1HP8A 1RFYA 3FAVA 3ABMB 2WLLA 1SKVA 4FFKA 5K1XA 4GYCB 4HNAA 2WPDG 4GT1A 3SJQC 1ZAUA 1H2GA 3K9SA 5DECA 3LNNA 4D7SA 2VRZA 1IXMA 2X0LA 1AI4A 4X1IA 1GN6A 1NT2B 1K4DC 2LP7A 2FKXA 4YHHO 1GM9A 1O9GA 4K3AA 4DV0O 1MSWD 4WFAV 3AG4B 4GKJB 5BR8O 4OX9O 1N32O 2UXDO 3WG7B 5JCOA 4I9WA 1P4RA 1BL8A 1OCRB 3MD0A 3R66A 2DN9A 2DYSB 3MDSA 2JVDA 2XHBA 3B40A 2A0LA 2QSAA 4DV6B 1PP9H 3NR7A 1VQ8V 3GVMA 2X6CA 4F6RB 2BOCC 4TV9B 1TUEB 2OCCB 3THOA 4IIJA 1ZTEA 3ZN1A 2W0FC 4GLXA 3QG5A 2EIKB 4MW8A 4LFBO 4DK1A 1KD1W 5CMUA 1AI7A 3EVKA 3K04A 4MS2A 4NXNB 1XREA 2GDSA 2QTSA 3SJAC 5LYJB 3SPJA 3I56V 2DQ0A 4IYHA 4I50B 4K0KO 4UB6Z 2HG5C 1OHHG 4K8ZA 3H1IH 2ZM6O 3FYEB 3IC9A 1NJIW 3JALB 3JAWB 2HVJC 1BQ0A 3WU2Z 1K5SA 4FLYA 3H1KH 5JQGA 3CC7V 2XUMA 2HFEC 2ADPA 1I94O 1EZVH 1LR1A 2EZOA 3E8HA 2JS5A 2EIKC 3CCQV 3WFVA 2ZNJA 1QLNA 1PNMA 2D3OW 2P4VA 4UCRA 1AR5A 1VQ4V 1ZLZA 2JEXA 1QU7A 4PA7A 5B1OA 4ZI7B 4J10A 1DLBA 1FXKA 2IJIA 5LGNA 4YHHB 1H2MA 1KYOF 4LC1A 4JI4O 1SQBH 1VF6A 4DV0B 1A32A 2EIMB 2BCCH 1YZBA 1IXBA 1M56C 3RGBA 4GX2A 3TJTA 1PM9A 2DQ3A 2P22C 2QE7G 5L3DA 3TETA 1AJNA 4OX9B 1N32B 2ZXWB 2UXDB 1K92A 5GONB 2LW1A 1FJGO 1YJWV 3ZMSA 3ZHTA 4FJCC 2P67A 4E2LA 4XBFA 5KHKA 3QF7A 4J80A 4H37A 2ZKOA 2YIBD 3CCLV 5LGUA 1Q6HA 3SYOA 3RYCB 1B6QA 4LFBB 2EIMC 4JI1B 1LUVA 3BFRA 5A2QN 1G1XB 5LA6B 1N34O 1MSDA 2ITCC 3ASNB 3F7VC 3J7AU 2ZXWC 3JATB 4NB5A 4DV3O 4DR1O 3B8NA 4I55B 1RPRA 2BTOA 1AB3A 4BWAA 4K0KB 2P4KA 4NTWA 4ZHQA 1UPGA 4DR7O 1COWG 2W6JG 2ZM6B 1QLEC 3HKBA 1XILA 3ZN0A 1IURA 1HR0O 1VQ6V 2RN9A 1NBMG 5CA1A 3AG1B 4O4JB 2OYQA 4LNUA 2A3QA 1VIBA 1I94B 3QNEA 1ROPA 3JASB 5H9CA 3RWRD 4CBCA 3K5NA 3HKEB 3FD9A 3AG3B 5FNVA 4PD4F 2WLLB 5B3SC 4HNAB 2EJRA 4WFEA 4LF9O 3N2KA 1S72V 1TUBA 1P7BA 1K34A 1YI2V 1BGYH 1H2SB 2ILMA 3SJCC 2QR4A 3OUFA 5LMNO 4X1IB 5LMUO 1FFXA 1DGSA 2CTPA 2WLIA 1K4CC 4UV8A 3RVYA 1EZJA 3AG1C 2ETNA 1VARA 1WJZA 2CTQA 1M1KW 5LL6Y 3PJSK 3WB2A 4FPPA 5CBGA 1EN4A 4PA6A 4MW3A 2PI4A 2Q68A 4OPHA 3TXQA 1S0VA 3SYPA 3KCXA 1SETA 1SRYA 2P5OA 3RN4A 4DW1A 1WP7A 1N34B 2AW9A 1H2LA 2ZE6A 4I0XB 4DV3B 4DR1B 3ABTA 1H38A 4EFBA 2GUZA 5B1AC 1BHAA 4X1YB 4ASUG 1YTFB 5EIBC 2P06A 1DF5A 4FM1A 5FPRA 5JCOC 4DR7B 3UM7A 3IGAC 3C90A 1HR0B 1NVPB 4FM0A 2RMKB 3U10A 1EN6A 4HBNA 3ZCCA 1QQCA 3OEHG 1HDJA 4Z2WA 1QVFU 1G6UA 1D5AA 5EBMC 3WB0A 3ZEDA 5KHIA 1V9PA 3SPHA 3VQXA 5CA3A 1FAFA 1NVPD 4L8JA 2CDYA 5JQGB 1B04A 4JI7O 3E89A 2XAGA 4BIOA 4LF9B 2JGUA 2A79B 2F4VO 2HHHO 2WLNA 1IBLO 2QWQB 3JCUZ 4B3TO 1WN7A 5LMUB 1FXKB 2QWPB 3LDDA 2HP8A 3CCRV 1EFRG 4DR4O 1QR9A 1ZUQA 4CH3A 1R6KA 4GUNA 3DC5A 4JZGA 1YJ9V 2QKCA 1QBZA 4HAMA 4AILC 1PD3A 4P30A 4Q6GA 5D5PA 1Q7YW 4UV9A 3TCUA 1SS3A 4RO2A 3ZIAG 1BE3H 3CHXA 1WPXA 4TQDA 1YJNV 2JK5C 1FXKC 4JPRA 4DR6O 4U3FH 4X62O 1R3LC 1AP6A 1VF6C 3T2MA 3U11A 2QWNB 3BABA 1HNZO 3FX7A 2E3CA 2YDEA 2Y69B 2Y0IA 5J2UA 3T4ZA 2EIJC 2F93B 2X6AA 5EC1C 3FB8C 1IBMO 1P7GA 4EKWA 1F4NA 4QIWF 4J11A 2UUCO 3A2FA 5E1AC 2CGNA 3ZRWA 4ZHQB 1GRJA 1OCOC 1S3JA 3LSQA 3HKBB 4LF5O 3ICXA 1V55C 5CA1B 1Q3EA 1YDXA 1Y74B 3UO3A 1XEQA 3ABLC 2QJ1A 4JI7B 1R73A 1AROP 2VQEO 1NU1H 4J42A 2EINC 5FNVB 4LP8A 2Y69C 2HHHB 2P7TC 1IBLB 3CCSV 4O2BA 2YI9A 1PNLA 4I4TA 4B3TB 3CCMV 3BHPA 1Q81W 5KAFZ 3STZC 2PYJA 3G4SV 3APQA 3RYHA 3AK2A 3HPLC 3CXCU 4H13B 1RM1B 3CCEV 1FFXB 2Q69A 1TGOA 1U96A 2WLIB 3SJBC 5JH7B 2ATKC 4U3JB 5FLXN 3OFNG 3JAKA 5KX5B 1SQQH 3J81N 4PDMA 2Q7HA 1WB7A 2KG7B 3F7YC 4JF3A 4XDLA 3L72H 2GTAA 3ZRSA 2BSKA 3N2GA 2WAMA 1P84F 4MVSA 4LF8O 1NTKH 4O2AA 4FK5C 2QM4A 5KMGB 5IJ0A 5LHIA 3ZHRA 4DR6B 1MA1A 2ZIOA 1N8RW 2YS8A 4MT8A 1F23A 4X62B 3BVOA 4PA3A 2GV9A 2Q4PA 3CMEV 1AI5A 5EBLC 2BOBC 1HNZB 2UXCO 1WLEA 4XDJA 2JDIG 4IGGA 3DSQA 5JJNB 5IE9A 3D36A 3HKCA 2VQFO 4UXNA 2QEXV 3TGUH 1US6A 4AQYO 3AEIA 5LXTA 2XAQA 1XNRO 2GUZB 1B06A 3DXRA 2UUAO 2VWKA 2WLKA 3LDCA 3QO7A 2UUCB 1W0KG 4MTOA 2QKSA 3G6EV 2ITDC 5KAIZ 4XDKA 2H3OA 4LF5B 2Q8VA 3JARA 4QE9A 2GHYA 2LFSA 4NTYA 4MVQA 2WA4A 2Q67A 3LNMB 1XI1A 1QVGU 5B1BB 4EEQA 4RAIA 2VQEB 3B4SA 2JS3A 1AR4A 1L8DA 4UCUA 4IL6Z 1OV9A 2CTWA 3JAMN 3L9DA 4PA9A 1D2DA 3F5WC 1U97A 1SA0B 4DV1B 3B2EE 3GWOA 4UCSA 2Q7EA 3UQ8A 1GM7A 2BTQA 4HYOA 5B5EZ 1N0JA 4P9OA 4DR2O 2IH3C 1UJWB 1HW7A 5DEDA 1MNGA 3BRCA 5EK0A 1RSOA 4JI6O 3Q4HA 4GX1A 2Y0PA 5IYZA 1BSMA 2Q0AA 4BW9A 5B1BC 3CMAV 4P9PA 1TVKA 1VF7A 5KHJA 3LUTB 3TXSA 4JI2O 4LF8B 4JI3B 4MSWC 1FXVA 3ASOB 4OXSA 1WA8B 3M7MX 1SQXH 2B1GA 1K33A 3G71V 3B09A 3G80A 3OW2U 5JJEB 1WNSA 4JYCA 3JD1A 5EC2C 1LUWA 4JI1O 2UXCB 4QJFB 1NZ6A 3K08A 3CP1A 3K0GA 2OCHA 4X89A 2VQFB 2H8PC 3M99B 5EZYB 1ZSPA 4GCZA 4AQYB 4WFBV 1XUQA 4DUYO 1XNRB 3SDLA 1IX9A 2UUAB 4DW0A 5J2UB 2RQ6A 4LWSB 3ABUA 2NLJC 1GN2A 3W7UA 4YJ3B 4PELA 1PL4A 3ASOC 4NR1A 4YJ2A 5J2TB 1M56B 3ZRWB 3SYQA 3CC4V 2Z0AA 3KG2A 3RYFB 2JGDA 1M90W 1PV0A 2O57A 1QHTA 2LW7A 4WCEV 1GN4A 1Y66A 4H33A 1BS3A 1SQVH 3ETQA 3VQVA 1AR1B 4JTDB 3BA8A 4WFGA 3CJHA 1Q82W 4I4TB 4ZIBA 1MG1A 3JSLA 4JV5O 1ENVA 3FB5C 4IHJA 4DR2B 1Q8IA 1N33O 3BPZA 5C93A 4Z1VA 1YXBA 3OT7A 4KL1A 2AZ0A 5IY5B 3OTFA 1P49A 4JI6B 1JFFA 2LGWA 2CGOA 1VQPV 1W2BU 2EULA 1GN3A 1YVWA 2Y48A 3T1HB 2PI5A 4RQFA 3JAKB 4DUZO 4EB6A 2B1IA 2YXHA 3OGIB 4J7JA 2PZSA 4JI2B 4RQEA 1PKXA 2BSKB 1QLEB 3N2GB 5CN0A 2R9AA 1N0NA 3ZX6A 2UXBO 1I0HA 3E8BA 3OMAB 2QDOA 3ABKC 4JASA 2CK3G 1BZKA 1M9NA 4FLVA 2E75B 2OIGA 2JEUA 1ZL8A 3RYIA 5JVDA 2DOSA 2X6BA 5IY5C 3O9OA 4JZ2A 4QPKA 5CBFA 4ZKIA 1KP2A 3FFQA 5B3SB 1ZWIC 2YICA 2ZR3A 3VQWA 1THZA 4DUYB 1VQMV 1F7YA 1PPJH 3HKCB 3AG2B 4UCTA 2M7WA 5GTIZ 5LXTB 5EBWC 2K9PA 2CUGA 1NH2B 2YIAA 1CPYA 3E8GA 3K58A 3K79A 4KP4A 3A0RA 3UCSC 3G6BA 2AHZA 3K9AA 3ZHSA 1S76D 2LO1A 1GMGA 1JQ0A 2FYUH 1NH2D 1R3KC 5KLVH 4DYLA 4W4LA 1I5XA 2DJVA 2AZ2A 5IWAO 3FAVB 3FB7C 1DF4A 5IYCO 4GX0A 3IJ4A 4YIPA 4YXWG 1S5JA 1R1BA 3D36C 3AG2C 2DW4A 4JV5B 2QKAA 2XOKG 5FL7G 1N33B 5BY1A 4X65B 2Q73A 1V54B 4I9QA 1KBHA 1I5YA 4H0LB 4X8AA 4FLWA 2QTOA 3H1JH 2PUSA 1EN5A 1CXZB 3KZIZ 1KMIZ 1GTOA 4TUYA 4KUMA 4K35A 4NVPA 4FMTA 4ZOLA 3UO2A 1VP7A 1J5EO 3CX5F 5B1NA 3Q4HB 2Q7GA 5IYZB 3MHSC 5B1AB 2B9ZA 4DUZB 3P3PA 3MAQA 1TVKB 4R7CA 2H94A 2EZPA 5IYDO 2UXBB 4O4HA 4CS4A 1NKDA 5EIBD 4R8CA 1Z5WA 5CB4A 3ZMTA 1V54C 4PHZA 4CC6A 3SYAA 1ORQC 2ZCEA 1AP5A 3L71H 1RPOA 3HB3B 4IIJB 1NQTA 3CRMA 3SPCA 4TQFA 4X1KA 3CE2A 4CZZA 3ETEA 5BMVA 3FYIB 1G4YB 1FS0G 3O65A 1Y76A 5J9PC 1JVMA 1Q5OA 4MVRA 4Z1MG 4B08A 2ZE7A 1L0NH 1S5LZ 1BT8A 1LNQA 5IJ9A 2W0XA 4UVBA 5L3EA 1YTFD 4J9ZB 5KHHA 2WLHA 2YI8A 4YJ2B 4J7ZA 2ZR2A 2ZE8A 5CA0A 5IT9N 3P3NA 1YSCA 5IWAB 2JGDB 1BQZA 3LSUA 2Z3YA 2DYRB 1TAEA 1FD9A 5H6QA 3E35A 2QM8A 1GKFA 1PNKA 5L3BA 1G8MA 4PI2A 1VQOV 1XNQO 3T1CA 3CEIA 2PY5A 4R50A 2RCVA 1J5EB 4DR3O 1JFFB 3D3QA 4JI5O 3TK1A 2ZDIA 4LF7O 5L3CA 2EIJB 1IVSA 1KUQA 1N4CA 2KQXA 1JA8A 2EJ7A 2DYRC 1VMGA 1BCCH 3AG7A 4B7KA 4P2ZA 2XAJA 3NXSA 4DRXA 2Q9LA 1D5NA 1JMKC 1OCOB 4WBNA 1KU9A 4QGPA 1BMFG 1Q43A 4O4IA 1V55B 4F6EA 3OM3B 3ABLB 3K5OA 2LQTA 2NNUA 4JI0O 2MK3A 2CH7A 3RYIB 5JVDB 2EINB 3AK1A 4PI0A 4K8XA 5IYBO 4NXMO 3A0BZ 3CSXA 2IJJA 3K0DA 2LJ2A 3ZMUA 2E74B 4CC5A 3CRQA 1K8AW 2ADQB 3SGIA 5LBQA 3M8AA 4TWKA 2AGAA 1YHQV 1R6NA 3K5MA 2OTLV 2L35A 1T5EA 1XHZA 3CC2V 3IFXA 3S3XA 4QPJA 4DV2O 3QTCA 2ZINA 4U7NA 4X64O 4LNUB 4U7OA 1L0LH 1R3IC 3OAAG 5IDJA 2G38A 4X20A 2XTAA 4AHCA 2XT9A 3JAWA 4X66O 4ABMA 4DV4O 5H5NA 3K3WA 4DXWA 4JTAB 3N2KB 4DV1O 1SESA 2IU0A 1TUBB 3SR2C 2V1DA 2M6YA 1VQKV 2FTKA 4RWUA 4MTXA 2YC0A 3QO8A 1XNQB 1KB9F 1IDSA 4PDVA 4ZI7A 1Z2GA 4DR3B 3HR0A 4JI5B 4QNHB 3OD4A 1W0JG 4LF7B 3VBBA 5K1PA 4UCVA 3EFFK 1WPBA 3CCVV 3RFRA 3CRCA 3ZBHA 1R6TA 1GAXA 4LFAO 1K9MW 4JI3O 5FPOA 3IAYA 1OCZC 2Q6AA 4OPAA 5GONA 3ZMVA 1OZ0A 2YIBA 4JI0B 1VQLV 3E83A 2KSDA 4NXMB 4LH7A 3EHBB 1M4UA 3RYCA 1NR1A 5BMVB 3AK3A 1JX9A 4NKGB 2RJZA 1Y76B 2XAHA 2IM9A 4G2KA 2L6LA 4G28B 4GX5A 5LA6A 3I5DA 2K1EA 5ITZA 5IJ9B 2ZQMA 2Z5UA 4MVUA 4DV2B 4I55A 4X64B 2PF4E 3STLC 1Q90D 2ZE5A 3W7TA 2QWOB 4TT3G 4IYIA 1B3QA 2UXNA 3PN1A 4X66B 4BAYA 4IT5A 1W59A 5DN6G 2WLMA 4DV4B 2EBOA 2RDCA 3OUSA 3R65A 2HVKC 3U0ZA 3OR7C 4D6TH 3HKEA 4BW5A 1XQ8A 3BA9A 3CRRA 3ZHUA 2GSMB 3UT5A 2LGQA 1M5IA 1K3EA 5L3FA 4UCOA 4UVAA 5H2FZ 2PYLA 2YXYA 4JAAA 5CBHA 1JCHA 4ICGA 3H9VA 2WA3A 4N21A 5H6RA 2UU9O 3JSNA 1F51A 4AI8A 4B3RO 3QVNA 1JR9A 2EX3A 2V7QG 1SERA 3T1HO 3ZMZA 3OGCC 2QGNA 4B3SO 4FFBA 1E1RG 1QNMA 2R9IA 5GTHZ 4LFAB 1Q6UA 1E1QG 2F1MA 1VQ5V 2A7WA 2F23A 3VQYA 2F66C 4KHPO 4J9YB 4DRXB 1MZEA 3MHHC 2CE4A 1TA8A 3ABMC 1H8EG 3JD3A 4WFFA 4WBNB 2JIZG 3L74H 4PDRA 2A9HA 4C7UA 1VQNV 4O4IB 4FZ0A 3X2QB 1KKCA 1Y67A 3ZRXA 3J80N 3ZJZA 3CXHF 2IJKA 1XMQO 4JYAO 2CH7B 4MTGA 2VWJA 2YEVA 2ZDIC 3K59A 1IZ3A 1NI8A 4LF4O 1K5QA 2R70A 1KP3A 3JD4A 1DTOA 2HJDA 4F4LA 4I0XA 3AG4C 1AILA 3JYCA 1OCCB 4JAUA 4X1YA 4BIUA 4FLUA 5EYPA 3WG7C 4ZBMA 3W7XA 5L3GA 3CB2A 2VS0A 3X2QC 1OCRC 5JJJB 2XAFA 2HR3A 4I5SA 3QO5A 1XMOO 2DYSC 2NR5A 3D8CA 4FLXA 1Y4MA 4X20B 1BHBA 4NTXA 4CS3A 1M57B 2AXTZ 1JJOA 2WSSG 5A9GA 1MZFA 1N36O 4O2BB 2OCCC 3ABKB 2R9RB 3KCYA 4X65O 3RYHB 2UU9B 2JJ1G 1OCCC 2E5LO 4PJ0Z 2DWDC 5LHHA 4B3RB 3OE7G 4MVMA 3VOUA 1JPXA 1URFA 4TV8A 3N27A 1CP9A 2IH1C 4B3SB 4YIOA 1VQ9V 3DGEA 1YCIA 4B3MO 2GBOA 5D5QA 5KUMA 2LFRA 1VEWA 3RW0A 5KHGA 1M57C 4KHPB 4LFCO 1FKAO 5BR8B 4DK0A 5LP6A 3T1YO 4O2AB 5IJ0B 4EFEA 3CCJV 3SPGA 4X88A 3APOA 3OR6C 2OWOA 3OMNB 2RNBA 4KFMA 2PTMA 1XMQB 4JTCB 4GZRB 1Z5VA 3EXAA 4JYAB 3A0HZ 3CYOA 1SQFA 2IJHA 3DC6A 4NYKA 5HFMA 1RP3B 4I7ZB 1YEWA 4LF4B 1Y6XA 1HNXO 2FMLA 3P32A 4O4LA 3DXRB 4FIPC 2HEPA 4CH5A 1KKDA 5ITZB 3ML0A 1PL0A 4WFHA 3JARB 4DR5O 1F4MA 4FLZA 1AJPA 2V4DA 1XMOB 3H1HH 4B7EA 3C3TA 2P6JA 2W6IG 3E86A 2JJ2G 4QE7A 1Y74A 1GK9A 5F2VO 1N36B 5KA6A 5AG2A 4A5UB 3BY6A 2OT5A 2BTQB 3L75H 4TSFG 2E5LB 1QCEA 3UT5B 4LR3A 4FM2A 2BE3A 3ASNC 2D2CB 1FPOA 3H1LH 4BR6A 3CD6V 1RSOB 3E22A 4JI4B 3RVZA 4G27B 4B3MB 4PDLA 5C8YA 1SZTA 2B5UA 3RT3C 4RUFA 2DE0X 2N05A 5JH7A 4JI8O 4FFBB 4U3JA 4CS2A 5KX5A 2N74A 4LFCB 3ZHQA 1H2KA 4DV5O 3T1YB 3FB6C 1XDCA 4LCUC 2KG7A 3D3IA 3OTOO 3E8FA 3OEEG 3AG3C 2CAZC 1FJGB 1K7DA 2YXLA 2JRIA 5KMGA 3JD0A 3CCUV 2GTSA 3ETDA 4J41A 1ZX3A 4JYYA 1XHXA 1FYJA 1FFTB 5LOVA 1HNXB 4BIZA 2CTRA 4GKKO 2YEVB 1QR8A 2HKOA 4YY3O 1HNWO 3FKSG 1MABG 3ETGA 3K5LA 4PV1B 2Y4UA 2YSUB 4J7KA 1VQ7V 4DR5B 1S77D 1AI6A 5EYPB 1SF9A 4X9QA 1CEZA 1E79G 2F95B 3A8TA 2OTJV 2KKWA 3HKDA 3B77A 2Q0OC 4RUEA 2Q5ZA 2UUBO 1K97A 5KA5A 5B66Z 1AJQA 4UVCA 1EBOA 4FVMA 2MW2B 3CJHB 4MTFA 5GW7A 1H2NA 1MMMA 3SYCA 3ZRVA 2ARHA 1WB8A 4IHJB 5BZBA 1SA0A 4JGSA 2R72A 3K06A 2Y4TA 3CPWU 2ZD9A 2F43G 5E79Z 2QM7A 4UB8Z 1FXHA 2HLDG 2QA4V 5LMNB 1R3JC 4TV8B 3I55V 2OIEA 4JI8B 2ZT9B 4EB6B 1XL4A 4JAVA 4DV5B 2HJFC 3SPIA 2P90A 3K57A 2ZNIA 2UXXA 3ZHVA 2E76B 4LF6O 2KB1A 3OTOB 1KC8W 4FZ1A 3CRAA 2WLJA 1SZXA 1GH6A 5LP6B 3JD2A 1XOUA 2C2AA 3DTUB 1K73W 4TOIA 1ZL8B 1WA8A 3S3WA 4MVOA 1VF5B 4W4KA 1JJ2U 1WP8A 3BEHA 4F6RA 2X7RB 4TV9A 5DM6V 4GKKB 2XNDG 2A06H 1MOFA 1NR7A 1X59A 1UFIA 4YY3B 1HNWB 4N23A 3GB7C 3K03A 2DMXA 3G67A 5EZYA 4O4LB 4DO2A 1SC5B 1IBKO 4HZ3A 3H01A 4CH4A 3T4DA 2AHYA
chains in the Genus database with same CATH topology
3OR7C 3SYPA 4BW5A 5LHGA 4MVZA 2Y48A 2PI5A 4RQFA 1HWYA 1SETA 2GSMB 2B1IA 1K3EA 1SRYA 5L3FA 4UVAA 4RQEA 1J95A 1PKXA 5CBHA 1S5HC 1JCHA 2WWWA 5HFLA 4N21A 5H6RA 1QLEB 1KECA 5CN0A 5KUKA 1F51A 1OCZB 1H38A 3ABTA 1BHAA 5B1AC 3E8BA 3OMAB 3OMIB 3ABKC 4ASUG 1YTFB 2V7QG 3W7WA 1SERA 4JASA 2CK3G 3ZMZA 1DF5A 3OGCC 1M9NA 3RBZA 4PA4A 1E1RG 3E2EA 2JEUA 3UM7A 2R9IA 5IY5C 2X6BA 3IGAC 1E1QG 4QPKA 5CBFA 1NVPB 1Q86W 4ZKIA 1KP2A 5B3SB 1VQ5V 3ZCCA 1ZWIC 2ZR3A 3OEHG 2EILB 1THZA 3IC7A 1VQMV 1QVFU 4J9YB 5EBMC 3MHHC 3ABMC 1H8EG 3SPHA 3JD3A 3AG2B 5CA3A 4WFFA 1H8HG 1NVPD 2M7WA 2JIZG 4PDRA 2A9HA 1VQNV 3X2QB 3E89A 5EBWC 3ZRXA 2IU3A 2XAGA 1NH2B 3ZJZA 2IJKA 1CPYA 3E8GA 2A79B 3K79A 4KP4A 3A0RA 4R6ZA 4JYBA 2AHZA 3K9AA 2WLNA 1S76D 4MTGA 4L87A 1GMGA 2YEVA 1JQ0A 1NH2D 1R3KC 2ZDIC 1FXKB 4UUJC 3LDDA 1I5XA 3CCRV 1K5QA 1XL6A 1KP3A 1EFRG 3JD4A 3LDEA 1DTOA 1QR9A 3FB7C 1GO3F 1L1FA 4F4LA 1DF4A 5IYCO 3AG4C 1R6KA 3JYCA 2EILC 1OCCB 4JAUA 3R65A 4GX0A 3JCZA 1YJ9V 4YXWG 1QBZA 4HAMA 1GM8A 1PD3A 4BIUA 4P30A 3LSSA 3AG2C 3UKMA 3WG7C 1Q7YW 2DW4A 4ZBMA 3W7XA 5L3GA 2XOKG 2XASA 3B8MA 4UV9A 5FL7G 3X2QC 1OCRC 1V54B 3TCUA 1I5YA 2XAFA 1RM1C 4X8AA 2HR3A 2QTOA 4LBEC 4I5SA 3QO5A 2DYSC 1Y4MA 1BHBA 3P30A 1GTOA 4RO2A 4KUMA 3ZIAG 2IW5A 4FMTA 3W7SA 1WPXA 1M57B 2WSSG 5B1NA 1YJNV 2JK5C 1FXKC 4WF9V 4JPRA 5LGTA 3MHSC 5B1AB 2OCCC 1YIJV 3ABKB 2R9RB 1R3LC 1YITV 2DWEC 1KQSU 3T2MA 1JOYA 4R7CA 2JJ1G 1OCCC 2H94A 2EZPA 2DWDC 5LHHA 5IYDO 3OE7G 4MVMA 4Q20A 3VOUA 1JPXA 2Y69B 1NKDA 4R8CA 3T4ZA 2EIJC 3ZMTA 1CP9A 1V54C 2X6AA 5EC1C 3SYAA 1ORQC 2IH1C 2WLLA 3ABMB 3FB8C 4EKWA 1VQ9V 1F4NA 3DGEA 2WPDG 4GT1A 4QIWF 5KUMA 3SJQC 1H2GA 1RPOA 3HB3B 5E1AC 2LFRA 3ZRWA 3RW0A 1NQTA 3SPCA 1M57C 1OCOC 1IXMA 1S3JA 3LSQA 2X0LA 4CZZA 3ETEA 3FYIB 1AI4A 1G4YB 1FS0G 1V55C 5J9PC 1JVMA 3CCJV 4MVRA 4Z1MG 3SPGA 4X88A 1K4DC 2LP7A 3ABLC 3OR6C 1GM9A 3OMNB 1R73A 4KFMA 1AROP 1LNQA 2EINC 1MSWD 4JTCB 4UVBA 4WFAV 5L3EA 4LP8A 1YTFD 2Y69C 3AG4B 3CYOA 2IJHA 2P7TC 4J9ZB 5HFMA 3CCSV 1PNLA 2WLHA 3CCMV 1Q81W 2ZR2A 3STZC 1YSCA 3G4SV 3WG7B 3HPLC 4I9WA 1P4RA 3P32A 1BL8A 2Z3YA 3CXCU 1OCRB 1RM1B 2DYRB 3MD0A 3CCEV 4FIPC 2Q69A 2DYSB 5H6QA 2WLIB 3E35A 2A0LA 2ATKC 3OFNG 1KKDA 1VQ8V 3ML0A 1PL0A 2QM8A 4WFHA 1GKFA 2X6CA 1PNKA 2BOCC 4PDMA 1F4MA 3F7YC 4JF3A 5L3BA 1TUEB 2OCCB 1AJPA 3ZN1A 4XDLA 2W0FC 1G8MA 2EIKB 3ZRSA 4MW8A 1VQOV 2WAMA 1KD1W 2P6JA 5CMUA 4MVSA 2W6IG 3T1CA 1AI7A 4R50A 3E86A 1S0VA 3K04A 2JJ2G 4FK5C 4QE7A 5LHIA 1GK9A 4MS2A 3TK1A 2ZDIA 1N8RW 4MT8A 5KA6A 1F23A 5L3CA 2EIJB 3SPJA 3BY6A 4PA3A 2OT5A 3I56V 3CMEV 2DQ0A 2DYRC 4TSFG 1AI5A 1QCEA 5EBLC 2HG5C 2BOBC 1OHHG 1WLEA 4XDJA 2JDIG 4P2ZA 3FYEB 2XAJA 3ASNC 3NXSA 3D36A 1NJIW 2HVJC 4UXNA 1OCOB 2QEXV 1K5SA 3CD6V 3CC7V 1BMFG 3AEIA 2HFEC 1V55B 2XAQA 3RVZA 2EZOA 3E8HA 3OM3B 4G27B 2EIKC 4PDLA 2WLKA 3CCQV 3LDCA 1SZTA 2B5UA 3ABLB 3QO7A 4RUFA 3WFVA 2NNUA 1W0KG 1QLNA 4MTOA 2QKSA 1PNMA 2MK3A 3G6EV 2D3OW 2ITDC 2EINB 4XDKA 1VQ4V 2JEXA 5IYBO 4PA7A 3FB6C 5B1OA 1DLBA 1FXKA 4LCUC 4QE9A 3D3IA 2GHYA 2IJIA 2LFSA 2IJJA 3E8FA 3AG3C 3OEEG 4MVQA 5LGNA 2Q67A 3K0DA 3LNMB 4LC1A 1QVGU 5B1BB 3ZMUA 1K7DA 4RAIA 1K8AW 2EIMB 5LBQA 4TWKA 1YHQV 1M56C 3JD0A 3CCUV 4GX2A 2DQ3A 3ETDA 4PA9A 1R6NA 3F5WC 2OTLV 3CC2V 2QE7G 5L3DA 3TETA 3IFXA 1AJNA 4QPJA 1FFTB 3GWOA 2ZXWB 4U7NA 4BIZA 1GM7A 4HYOA 1K92A 4U7OA 2YEVB 1R3IC 1QR8A 2HKOA 3OAAG 5IDJA 4P9OA 3FKSG 1MABG 3ZMSA 1YJWV 2IH3C 1UJWB 4FJCC 3ETGA 2P67A 4E2LA 5EK0A 4XBFA 4GX1A 2YSUB 4H37A 1VQ7V 4DXWA 3K3WA 4JTAB 3CCLV 5B1BC 1SESA 4P9PA 3CMAV 2IU0A 5LGUA 2V1DA 1S77D 3SYOA 1AI6A 1VQKV 2FTKA 1B6QA 2EIMC 1CEZA 3LUTB 4MTXA 1E79G 3QO8A 2OTJV 4PDVA 4MSWC 3B77A 1FXVA 4QNHB 2ITCC 1W0JG 3ASNB 3ASOB 3F7VC 4OXSA 4RUEA 2ZXWC 1K97A 3VBBA 2B1GA 5KA5A 1K33A 3G71V 1AJQA 4UVCA 3B8NA 1EBOA 1RPRA 3OW2U 3EFFK 5GW7A 4MTFA 3CCVV 4JYCA 3JD1A 3SYCA 5EC2C 3ZRVA 1COWG 4QJFB 2W6JG 1QLEC 5BZBA 3K08A 3CP1A 3K0GA 3ZN0A 4JGSA 1K9MW 4X89A 3K06A 1OCZC 2H8PC 3CPWU 1VQ6V 3M99B 1NBMG 2ZD9A 2F43G 3AG1B 2Q6AA 4GCZA 4WFBV 2QM7A 1FXHA 3QNEA 3ZMVA 2HLDG 1ROPA 5H9CA 4CBCA 2QA4V 1OZ0A 1R3JC 3AG3B 3ABUA 2NLJC 3I55V 3W7UA 1VQLV 2WLLB 3E83A 5B3SC 1XL4A 2EJRA 4JAVA 4WFEA 4PELA 2HJFC 3SPIA 2P90A 3ASOC 2UXXA 1M56B 1S72V 3ZRWB 3EHBB 2KB1A 1KC8W 3SYQA 1P7BA 1K34A 1YI2V 3CC4V 3KG2A 1NR1A 1M90W 2WLJA 1JX9A 3OUFA 3JD2A 2XAHA 2C2AA 4WCEV 4G2KA 3DTUB 4G28B 4GX5A 2WLIA 1Y66A 1K73W 1K4CC 4H33A 4UV8A 3RVYA 1EZJA 2K1EA 3AG1C 4MVOA 2ZQMA 2Z5UA 4MVUA 1JJ2U 3BEHA 1AR1B 2X7RB 4JTDB 1M1KW 5DM6V 3STLC 4WFGA 2XNDG 1Q82W 1MOFA 1NR7A 3PJSK 1MG1A 1ENVA 3FB5C 4FPPA 4N23A 3GB7C 3K03A 4TT3G 3W7TA 5C93A 5CBGA 2UXNA 4PA6A 4BAYA 5IY5B 4DO2A 5DN6G 2WLMA 4HZ3A 3H01A 4MW3A 2PI4A 2Q68A 2EBOA 1VQPV 3T4DA 2AHYA 3OUSA 2HVKC 1W2BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYC A;  4QPJ A;  4JAV A;  3ZRV A;  5B1O A;  4U7N A;  3P32 A;  4JAS A;  3NXS A;  2FTK A;  4BIZ A;  4FMT A;  3ZRX A;  4U7O A;  3D36 A;  4JAU A;  4MTX A;  5B1N A;  2LFS A;  3ZRW B;  3MD0 A;  5IDJ A;  4KP4 A;  4BIU A;  3A0R A;  4LC1 A;  4JYB A;  3DGE A;  4QPK A;  4GCZ A;  4ZKI A;  4FPP A;  3TK1 A;  2P67 A;  4GT1 A;  3ZCC A;  2QM7 A;  4MT8 A;  2WWW A;  5C93 A;  2LFR A;  2QM8 A;  3ZRW A;  2C2A A;  1JOY A;  1F51 A;  1IXM A;  4I5S A;  4Q20 A; 
#chains in the Genus database with same CATH topology
 5LYJ A;  5LHG A;  4MVZ A;  3BAA A;  4KXR A;  4LWS A;  5LP6 C;  4H44 B;  1HWY A;  3L70 H;  4YJ3 A;  4I50 A;  1EM1 A;  4CH6 A;  1M93 A;  1J95 A;  5BXZ A;  2FL4 A;  4E4E A;  1S5H C;  5J2T A;  2NN4 A;  2WWW A;  5HFL A;  4D7T A;  3JAL A;  4UFZ A;  1KEC A;  5KUK A;  2UUB B;  3RYF A;  1OCZ B;  3OMI B;  4DV7 O;  2PGG A;  1AVM A;  3W7W A;  1Q6I A;  1I08 A;  3RBZ A;  4PA4 A;  3E2E A;  3CS5 A;  2F4V B;  2N04 A;  1Q86 W;  2EIL B;  3IC7 A;  1SQP H;  1NS1 A;  4TUY B;  4ZOL B;  1H8H G;  3E22 B;  4DR4 B;  3L73 H;  1OJH A;  5TIS Z;  2IU3 A;  2IBZ H;  5C8Y B;  1WAZ A;  4R6Z A;  4JYB A;  4LF6 B;  1NTZ H;  4GKJ O;  3C3S A;  4L87 A;  3KKY A;  1X4T A;  4O4H B;  1NTM H;  4UUJ C;  1XBL A;  5CB4 B;  1XL6 A;  2ODM A;  3LDE A;  1L1F A;  1GO3 F;  1SQG A;  2EIL C;  3JCZ A;  2YUA A;  2QWR B;  1GM8 A;  3LSS A;  4DV6 O;  4X1K B;  3UKM A;  4LH6 A;  4OGQ B;  2XAS A;  1YF2 A;  3B8M A;  5LOV B;  3BCC H;  1DK1 A;  3CWB H;  1RM1 C;  4LBE C;  1IBK B;  2FB5 A;  2YID A;  3P30 A;  3JAT A;  2IW5 A;  3W7S A;  1I7F A;  3GWK C;  4WF9 V;  5LGT A;  4NXN O;  1IBM B;  1YIJ V;  5CA0 B;  4FLT A;  1YIT V;  5JWP A;  2DWE C;  1KQS U;  1JOY A;  3F5T A;  4O4J A;  1O9H A;  3WB1 A;  4Q20 A;  3HKD B;  3JAS A;  2ZIM A;  4DV7 B;  3ZS8 C;  1HP8 A;  1RFY A;  3FAV A;  3ABM B;  2WLL A;  1SKV A;  4FFK A;  5K1X A;  4GYC B;  4HNA A;  2WPD G;  4GT1 A;  3SJQ C;  1ZAU A;  1H2G A;  3K9S A;  5DEC A;  3LNN A;  4D7S A;  2VRZ A;  1IXM A;  2X0L A;  1AI4 A;  4X1I A;  1GN6 A;  1NT2 B;  1K4D C;  2LP7 A;  2FKX A;  4YHH O;  1GM9 A;  1O9G A;  4K3A A;  4DV0 O;  1MSW D;  4WFA V;  3AG4 B;  4GKJ B;  5BR8 O;  4OX9 O;  1N32 O;  2UXD O;  3WG7 B;  5JCO A;  4I9W A;  1P4R A;  1BL8 A;  1OCR B;  3MD0 A;  3R66 A;  2DN9 A;  2DYS B;  3MDS A;  2JVD A;  2XHB A;  3B40 A;  2A0L A;  2QSA A;  4DV6 B;  1PP9 H;  3NR7 A;  1VQ8 V;  3GVM A;  2X6C A;  4F6R B;  2BOC C;  4TV9 B;  1TUE B;  2OCC B;  3THO A;  4IIJ A;  1ZTE A;  3ZN1 A;  2W0F C;  4GLX A;  3QG5 A;  2EIK B;  4MW8 A;  4LFB O;  4DK1 A;  1KD1 W;  5CMU A;  1AI7 A;  3EVK A;  3K04 A;  4MS2 A;  4NXN B;  1XRE A;  2GDS A;  2QTS A;  3SJA C;  5LYJ B;  3SPJ A;  3I56 V;  2DQ0 A;  4IYH A;  4I50 B;  4K0K O;  4UB6 Z;  2HG5 C;  1OHH G;  4K8Z A;  3H1I H;  2ZM6 O;  3FYE B;  3IC9 A;  1NJI W;  3JAL B;  3JAW B;  2HVJ C;  1BQ0 A;  3WU2 Z;  1K5S A;  4FLY A;  3H1K H;  5JQG A;  3CC7 V;  2XUM A;  2HFE C;  2ADP A;  1I94 O;  1EZV H;  1LR1 A;  2EZO A;  3E8H A;  2JS5 A;  2EIK C;  3CCQ V;  3WFV A;  2ZNJ A;  1QLN A;  1PNM A;  2D3O W;  2P4V A;  4UCR A;  1AR5 A;  1VQ4 V;  1ZLZ A;  2JEX A;  1QU7 A;  4PA7 A;  5B1O A;  4ZI7 B;  4J10 A;  1DLB A;  1FXK A;  2IJI A;  5LGN A;  4YHH B;  1H2M A;  1KYO F;  4LC1 A;  4JI4 O;  1SQB H;  1VF6 A;  4DV0 B;  1A32 A;  2EIM B;  2BCC H;  1YZB A;  1IXB A;  1M56 C;  3RGB A;  4GX2 A;  3TJT A;  1PM9 A;  2DQ3 A;  2P22 C;  2QE7 G;  5L3D A;  3TET A;  1AJN A;  4OX9 B;  1N32 B;  2ZXW B;  2UXD B;  1K92 A;  5GON B;  2LW1 A;  1FJG O;  1YJW V;  3ZMS A;  3ZHT A;  4FJC C;  2P67 A;  4E2L A;  4XBF A;  5KHK A;  3QF7 A;  4J80 A;  4H37 A;  2ZKO A;  2YIB D;  3CCL V;  5LGU A;  1Q6H A;  3SYO A;  3RYC B;  1B6Q A;  4LFB B;  2EIM C;  4JI1 B;  1LUV A;  3BFR A;  5A2Q N;  1G1X B;  5LA6 B;  1N34 O;  1MSD A;  2ITC C;  3ASN B;  3F7V C;  3J7A U;  2ZXW C;  3JAT B;  4NB5 A;  4DV3 O;  4DR1 O;  3B8N A;  4I55 B;  1RPR A;  2BTO A;  1AB3 A;  4BWA A;  4K0K B;  2P4K A;  4NTW A;  4ZHQ A;  1UPG A;  4DR7 O;  1COW G;  2W6J G;  2ZM6 B;  1QLE C;  3HKB A;  1XIL A;  3ZN0 A;  1IUR A;  1HR0 O;  1VQ6 V;  2RN9 A;  1NBM G;  5CA1 A;  3AG1 B;  4O4J B;  2OYQ A;  4LNU A;  2A3Q A;  1VIB A;  1I94 B;  3QNE A;  1ROP A;  3JAS B;  5H9C A;  3RWR D;  4CBC A;  3K5N A;  3HKE B;  3FD9 A;  3AG3 B;  5FNV A;  4PD4 F;  2WLL B;  5B3S C;  4HNA B;  2EJR A;  4WFE A;  4LF9 O;  3N2K A;  1S72 V;  1TUB A;  1P7B A;  1K34 A;  1YI2 V;  1BGY H;  1H2S B;  2ILM A;  3SJC C;  2QR4 A;  3OUF A;  5LMN O;  4X1I B;  5LMU O;  1FFX A;  1DGS A;  2CTP A;  2WLI A;  1K4C C;  4UV8 A;  3RVY A;  1EZJ A;  3AG1 C;  2ETN A;  1VAR A;  1WJZ A;  2CTQ A;  1M1K W;  5LL6 Y;  3PJS K;  3WB2 A;  4FPP A;  5CBG A;  1EN4 A;  4PA6 A;  4MW3 A;  2PI4 A;  2Q68 A;  4OPH A;  3TXQ A;  1S0V A;  3SYP A;  3KCX A;  1SET A;  1SRY A;  2P5O A;  3RN4 A;  4DW1 A;  1WP7 A;  1N34 B;  2AW9 A;  1H2L A;  2ZE6 A;  4I0X B;  4DV3 B;  4DR1 B;  3ABT A;  1H38 A;  4EFB A;  2GUZ A;  5B1A C;  1BHA A;  4X1Y B;  4ASU G;  1YTF B;  5EIB C;  2P06 A;  1DF5 A;  4FM1 A;  5FPR A;  5JCO C;  4DR7 B;  3UM7 A;  3IGA C;  3C90 A;  1HR0 B;  1NVP B;  4FM0 A;  2RMK B;  3U10 A;  1EN6 A;  4HBN A;  3ZCC A;  1QQC A;  3OEH G;  1HDJ A;  4Z2W A;  1QVF U;  1G6U A;  1D5A A;  5EBM C;  3WB0 A;  3ZED A;  5KHI A;  1V9P A;  3SPH A;  3VQX A;  5CA3 A;  1FAF A;  1NVP D;  4L8J A;  2CDY A;  5JQG B;  1B04 A;  4JI7 O;  3E89 A;  2XAG A;  4BIO A;  4LF9 B;  2JGU A;  2A79 B;  2F4V O;  2HHH O;  2WLN A;  1IBL O;  2QWQ B;  3JCU Z;  4B3T O;  1WN7 A;  5LMU B;  1FXK B;  2QWP B;  3LDD A;  2HP8 A;  3CCR V;  1EFR G;  4DR4 O;  1QR9 A;  1ZUQ A;  4CH3 A;  1R6K A;  4GUN A;  3DC5 A;  4JZG A;  1YJ9 V;  2QKC A;  1QBZ A;  4HAM A;  4AIL C;  1PD3 A;  4P30 A;  4Q6G A;  5D5P A;  1Q7Y W;  4UV9 A;  3TCU A;  1SS3 A;  4RO2 A;  3ZIA G;  1BE3 H;  3CHX A;  1WPX A;  4TQD A;  1YJN V;  2JK5 C;  1FXK C;  4JPR A;  4DR6 O;  4U3F H;  4X62 O;  1R3L C;  1AP6 A;  1VF6 C;  3T2M A;  3U11 A;  2QWN B;  3BAB A;  1HNZ O;  3FX7 A;  2E3C A;  2YDE A;  2Y69 B;  2Y0I A;  5J2U A;  3T4Z A;  2EIJ C;  2F93 B;  2X6A A;  5EC1 C;  3FB8 C;  1IBM O;  1P7G A;  4EKW A;  1F4N A;  4QIW F;  4J11 A;  2UUC O;  3A2F A;  5E1A C;  2CGN A;  3ZRW A;  4ZHQ B;  1GRJ A;  1OCO C;  1S3J A;  3LSQ A;  3HKB B;  4LF5 O;  3ICX A;  1V55 C;  5CA1 B;  1Q3E A;  1YDX A;  1Y74 B;  3UO3 A;  1XEQ A;  3ABL C;  2QJ1 A;  4JI7 B;  1R73 A;  1ARO P;  2VQE O;  1NU1 H;  4J42 A;  2EIN C;  5FNV B;  4LP8 A;  2Y69 C;  2HHH B;  2P7T C;  1IBL B;  3CCS V;  4O2B A;  2YI9 A;  1PNL A;  4I4T A;  4B3T B;  3CCM V;  3BHP A;  1Q81 W;  5KAF Z;  3STZ C;  2PYJ A;  3G4S V;  3APQ A;  3RYH A;  3AK2 A;  3HPL C;  3CXC U;  4H13 B;  1RM1 B;  3CCE V;  1FFX B;  2Q69 A;  1TGO A;  1U96 A;  2WLI B;  3SJB C;  5JH7 B;  2ATK C;  4U3J B;  5FLX N;  3OFN G;  3JAK A;  5KX5 B;  1SQQ H;  3J81 N;  4PDM A;  2Q7H A;  1WB7 A;  2KG7 B;  3F7Y C;  4JF3 A;  4XDL A;  3L72 H;  2GTA A;  3ZRS A;  2BSK A;  3N2G A;  2WAM A;  1P84 F;  4MVS A;  4LF8 O;  1NTK H;  4O2A A;  4FK5 C;  2QM4 A;  5KMG B;  5IJ0 A;  5LHI A;  3ZHR A;  4DR6 B;  1MA1 A;  2ZIO A;  1N8R W;  2YS8 A;  4MT8 A;  1F23 A;  4X62 B;  3BVO A;  4PA3 A;  2GV9 A;  2Q4P A;  3CME V;  1AI5 A;  5EBL C;  2BOB C;  1HNZ B;  2UXC O;  1WLE A;  4XDJ A;  2JDI G;  4IGG A;  3DSQ A;  5JJN B;  5IE9 A;  3D36 A;  3HKC A;  2VQF O;  4UXN A;  2QEX V;  3TGU H;  1US6 A;  4AQY O;  3AEI A;  5LXT A;  2XAQ A;  1XNR O;  2GUZ B;  1B06 A;  3DXR A;  2UUA O;  2VWK A;  2WLK A;  3LDC A;  3QO7 A;  2UUC B;  1W0K G;  4MTO A;  2QKS A;  3G6E V;  2ITD C;  5KAI Z;  4XDK A;  2H3O A;  4LF5 B;  2Q8V A;  3JAR A;  4QE9 A;  2GHY A;  2LFS A;  4NTY A;  4MVQ A;  2WA4 A;  2Q67 A;  3LNM B;  1XI1 A;  1QVG U;  5B1B B;  4EEQ A;  4RAI A;  2VQE B;  3B4S A;  2JS3 A;  1AR4 A;  1L8D A;  4UCU A;  4IL6 Z;  1OV9 A;  2CTW A;  3JAM N;  3L9D A;  4PA9 A;  1D2D A;  3F5W C;  1U97 A;  1SA0 B;  4DV1 B;  3B2E E;  3GWO A;  4UCS A;  2Q7E A;  3UQ8 A;  1GM7 A;  2BTQ A;  4HYO A;  5B5E Z;  1N0J A;  4P9O A;  4DR2 O;  2IH3 C;  1UJW B;  1HW7 A;  5DED A;  1MNG A;  3BRC A;  5EK0 A;  1RSO A;  4JI6 O;  3Q4H A;  4GX1 A;  2Y0P A;  5IYZ A;  1BSM A;  2Q0A A;  4BW9 A;  5B1B C;  3CMA V;  4P9P A;  1TVK A;  1VF7 A;  5KHJ A;  3LUT B;  3TXS A;  4JI2 O;  4LF8 B;  4JI3 B;  4MSW C;  1FXV A;  3ASO B;  4OXS A;  1WA8 B;  3M7M X;  1SQX H;  2B1G A;  1K33 A;  3G71 V;  3B09 A;  3G80 A;  3OW2 U;  5JJE B;  1WNS A;  4JYC A;  3JD1 A;  5EC2 C;  1LUW A;  4JI1 O;  2UXC B;  4QJF B;  1NZ6 A;  3K08 A;  3CP1 A;  3K0G A;  2OCH A;  4X89 A;  2VQF B;  2H8P C;  3M99 B;  5EZY B;  1ZSP A;  4GCZ A;  4AQY B;  4WFB V;  1XUQ A;  4DUY O;  1XNR B;  3SDL A;  1IX9 A;  2UUA B;  4DW0 A;  5J2U B;  2RQ6 A;  4LWS B;  3ABU A;  2NLJ C;  1GN2 A;  3W7U A;  4YJ3 B;  4PEL A;  1PL4 A;  3ASO C;  4NR1 A;  4YJ2 A;  5J2T B;  1M56 B;  3ZRW B;  3SYQ A;  3CC4 V;  2Z0A A;  3KG2 A;  3RYF B;  2JGD A;  1M90 W;  1PV0 A;  2O57 A;  1QHT A;  2LW7 A;  4WCE V;  1GN4 A;  1Y66 A;  4H33 A;  1BS3 A;  1SQV H;  3ETQ A;  3VQV A;  1AR1 B;  4JTD B;  3BA8 A;  4WFG A;  3CJH A;  1Q82 W;  4I4T B;  4ZIB A;  1MG1 A;  3JSL A;  4JV5 O;  1ENV A;  3FB5 C;  4IHJ A;  4DR2 B;  1Q8I A;  1N33 O;  3BPZ A;  5C93 A;  4Z1V A;  1YXB A;  3OT7 A;  4KL1 A;  2AZ0 A;  5IY5 B;  3OTF A;  1P49 A;  4JI6 B;  1JFF A;  2LGW A;  2CGO A;  1VQP V;  1W2B U;  2EUL A;  1GN3 A;  1YVW A;  2Y48 A;  3T1H B;  2PI5 A;  4RQF A;  3JAK B;  4DUZ O;  4EB6 A;  2B1I A;  2YXH A;  3OGI B;  4J7J A;  2PZS A;  4JI2 B;  4RQE A;  1PKX A;  2BSK B;  1QLE B;  3N2G B;  5CN0 A;  2R9A A;  1N0N A;  3ZX6 A;  2UXB O;  1I0H A;  3E8B A;  3OMA B;  2QDO A;  3ABK C;  4JAS A;  2CK3 G;  1BZK A;  1M9N A;  4FLV A;  2E75 B;  2OIG A;  2JEU A;  1ZL8 A;  3RYI A;  5JVD A;  2DOS A;  2X6B A;  5IY5 C;  3O9O A;  4JZ2 A;  4QPK A;  5CBF A;  4ZKI A;  1KP2 A;  3FFQ A;  5B3S B;  1ZWI C;  2YIC A;  2ZR3 A;  3VQW A;  1THZ A;  4DUY B;  1VQM V;  1F7Y A;  1PPJ H;  3HKC B;  3AG2 B;  4UCT A;  2M7W A;  5GTI Z;  5LXT B;  5EBW C;  2K9P A;  2CUG A;  1NH2 B;  2YIA A;  1CPY A;  3E8G A;  3K58 A;  3K79 A;  4KP4 A;  3A0R A;  3UCS C;  3G6B A;  2AHZ A;  3K9A A;  3ZHS A;  1S76 D;  2LO1 A;  1GMG A;  1JQ0 A;  2FYU H;  1NH2 D;  1R3K C;  5KLV H;  4DYL A;  4W4L A;  1I5X A;  2DJV A;  2AZ2 A;  5IWA O;  3FAV B;  3FB7 C;  1DF4 A;  5IYC O;  4GX0 A;  3IJ4 A;  4YIP A;  4YXW G;  1S5J A;  1R1B A;  3D36 C;  3AG2 C;  2DW4 A;  4JV5 B;  2QKA A;  2XOK G;  5FL7 G;  1N33 B;  5BY1 A;  4X65 B;  2Q73 A;  1V54 B;  4I9Q A;  1KBH A;  1I5Y A;  4H0L B;  4X8A A;  4FLW A;  2QTO A;  3H1J H;  2PUS A;  1EN5 A;  1CXZ B;  3KZI Z;  1KMI Z;  1GTO A;  4TUY A;  4KUM A;  4K35 A;  4NVP A;  4FMT A;  4ZOL A;  3UO2 A;  1VP7 A;  1J5E O;  3CX5 F;  5B1N A;  3Q4H B;  2Q7G A;  5IYZ B;  3MHS C;  5B1A B;  2B9Z A;  4DUZ B;  3P3P A;  3MAQ A;  1TVK B;  4R7C A;  2H94 A;  2EZP A;  5IYD O;  2UXB B;  4O4H A;  4CS4 A;  1NKD A;  5EIB D;  4R8C A;  1Z5W A;  5CB4 A;  3ZMT A;  1V54 C;  4PHZ A;  4CC6 A;  3SYA A;  1ORQ C;  2ZCE A;  1AP5 A;  3L71 H;  1RPO A;  3HB3 B;  4IIJ B;  1NQT A;  3CRM A;  3SPC A;  4TQF A;  4X1K A;  3CE2 A;  4CZZ A;  3ETE A;  5BMV A;  3FYI B;  1G4Y B;  1FS0 G;  3O65 A;  1Y76 A;  5J9P C;  1JVM A;  1Q5O A;  4MVR A;  4Z1M G;  4B08 A;  2ZE7 A;  1L0N H;  1S5L Z;  1BT8 A;  1LNQ A;  5IJ9 A;  2W0X A;  4UVB A;  5L3E A;  1YTF D;  4J9Z B;  5KHH A;  2WLH A;  2YI8 A;  4YJ2 B;  4J7Z A;  2ZR2 A;  2ZE8 A;  5CA0 A;  5IT9 N;  3P3N A;  1YSC A;  5IWA B;  2JGD B;  1BQZ A;  3LSU A;  2Z3Y A;  2DYR B;  1TAE A;  1FD9 A;  5H6Q A;  3E35 A;  2QM8 A;  1GKF A;  1PNK A;  5L3B A;  1G8M A;  4PI2 A;  1VQO V;  1XNQ O;  3T1C A;  3CEI A;  2PY5 A;  4R50 A;  2RCV A;  1J5E B;  4DR3 O;  1JFF B;  3D3Q A;  4JI5 O;  3TK1 A;  2ZDI A;  4LF7 O;  5L3C A;  2EIJ B;  1IVS A;  1KUQ A;  1N4C A;  2KQX A;  1JA8 A;  2EJ7 A;  2DYR C;  1VMG A;  1BCC H;  3AG7 A;  4B7K A;  4P2Z A;  2XAJ A;  3NXS A;  4DRX A;  2Q9L A;  1D5N A;  1JMK C;  1OCO B;  4WBN A;  1KU9 A;  4QGP A;  1BMF G;  1Q43 A;  4O4I A;  1V55 B;  4F6E A;  3OM3 B;  3ABL B;  3K5O A;  2LQT A;  2NNU A;  4JI0 O;  2MK3 A;  2CH7 A;  3RYI B;  5JVD B;  2EIN B;  3AK1 A;  4PI0 A;  4K8X A;  5IYB O;  4NXM O;  3A0B Z;  3CSX A;  2IJJ A;  3K0D A;  2LJ2 A;  3ZMU A;  2E74 B;  4CC5 A;  3CRQ A;  1K8A W;  2ADQ B;  3SGI A;  5LBQ A;  3M8A A;  4TWK A;  2AGA A;  1YHQ V;  1R6N A;  3K5M A;  2OTL V;  2L35 A;  1T5E A;  1XHZ A;  3CC2 V;  3IFX A;  3S3X A;  4QPJ A;  4DV2 O;  3QTC A;  2ZIN A;  4U7N A;  4X64 O;  4LNU B;  4U7O A;  1L0L H;  1R3I C;  3OAA G;  5IDJ A;  2G38 A;  4X20 A;  2XTA A;  4AHC A;  2XT9 A;  3JAW A;  4X66 O;  4ABM A;  4DV4 O;  5H5N A;  3K3W A;  4DXW A;  4JTA B;  3N2K B;  4DV1 O;  1SES A;  2IU0 A;  1TUB B;  3SR2 C;  2V1D A;  2M6Y A;  1VQK V;  2FTK A;  4RWU A;  4MTX A;  2YC0 A;  3QO8 A;  1XNQ B;  1KB9 F;  1IDS A;  4PDV A;  4ZI7 A;  1Z2G A;  4DR3 B;  3HR0 A;  4JI5 B;  4QNH B;  3OD4 A;  1W0J G;  4LF7 B;  3VBB A;  5K1P A;  4UCV A;  3EFF K;  1WPB A;  3CCV V;  3RFR A;  3CRC A;  3ZBH A;  1R6T A;  1GAX A;  4LFA O;  1K9M W;  4JI3 O;  5FPO A;  3IAY A;  1OCZ C;  2Q6A A;  4OPA A;  5GON A;  3ZMV A;  1OZ0 A;  2YIB A;  4JI0 B;  1VQL V;  3E83 A;  2KSD A;  4NXM B;  4LH7 A;  3EHB B;  1M4U A;  3RYC A;  1NR1 A;  5BMV B;  3AK3 A;  1JX9 A;  4NKG B;  2RJZ A;  1Y76 B;  2XAH A;  2IM9 A;  4G2K A;  2L6L A;  4G28 B;  4GX5 A;  5LA6 A;  3I5D A;  2K1E A;  5ITZ A;  5IJ9 B;  2ZQM A;  2Z5U A;  4MVU A;  4DV2 B;  4I55 A;  4X64 B;  2PF4 E;  3STL C;  1Q90 D;  2ZE5 A;  3W7T A;  2QWO B;  4TT3 G;  4IYI A;  1B3Q A;  2UXN A;  3PN1 A;  4X66 B;  4BAY A;  4IT5 A;  1W59 A;  5DN6 G;  2WLM A;  4DV4 B;  2EBO A;  2RDC A;  3OUS A;  3R65 A;  2HVK C;  3U0Z A;  3OR7 C;  4D6T H;  3HKE A;  4BW5 A;  1XQ8 A;  3BA9 A;  3CRR A;  3ZHU A;  2GSM B;  3UT5 A;  2LGQ A;  1M5I A;  1K3E A;  5L3F A;  4UCO A;  4UVA A;  5H2F Z;  2PYL A;  2YXY A;  4JAA A;  5CBH A;  1JCH A;  4ICG A;  3H9V A;  2WA3 A;  4N21 A;  5H6R A;  2UU9 O;  3JSN A;  1F51 A;  4AI8 A;  4B3R O;  3QVN A;  1JR9 A;  2EX3 A;  2V7Q G;  1SER A;  3T1H O;  3ZMZ A;  3OGC C;  2QGN A;  4B3S O;  4FFB A;  1E1R G;  1QNM A;  2R9I A;  5GTH Z;  4LFA B;  1Q6U A;  1E1Q G;  2F1M A;  1VQ5 V;  2A7W A;  2F23 A;  3VQY A;  2F66 C;  4KHP O;  4J9Y B;  4DRX B;  1MZE A;  3MHH C;  2CE4 A;  1TA8 A;  3ABM C;  1H8E G;  3JD3 A;  4WFF A;  4WBN B;  2JIZ G;  3L74 H;  4PDR A;  2A9H A;  4C7U A;  1VQN V;  4O4I B;  4FZ0 A;  3X2Q B;  1KKC A;  1Y67 A;  3ZRX A;  3J80 N;  3ZJZ A;  3CXH F;  2IJK A;  1XMQ O;  4JYA O;  2CH7 B;  4MTG A;  2VWJ A;  2YEV A;  2ZDI C;  3K59 A;  1IZ3 A;  1NI8 A;  4LF4 O;  1K5Q A;  2R70 A;  1KP3 A;  3JD4 A;  1DTO A;  2HJD A;  4F4L A;  4I0X A;  3AG4 C;  1AIL A;  3JYC A;  1OCC B;  4JAU A;  4X1Y A;  4BIU A;  4FLU A;  5EYP A;  3WG7 C;  4ZBM A;  3W7X A;  5L3G A;  3CB2 A;  2VS0 A;  3X2Q C;  1OCR C;  5JJJ B;  2XAF A;  2HR3 A;  4I5S A;  3QO5 A;  1XMO O;  2DYS C;  2NR5 A;  3D8C A;  4FLX A;  1Y4M A;  4X20 B;  1BHB A;  4NTX A;  4CS3 A;  1M57 B;  2AXT Z;  1JJO A;  2WSS G;  5A9G A;  1MZF A;  1N36 O;  4O2B B;  2OCC C;  3ABK B;  2R9R B;  3KCY A;  4X65 O;  3RYH B;  2UU9 B;  2JJ1 G;  1OCC C;  2E5L O;  4PJ0 Z;  2DWD C;  5LHH A;  4B3R B;  3OE7 G;  4MVM A;  3VOU A;  1JPX A;  1URF A;  4TV8 A;  3N27 A;  1CP9 A;  2IH1 C;  4B3S B;  4YIO A;  1VQ9 V;  3DGE A;  1YCI A;  4B3M O;  2GBO A;  5D5Q A;  5KUM A;  2LFR A;  1VEW A;  3RW0 A;  5KHG A;  1M57 C;  4KHP B;  4LFC O;  1FKA O;  5BR8 B;  4DK0 A;  5LP6 A;  3T1Y O;  4O2A B;  5IJ0 B;  4EFE A;  3CCJ V;  3SPG A;  4X88 A;  3APO A;  3OR6 C;  2OWO A;  3OMN B;  2RNB A;  4KFM A;  2PTM A;  1XMQ B;  4JTC B;  4GZR B;  1Z5V A;  3EXA A;  4JYA B;  3A0H Z;  3CYO A;  1SQF A;  2IJH A;  3DC6 A;  4NYK A;  5HFM A;  1RP3 B;  4I7Z B;  1YEW A;  4LF4 B;  1Y6X A;  1HNX O;  2FML A;  3P32 A;  4O4L A;  3DXR B;  4FIP C;  2HEP A;  4CH5 A;  1KKD A;  5ITZ B;  3ML0 A;  1PL0 A;  4WFH A;  3JAR B;  4DR5 O;  1F4M A;  4FLZ A;  1AJP A;  2V4D A;  1XMO B;  3H1H H;  4B7E A;  3C3T A;  2P6J A;  2W6I G;  3E86 A;  2JJ2 G;  4QE7 A;  1Y74 A;  1GK9 A;  5F2V O;  1N36 B;  5KA6 A;  5AG2 A;  4A5U B;  3BY6 A;  2OT5 A;  2BTQ B;  3L75 H;  4TSF G;  2E5L B;  1QCE A;  3UT5 B;  4LR3 A;  4FM2 A;  2BE3 A;  3ASN C;  2D2C B;  1FPO A;  3H1L H;  4BR6 A;  3CD6 V;  1RSO B;  3E22 A;  4JI4 B;  3RVZ A;  4G27 B;  4B3M B;  4PDL A;  5C8Y A;  1SZT A;  2B5U A;  3RT3 C;  4RUF A;  2DE0 X;  2N05 A;  5JH7 A;  4JI8 O;  4FFB B;  4U3J A;  4CS2 A;  5KX5 A;  2N74 A;  4LFC B;  3ZHQ A;  1H2K A;  4DV5 O;  3T1Y B;  3FB6 C;  1XDC A;  4LCU C;  2KG7 A;  3D3I A;  3OTO O;  3E8F A;  3OEE G;  3AG3 C;  2CAZ C;  1FJG B;  1K7D A;  2YXL A;  2JRI A;  5KMG A;  3JD0 A;  3CCU V;  2GTS A;  3ETD A;  4J41 A;  1ZX3 A;  4JYY A;  1XHX A;  1FYJ A;  1FFT B;  5LOV A;  1HNX B;  4BIZ A;  2CTR A;  4GKK O;  2YEV B;  1QR8 A;  2HKO A;  4YY3 O;  1HNW O;  3FKS G;  1MAB G;  3ETG A;  3K5L A;  4PV1 B;  2Y4U A;  2YSU B;  4J7K A;  1VQ7 V;  4DR5 B;  1S77 D;  1AI6 A;  5EYP B;  1SF9 A;  4X9Q A;  1CEZ A;  1E79 G;  2F95 B;  3A8T A;  2OTJ V;  2KKW A;  3HKD A;  3B77 A;  2Q0O C;  4RUE A;  2Q5Z A;  2UUB O;  1K97 A;  5KA5 A;  5B66 Z;  1AJQ A;  4UVC A;  1EBO A;  4FVM A;  2MW2 B;  3CJH B;  4MTF A;  5GW7 A;  1H2N A;  1MMM A;  3SYC A;  3ZRV A;  2ARH A;  1WB8 A;  4IHJ B;  5BZB A;  1SA0 A;  4JGS A;  2R72 A;  3K06 A;  2Y4T A;  3CPW U;  2ZD9 A;  2F43 G;  5E79 Z;  2QM7 A;  4UB8 Z;  1FXH A;  2HLD G;  2QA4 V;  5LMN B;  1R3J C;  4TV8 B;  3I55 V;  2OIE A;  4JI8 B;  2ZT9 B;  4EB6 B;  1XL4 A;  4JAV A;  4DV5 B;  2HJF C;  3SPI A;  2P90 A;  3K57 A;  2ZNI A;  2UXX A;  3ZHV A;  2E76 B;  4LF6 O;  2KB1 A;  3OTO B;  1KC8 W;  4FZ1 A;  3CRA A;  2WLJ A;  1SZX A;  1GH6 A;  5LP6 B;  3JD2 A;  1XOU A;  2C2A A;  3DTU B;  1K73 W;  4TOI A;  1ZL8 B;  1WA8 A;  3S3W A;  4MVO A;  1VF5 B;  4W4K A;  1JJ2 U;  1WP8 A;  3BEH A;  4F6R A;  2X7R B;  4TV9 A;  5DM6 V;  4GKK B;  2XND G;  2A06 H;  1MOF A;  1NR7 A;  1X59 A;  1UFI A;  4YY3 B;  1HNW B;  4N23 A;  3GB7 C;  3K03 A;  2DMX A;  3G67 A;  5EZY A;  4O4L B;  4DO2 A;  1SC5 B;  1IBK O;  4HZ3 A;  3H01 A;  4CH4 A;  3T4D A;  2AHY A; 
#chains in the Genus database with same CATH homology
 3OR7 C;  3SYP A;  4BW5 A;  5LHG A;  4MVZ A;  2Y48 A;  2PI5 A;  4RQF A;  1HWY A;  1SET A;  2GSM B;  2B1I A;  1K3E A;  1SRY A;  5L3F A;  4UVA A;  4RQE A;  1J95 A;  1PKX A;  5CBH A;  1S5H C;  1JCH A;  2WWW A;  5HFL A;  4N21 A;  5H6R A;  1QLE B;  1KEC A;  5CN0 A;  5KUK A;  1F51 A;  1OCZ B;  1H38 A;  3ABT A;  1BHA A;  5B1A C;  3E8B A;  3OMA B;  3OMI B;  3ABK C;  4ASU G;  1YTF B;  2V7Q G;  3W7W A;  1SER A;  4JAS A;  2CK3 G;  3ZMZ A;  1DF5 A;  3OGC C;  1M9N A;  3RBZ A;  4PA4 A;  1E1R G;  3E2E A;  2JEU A;  3UM7 A;  2R9I A;  5IY5 C;  2X6B A;  3IGA C;  1E1Q G;  4QPK A;  5CBF A;  1NVP B;  1Q86 W;  4ZKI A;  1KP2 A;  5B3S B;  1VQ5 V;  3ZCC A;  1ZWI C;  2ZR3 A;  3OEH G;  2EIL B;  1THZ A;  3IC7 A;  1VQM V;  1QVF U;  4J9Y B;  5EBM C;  3MHH C;  3ABM C;  1H8E G;  3SPH A;  3JD3 A;  3AG2 B;  5CA3 A;  4WFF A;  1H8H G;  1NVP D;  2M7W A;  2JIZ G;  4PDR A;  2A9H A;  1VQN V;  3X2Q B;  3E89 A;  5EBW C;  3ZRX A;  2IU3 A;  2XAG A;  1NH2 B;  3ZJZ A;  2IJK A;  1CPY A;  3E8G A;  2A79 B;  3K79 A;  4KP4 A;  3A0R A;  4R6Z A;  4JYB A;  2AHZ A;  3K9A A;  2WLN A;  1S76 D;  4MTG A;  4L87 A;  1GMG A;  2YEV A;  1JQ0 A;  1NH2 D;  1R3K C;  2ZDI C;  1FXK B;  4UUJ C;  3LDD A;  1I5X A;  3CCR V;  1K5Q A;  1XL6 A;  1KP3 A;  1EFR G;  3JD4 A;  3LDE A;  1DTO A;  1QR9 A;  3FB7 C;  1GO3 F;  1L1F A;  4F4L A;  1DF4 A;  5IYC O;  3AG4 C;  1R6K A;  3JYC A;  2EIL C;  1OCC B;  4JAU A;  3R65 A;  4GX0 A;  3JCZ A;  1YJ9 V;  4YXW G;  1QBZ A;  4HAM A;  1GM8 A;  1PD3 A;  4BIU A;  4P30 A;  3LSS A;  3AG2 C;  3UKM A;  3WG7 C;  1Q7Y W;  2DW4 A;  4ZBM A;  3W7X A;  5L3G A;  2XOK G;  2XAS A;  3B8M A;  4UV9 A;  5FL7 G;  3X2Q C;  1OCR C;  1V54 B;  3TCU A;  1I5Y A;  2XAF A;  1RM1 C;  4X8A A;  2HR3 A;  2QTO A;  4LBE C;  4I5S A;  3QO5 A;  2DYS C;  1Y4M A;  1BHB A;  3P30 A;  1GTO A;  4RO2 A;  4KUM A;  3ZIA G;  2IW5 A;  4FMT A;  3W7S A;  1WPX A;  1M57 B;  2WSS G;  5B1N A;  1YJN V;  2JK5 C;  1FXK C;  4WF9 V;  4JPR A;  5LGT A;  3MHS C;  5B1A B;  2OCC C;  1YIJ V;  3ABK B;  2R9R B;  1R3L C;  1YIT V;  2DWE C;  1KQS U;  3T2M A;  1JOY A;  4R7C A;  2JJ1 G;  1OCC C;  2H94 A;  2EZP A;  2DWD C;  5LHH A;  5IYD O;  3OE7 G;  4MVM A;  4Q20 A;  3VOU A;  1JPX A;  2Y69 B;  1NKD A;  4R8C A;  3T4Z A;  2EIJ C;  3ZMT A;  1CP9 A;  1V54 C;  2X6A A;  5EC1 C;  3SYA A;  1ORQ C;  2IH1 C;  2WLL A;  3ABM B;  3FB8 C;  4EKW A;  1VQ9 V;  1F4N A;  3DGE A;  2WPD G;  4GT1 A;  4QIW F;  5KUM A;  3SJQ C;  1H2G A;  1RPO A;  3HB3 B;  5E1A C;  2LFR A;  3ZRW A;  3RW0 A;  1NQT A;  3SPC A;  1M57 C;  1OCO C;  1IXM A;  1S3J A;  3LSQ A;  2X0L A;  4CZZ A;  3ETE A;  3FYI B;  1AI4 A;  1G4Y B;  1FS0 G;  1V55 C;  5J9P C;  1JVM A;  3CCJ V;  4MVR A;  4Z1M G;  3SPG A;  4X88 A;  1K4D C;  2LP7 A;  3ABL C;  3OR6 C;  1GM9 A;  3OMN B;  1R73 A;  4KFM A;  1ARO P;  1LNQ A;  2EIN C;  1MSW D;  4JTC B;  4UVB A;  4WFA V;  5L3E A;  4LP8 A;  1YTF D;  2Y69 C;  3AG4 B;  3CYO A;  2IJH A;  2P7T C;  4J9Z B;  5HFM A;  3CCS V;  1PNL A;  2WLH A;  3CCM V;  1Q81 W;  2ZR2 A;  3STZ C;  1YSC A;  3G4S V;  3WG7 B;  3HPL C;  4I9W A;  1P4R A;  3P32 A;  1BL8 A;  2Z3Y A;  3CXC U;  1OCR B;  1RM1 B;  2DYR B;  3MD0 A;  3CCE V;  4FIP C;  2Q69 A;  2DYS B;  5H6Q A;  2WLI B;  3E35 A;  2A0L A;  2ATK C;  3OFN G;  1KKD A;  1VQ8 V;  3ML0 A;  1PL0 A;  2QM8 A;  4WFH A;  1GKF A;  2X6C A;  1PNK A;  2BOC C;  4PDM A;  1F4M A;  3F7Y C;  4JF3 A;  5L3B A;  1TUE B;  2OCC B;  1AJP A;  3ZN1 A;  4XDL A;  2W0F C;  1G8M A;  2EIK B;  3ZRS A;  4MW8 A;  1VQO V;  2WAM A;  1KD1 W;  2P6J A;  5CMU A;  4MVS A;  2W6I G;  3T1C A;  1AI7 A;  4R50 A;  3E86 A;  1S0V A;  3K04 A;  2JJ2 G;  4FK5 C;  4QE7 A;  5LHI A;  1GK9 A;  4MS2 A;  3TK1 A;  2ZDI A;  1N8R W;  4MT8 A;  5KA6 A;  1F23 A;  5L3C A;  2EIJ B;  3SPJ A;  3BY6 A;  4PA3 A;  2OT5 A;  3I56 V;  3CME V;  2DQ0 A;  2DYR C;  4TSF G;  1AI5 A;  1QCE A;  5EBL C;  2HG5 C;  2BOB C;  1OHH G;  1WLE A;  4XDJ A;  2JDI G;  4P2Z A;  3FYE B;  2XAJ A;  3ASN C;  3NXS A;  3D36 A;  1NJI W;  2HVJ C;  4UXN A;  1OCO B;  2QEX V;  1K5S A;  3CD6 V;  3CC7 V;  1BMF G;  3AEI A;  2HFE C;  1V55 B;  2XAQ A;  3RVZ A;  2EZO A;  3E8H A;  3OM3 B;  4G27 B;  2EIK C;  4PDL A;  2WLK A;  3CCQ V;  3LDC A;  1SZT A;  2B5U A;  3ABL B;  3QO7 A;  4RUF A;  3WFV A;  2NNU A;  1W0K G;  1QLN A;  4MTO A;  2QKS A;  1PNM A;  2MK3 A;  3G6E V;  2D3O W;  2ITD C;  2EIN B;  4XDK A;  1VQ4 V;  2JEX A;  5IYB O;  4PA7 A;  3FB6 C;  5B1O A;  1DLB A;  1FXK A;  4LCU C;  4QE9 A;  3D3I A;  2GHY A;  2IJI A;  2LFS A;  2IJJ A;  3E8F A;  3AG3 C;  3OEE G;  4MVQ A;  5LGN A;  2Q67 A;  3K0D A;  3LNM B;  4LC1 A;  1QVG U;  5B1B B;  3ZMU A;  1K7D A;  4RAI A;  1K8A W;  2EIM B;  5LBQ A;  4TWK A;  1YHQ V;  1M56 C;  3JD0 A;  3CCU V;  4GX2 A;  2DQ3 A;  3ETD A;  4PA9 A;  1R6N A;  3F5W C;  2OTL V;  3CC2 V;  2QE7 G;  5L3D A;  3TET A;  3IFX A;  1AJN A;  4QPJ A;  1FFT B;  3GWO A;  2ZXW B;  4U7N A;  4BIZ A;  1GM7 A;  4HYO A;  1K92 A;  4U7O A;  2YEV B;  1R3I C;  1QR8 A;  2HKO A;  3OAA G;  5IDJ A;  4P9O A;  3FKS G;  1MAB G;  3ZMS A;  1YJW V;  2IH3 C;  1UJW B;  4FJC C;  3ETG A;  2P67 A;  4E2L A;  5EK0 A;  4XBF A;  4GX1 A;  2YSU B;  4H37 A;  1VQ7 V;  4DXW A;  3K3W A;  4JTA B;  3CCL V;  5B1B C;  1SES A;  4P9P A;  3CMA V;  2IU0 A;  5LGU A;  2V1D A;  1S77 D;  3SYO A;  1AI6 A;  1VQK V;  2FTK A;  1B6Q A;  2EIM C;  1CEZ A;  3LUT B;  4MTX A;  1E79 G;  3QO8 A;  2OTJ V;  4PDV A;  4MSW C;  3B77 A;  1FXV A;  4QNH B;  2ITC C;  1W0J G;  3ASN B;  3ASO B;  3F7V C;  4OXS A;  4RUE A;  2ZXW C;  1K97 A;  3VBB A;  2B1G A;  5KA5 A;  1K33 A;  3G71 V;  1AJQ A;  4UVC A;  3B8N A;  1EBO A;  1RPR A;  3OW2 U;  3EFF K;  5GW7 A;  4MTF A;  3CCV V;  4JYC A;  3JD1 A;  3SYC A;  5EC2 C;  3ZRV A;  1COW G;  4QJF B;  2W6J G;  1QLE C;  5BZB A;  3K08 A;  3CP1 A;  3K0G A;  3ZN0 A;  4JGS A;  1K9M W;  4X89 A;  3K06 A;  1OCZ C;  2H8P C;  3CPW U;  1VQ6 V;  3M99 B;  1NBM G;  2ZD9 A;  2F43 G;  3AG1 B;  2Q6A A;  4GCZ A;  4WFB V;  2QM7 A;  1FXH A;  3QNE A;  3ZMV A;  2HLD G;  1ROP A;  5H9C A;  4CBC A;  2QA4 V;  1OZ0 A;  1R3J C;  3AG3 B;  3ABU A;  2NLJ C;  3I55 V;  3W7U A;  1VQL V;  2WLL B;  3E83 A;  5B3S C;  1XL4 A;  2EJR A;  4JAV A;  4WFE A;  4PEL A;  2HJF C;  3SPI A;  2P90 A;  3ASO C;  2UXX A;  1M56 B;  1S72 V;  3ZRW B;  3EHB B;  2KB1 A;  1KC8 W;  3SYQ A;  1P7B A;  1K34 A;  1YI2 V;  3CC4 V;  3KG2 A;  1NR1 A;  1M90 W;  2WLJ A;  1JX9 A;  3OUF A;  3JD2 A;  2XAH A;  2C2A A;  4WCE V;  4G2K A;  3DTU B;  4G28 B;  4GX5 A;  2WLI A;  1Y66 A;  1K73 W;  1K4C C;  4H33 A;  4UV8 A;  3RVY A;  1EZJ A;  2K1E A;  3AG1 C;  4MVO A;  2ZQM A;  2Z5U A;  4MVU A;  1JJ2 U;  3BEH A;  1AR1 B;  2X7R B;  4JTD B;  1M1K W;  5DM6 V;  3STL C;  4WFG A;  2XND G;  1Q82 W;  1MOF A;  1NR7 A;  3PJS K;  1MG1 A;  1ENV A;  3FB5 C;  4FPP A;  4N23 A;  3GB7 C;  3K03 A;  4TT3 G;  3W7T A;  5C93 A;  5CBG A;  2UXN A;  4PA6 A;  4BAY A;  5IY5 B;  4DO2 A;  5DN6 G;  2WLM A;  4HZ3 A;  3H01 A;  4MW3 A;  2PI4 A;  2Q68 A;  2EBO A;  1VQP V;  3T4D A;  2AHY A;  3OUS A;  2HVK C;  1W2B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...