2LFSA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer; a219f variant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
total genus 42
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfsA00
2C2AA 4Q20A 2LFSA 2QM8A 5C93A 3TK1A 4KP4A 3MD0A 4BIUA 5B1OA 4MTXA 3ZRXA 4JAUA 4MT8A 4JAVA 2LFRA 2FTKA 4GCZA 3A0RA 4LC1A 4FPPA 4U7NA 3D36A 3ZRWA 1JOYA 4JYCA 4QPKA 2QM7A 3ZRVA 1IXMA 4FMTA 4GT1A 4QPJA 3ZRWB 4JYBA 4BIZA 4ZKIA 4JASA 1F51A 2WWWA 3P32A 3ZCCA 4U7OA 5IDJA 3NXSA 5B1NA 2P67A 3DGEA 4I5SA
chains in the Genus database with same CATH superfamily
3BY6A 4LF8O 1Q7YW 3U0ZA 1NTZH 3CCLV 2YI8A 4MTXA 3B2EE 3GB7C 3ZRWA 1O9HA 1BHBA 4GYCB 2VRZA 1RP3B 1K4CC 1W0JG 2P06A 1DGSA 3SJAC 3K06A 4R7CA 2YXHA 4IYIA 1GN4A 5JQGA 2E74B 1FPOA 3SYAA 2WLMA 2HJFC 4RQFA 3CPWU 1XNRO 1Q43A 4DV4B 2JGDA 4X1IB 4CBCA 3G80A 1VF6C 2QKSA 3MHSC 1PL0A 4UCRA 5A2QN 1VF5B 2OT5A 3OTOB 3AK3A 4GX5A 4JTDB 1EN4A 4OXSA 2BOBC 1BZKA 3OUFA 4A5UB 2A79B 4J9YB 3BFRA 1I94O 4JI8B 4PA9A 2DOSA 3ZMTA 1OCCB 3CYOA 1FXHA 4FM1A 1BQZA 4QPJA 3JD4A 3ZJZA 2XAGA 3ABMC 1GKFA 5IYCO 2EINC 4QJFB 2CAZC 1ZUQA 4UV9A 5EC2C 4GKJO 1AJPA 3SYOA 3ZMZA 3ZMUA 4LCUC 2YIBA 4YJ3B 4BW9A 2E3CA 3E35A 3MD0A 2RMKB 5L3GA 1FAFA 3W7UA 1QNMA 2VQEB 1F4NA 2YXLA 5EIBD 3F7YC 2PZSA 3JATA 3T1YO 4FMTA 5KHHA 4NB5A 4DV0B 1COWG 4DR4O 2XAQA 3UCSC 3OGIB 5FPRA 1RM1C 3B09A 1XNQO 5BR8B 2HKOA 5A9GA 2EZOA 4ZOLB 4IYHA 2F4VO 4JPRA 3WFVA 1OCOB 3RWRD 3SGIA 2IJHA 3CP1A 4MW8A 5J2UB 2UUCO 1KC8W 3H01A 2DWDC 2LFRA 3P3NA 3M7MX 5C8YB 4ZIBA 5JJNB 3OMNB 4X66B 1BMFG 3RYIA 5H9CA 1EM1A 1AI5A 5LGNA 1I5YA 4LFCO 4I4TA 1SQBH 1IBLO 2QM7A 1B3QA 1AVMA 4U3JB 1VARA 2XAJA 3G6BA 3BAAA 2ZM6O 4HNAB 3DGEA 2R9AA 2DYRC 1IZ3A 3HKCB 4FJCC 4RUEA 5EYPB 1TGOA 1IBMB 1DTOA 2UXBO 3E22B 2Q67A 3JAWA 4NXNB 4GUNA 1J5EO 1MG1A 2ZE6A 1YJ9V 1IXBA 1TUBB 5CMUA 2OYQA 1N0JA 2XT9A 2AZ0A 2Q0OC 4EB6B 1SA0A 2P4VA 1N36O 3LSUA 5CN0A 3N2GB 5LXTB 5FNVB 2IJIA 4O2BB 5DN6G 5IYDO 2WLJA 3LSQA 4YY3O 4LFBB 4GX1A 1V55C 1S5LZ 4PA3A 4MTFA 3ZIAG 4O2AB 1XNRB 3K5OA 5FPOA 3RYFA 2ZE8A 2WLIA 1YJNV 3I55V 1HNZO 5BMVA 5CBHA 1BSMA 2CH7B 4TT3G 5CA1B 1BT8A 1FXKC 4X65O 3K08A 3LDEA 3J81N 5CA0A 3F5WC 2MW2B 1K8AW 4JZ2A 4MVSA 2KG7B 5EIBC 1BGYH 5D5QA 2DYSB 2EIJB 2NR5A 2IW5A 3HKEA 3ZN1A 1NJIW 4P30A 1Q82W 4DR7O 1EN5A 4UFZA 2CTWA 3HKDA 1SQXH 3ML0A 3CX5F 4GLXA 4YJ2A 1RSOB 3ZHTA 4IIJA 5L3BA 1M9NA 4PELA 4OPHA 1JFFA 5LHIA 1S0VA 2YEVB 1AILA 3JSNA 2YS8A 5BZBA 1N32B 5CB4B 5KAFZ 3BVOA 3SPCA 4X20B 4X1YB 1Y74B 5KAIZ 3T1YB 4PDMA 4CC5A 4JAUA 4MT8A 4DR4B 3L9DA 4DR6O 5GONA 4I50A 2ZDIC 4P9OA 1K5SA 2HLDG 4DUZB 4JI5B 3F7VC 1BE3H 3JD0A 4TQDA 2Q0AA 3IFXA 4XDKA 4LF7O 2Q9LA 2EIMC 3D3QA 1AROP 3WU2Z 4MVUA 3TJTA 4XDLA 3P30A 3W7TA 1VQNV 1M56C 3OEEG 1Z5WA 4YXWG 4LFCB 4JTAB 2P22C 1JJ2U 2EZPA 1H2KA 4X1KB 2RJZA 1IBLB 1NKDA 4JYYA 5B1OA 1THZA 3OEHG 4BW5A 2A06H 4DR5O 2FB5A 1VQ4V 5KMGB 4GX2A 1V54C 2ZM6B 5LMNO 3QTCA 4CH5A 5EZYA 4YHHO 4TWKA 4UB8Z 1K5QA 1ZLZA 5KX5B 1FYJA 5B1AB 2QWOB 5FLXN 3IC7A 2RNBA 2YSUB 5IYZA 3EXAA 1KUQA 1S3JA 4OGQB 4PI0A 4KL1A 3ZHUA 3N2KB 3CD6V 4DR2O 1R3LC 1U96A 4AHCA 3ETEA 1BQ0A 3UKMA 1N36B 1KU9A 4NKGB 2A9HA 3B8NA 4G2KA 3ZMVA 4DV5B 1D5AA 3RVYA 1SZXA 1H8EG 4WF9V 5B1BB 4I0XA 3G67A 4BIOA 2QM8A 3TXQA 1YI2V 1H2LA 3CS5A 1R1BA 2QE7G 2EIKC 4X64O 1QHTA 4BR6A 1MZFA 3AG3C 3I56V 2H94A 3A0BZ 1HNZB 1MSDA 3ABUA 3C3SA 5ITZA 1SZTA 1NS1A 2BTQA 1NZ6A 4UCSA 5TISZ 5IDJA 4LBEC 3EVKA 1VP7A 1PP9H 4FFBB 3RYCA 5IJ0A 1IDSA 3RFRA 3OAAG 4J41A 5FL7G 5HFMA 5LHHA 4K0KO 2WLNA 3L70H 1VF6A 3UT5B 1Q81W 4DR1O 2WLKA 4G28B 3WG7C 4WFAV 2UXXA 3FFQA 4KFMA 1GO3F 3OTFA 2Q8VA 2DN9A 1S5HC 1SQPH 1K92A 4CZZA 2L35A 3ZHQA 2CDYA 1H2SB 1SERA 3DTUB 4UVAA 3OTOO 2UXCO 1AP6A 4E2LA 2PF4E 5L3FA 3SJQC 2QKCA 2V7QG 4ZHQB 4DV6B 1EN6A 4B08A 5GTHZ 2ITCC 2IH3C 1AI4A 4HZ3A 3T4DA 4LWSB 2ZNJA 2X0LA 1VQ8V 4JAAA 5EK0A 4JV5B 1X59A 1YXBA 3HKCA 4DR6B 1HNXO 3K5MA 4MTGA 3AG1C 1VIBA 3SR2C 4WFGA 4CS2A 4F6RB 4B3MB 3BPZA 2WAMA 2QWPB 1VQ5V 3OW2U 1R3KC 2QM4A 5L3DA 2H3OA 2VQEO 2XASA 3CHXA 2LW7A 1AB3A 3BEHA 1YTFB 2C2AA 1D5NA 2CK3G 2A7WA 4B3RO 4RO2A 2VWJA 1B06A 4DV2B 3OMAB 4PDRA 2XHBA 2BSKB 2JS3A 3WG7B 4QPKA 4JGSA 3CJHA 2Y4UA 4B7EA 1ZAUA 3K58A 3A0HZ 3K5NA 1K33A 4TQFA 4DR5B 4X66O 4QE7A 3DXRB 5LMNB 1KMIZ 5KHKA 5KA5A 1PNKA 4U7NA 1XBLA 1S72V 3S3WA 3AG4B 3HKBB 3JD1A 4TV8A 4K8XA 2HVJC 2RCVA 1FFXA 5KHGA 1R3IC 1LR1A 3CCQV 4DV7O 4PV1B 3ZRSA 2AGAA 1F23A 1FD9A 2NNUA 1ZX3A 2UU9O 4WBNB 4D7SA 1WB7A 1OCCC 2ILMA 1YHQV 5LHGA 2EBOA 1I08A 4X62O 4I9WA 5BXZA 1GM9A 2YEVA 4DR3B 1IBMO 4JI2B 3VQYA 4ZKIA 3LNMB 1LNQA 1XQ8A 4HAMA 1NVPB 2DW4A 4X20A 2YDEA 4O4JB 4X64B 4O4LA 3ABTA 2GUZA 1GM7A 3I5DA 4ZI7B 1OJHA 3AG2B 4TUYB 2N04A 1OV9A 4FLTA 4MVZA 4R8CA 3G6EV 2HR3A 2KSDA 3STLC 1JOYA 1CP9A 1JX9A 3C3TA 3IC9A 4K0KB 2IH1C 4DXWA 1FXKA 3ZN0A 4LFBO 4DR1B 3BRCA 3Q4HB 3JALA 2GDSA 3JAKB 1OCOC 3AK2A 1OCRC 2Q73A 1BL8A 4JI6O 4NTXA 1SRYA 2L6LA 5IYBO 4DO2A 2EILB 3JARB 2IBZH 4DK0A 2AXTZ 4FZ1A 2UXCB 3JD2A 4L87A 1P7GA 2P67A 4WFHA 1M57B 4RUFA 3OR7C 3BCCH 4RQEA 1QLNA 3O9OA 2Y4TA 4CH6A 5CA3A 3THOA 3QO7A 2M6YA 1HNXB 2A0LA 3K59A 2AHZA 2WA4A 2IJKA 1NT2B 2W0FC 3K03A 4IHJB 4W4KA 2JJ1G 2GTSA 3R66A 3ABLB 2Q69A 3K0GA 1KD1W 2PYJA 1N32O 2ZDIA 3T1HO 1N34B 3IAYA 3E2EA 5JH7A 1LUWA 3ZHVA 3JYCA 2FL4A 4B3RB 2A3QA 4DUZO 1H38A 3UO2A 4JI5O 2ZT9B 1P7BA 3OE7G 3A2FA 1WA8A 1WAZA 2ZR2A 2P90A 1GMGA 1OCRB 3K9SA 3RT3C 1URFA 4LNUA 3EHBB 3CXHF 3T2MA 1L1FA 2JGUA 1XUQA 1L8DA 2Z0AA 5IJ9A 1H2GA 4HBNA 1AJQA 1ROPA 1DF4A 2ODMA 3CCUV 4DYLA 4RWUA 3CCRV 1CPYA 3CCMV 4DV7B 3FAVB 4B3TO 3VQVA 3STZC 5L3CA 2DYSC 4OX9O 1QVFU 2EIJC 1WNSA 4ABMA 3CRAA 2UU9B 4ASUG 4J10A 3ASNB 3T1CA 4X62B 4JI3B 1R6NA 2YIDA 4JAVA 2QSAA 1Y76B 3CB2A 4EKWA 3B8MA 4X88A 4O4HA 5LYJB 2B1IA 3D36C 1FJGB 4FM2A 4WCEV 4AQYB 2UUBO 4DV3B 1MABG 2QWNB 5EBWC 3W7SA 4ICGA 1I0HA 2WA3A 1G1XB 2LO1A 2QWRB 4NYKA 4DV5O 2ZINA 2CGNA 2BTOA 5KHJA 1Q6IA 3JSLA 3L75H 3AK1A 2XAFA 2FKXA 3AG7A 3OM3B 1HNWB 2CTPA 4FLVA 5LP6B 3U11A 4JI1O 4JI6B 1Y6XA 3CCJV 1Z2GA 5EBMC 2YUAA 4I7ZB 5KHIA 4DRXA 4GCZA 4Q6GA 3ETDA 2DQ3A 4O4IA 3OUSA 3H1JH 1W59A 3DXRA 1K73W 4J7KA 1QBZA 3WB1A 4J42A 2LGQA 4B7KA 1HDJA 3E8FA 4BIUA 3UM7A 2WLLB 4FZ0A 5IWAO 4LC1A 1TUEB 1FXVA 3ETGA 2X6AA 1KYOF 5LMUO 4QE9A 4Z1VA 1YTFD 1VQ6V 4MSWC 1KKCA 3ETQA 1ZL8B 4DV6O 4X89A 1QVGU 5LBQA 3JASA 4I55A 5JVDA 3T1HB 4GKKO 5B1AC 3CE2A 4LFAB 4JV5O 2F23A 3CMAV 2JIZG 5LA6B 1CXZB 2GV9A 5LOVA 3S3XA 2QGNA 2LP7A 3CSXA 4O4JA 4TV9A 4B3MO 2Q68A 3FX7A 5B1BC 3F5TA 2F95B 1XEQA 1SKVA 3L71H 3R65A 3K0DA 5B3SC 1WP8A 4KXRA 3ZRWB 5EC1C 4JYBA 4NTWA 2ZCEA 1WPXA 4X8AA 4DV2O 1TA8A 2ZKOA 1N33O 3Q4HA 4H0LB 1XREA 2QDOA 3PN1A 3ZS8C 5JQGB 1F4MA 1XI1A 3GVMA 4K35A 4X1IA 4B3SO 1BS3A 3O65A 4B3TB 1G8MA 2JGDB 3RYHB 1GN6A 3KKYA 3CMEV 3A0RA 1XILA 4FLUA 3QVNA 1NVPD 4OX9B 3FB5C 5H6QA 3FYEB 2Q6AA 2HG5C 4NTYA 5DECA 1JPXA 2NLJC 1GRJA 2XTAA 1IURA 3BA9A 3X2QB 1NU1H 2HFEC 5JCOC 3E89A 2CUGA 3MAQA 3J80N 1YEWA 2UUBB 3KCXA 1KP3A 1PNMA 3CC7V 3CCSV 2F93B 2XNDG 4MVRA 5B1NA 4YJ3A 3A8TA 4DR3O 3RW0A 4JI2O 2E5LO 1NR1A 2Y69B 1VQPV 1VQLV 2YI9A 3P3PA 1ZTEA 1GK9A 2R70A 1YIJV 2ZIMA 3L73H 2X6CA 5KUKA 5B3SB 4JI1B 2YICA 3JATB 3VBBA 1GN3A 1UJWB 2IU0A 2WPDG 4ZOLA 4FLZA 1SETA 2B9ZA 5J2UA 3SYCA 3G4SV 1XL4A 1PPJH 2HVKC 3N27A 5C8YA 1H2MA 1DK1A 3ZX6A 2OWOA 3UO3A 2PY5A 1F51A 2ZXWB 1TAEA 3CC2V 1D2DA 1PL4A 5IWAB 3ASOB 3RYIB 1IBKB 1I7FA 3H1KH 4YIPA 2WLHA 1MZEA 4J80A 5LMUB 3ICXA 2IM9A 4KUMA 2X6BA 4I4TB 4IL6Z 4E4EA 4U3JA 1XDCA 4MW3A 3AG4C 3K9AA 2F1MA 1OZ0A 1HWYA 3TXSA 4JI0B 4GKKB 1MNGA 4HNAA 2E76B 5LGUA 5EYPA 4LF6O 3ZHRA 4U3FH 1U97A 3E22A 3ZRXA 3RVZA 4UCTA 2FMLA 3EFFK 4CS3A 4I9QA 4Z1MG 1VF7A 5BY1A 4NXMB 2VS0A 3SPIA 3JAWB 1ZSPA 5DEDA 1ENVA 3QF7A 4BWAA 4JYAB 1TUBA 2QJ1A 1N34O 3FB6C 4J7JA 4EB6A 5H6RA 1M90W 2PGGA 3N2GA 5LXTA 2JEUA 5FNVA 4MVMA 3KG2A 3AG2C 1SA0B 4O2BA 2ZE5A 2R9IA 3SPGA 4LH7A 5B66Z 1DF5A 3RBZA 4F4LA 1N33B 1F7YA 5HFLA 1P4RA 4O2AA 4IT5A 1N8RW 1KP2A 3E83A 3FYIB 1K4DC 3TCUA 2CH7A 4CH3A 5CA1A 4B3SB 1DLBA 1K34A 5H5NA 3RYFB 2WLIB 2PYLA 1RPOA 4TOIA 5JWPA 5BMVB 1UPGA 4CH4A 1RPRA 3APQA 4N23A 1PV0A 2W6JG 2ZE7A 2JK5C 2D3OW 5J2TB 4FLYA 5CA0B 5L3EA 4DUYO 1M4UA 2UXDB 2Y0PA 2EILC 2VQFB 2KG7A 4R50A 3QG5A 3K79A 3M99B 1NH2B 2Q7EA 4U7OA 1R6TA 3HR0A 5F2VO 1M57C 1SQFA 2WLLA 4LF4O 3HPLC 3HKDB 5GW7A 1RSOA 4JTCB 1SQVH 4D6TH 4YJ2B 3D36A 4JI3O 1BCCH 1VQ7V 2Q4PA 2E5LB 1L0LH 4JI4O 3ABKB 3E8HA 5CB4A 2W6IG 3LSSA 4X1YA 1Y74A 1FJGO 1UFIA 3APOA 5IT9N 3ABLC 2QA4V 4AQYO 4DV3O 5IE9A 3CWBH 5KUMA 3DSQA 5GONB 4I50B 4W4LA 1Q6UA 1VMGA 1WN7A 3P32A 2Z3YA 1WJZA 2AHYA 1QCEA 2F66C 2ZR3A 1HNWO 1H2NA 1TVKB 3SJBC 2LFSA 4LR3A 3HB3B 2CTQA 2ZQMA 4J11A 5K1XA 2GSMB 2EULA 4JZGA 3JD3A 4JYCA 1VQMV 2PUSA 4EFBA 1O9GA 4FFKA 4X1KA 4UXNA 1Q8IA 2OTLV 3RYHA 2YIAA 1M1KW 2JDIG 5KMGA 2CE4A 1EFRG 1R3JC 4G27B 1K9MW 2ATKC 3BHPA 1WLEA 3BABA 2GTAA 3SYQA 1US6A 4PA4A 5EZYB 4LF6B 3ZMSA 4PA7A 5KX5A 2DE0X 3SPHA 1P49A 3ASNC 2F43G 4NR1A 2E75B 3N2KA 5IYZB 5GTIZ 4F6EA 4LFAO 4H37A 3K3WA 2OCCB 2HHHO 2OTJV 2WWWA 3CRQA 1VQ9V 1JCHA 1NQTA 2QR4A 4JI7B 2P7TC 2P5OA 5IY5B 4MVOA 5AG2A 1BHAA 4I0XB 3JAMN 3H1LH 2BOCC 1S76D 1YZBA 1KB9F 4WFEA 4PD4F 3NR7A 3IGAC 1JQ0A 5ITZB 2BTQB 3QO5A 3RN4A 4MVQA 1ZWIC 4QGPA 2YXYA 5LP6C 4NVPA 4FFBA 2Q5ZA 4DUYB 5LL6Y 3C90A 2IU3A 1SQQH 3RYCB 5IJ0B 3RGBA 3UT5A 4MTOA 3ZBHA 3CRCA 4KHPO 4FLXA 2PI4A 1KECA 1OCZC 4FLWA 2N74A 4LF4B 1AR1B 5JJEB 2YIBD 4LH6A 2W0XA 1EBOA 4K8ZA 5C93A 3PJSK 5JCOA 4ZHQA 1YVWA 4JI4B 1I5XA 2ZD9A 1NTKH 4LWSA 4OPAA 3U10A 1E79G 5J9PC 1SQGA 4UVCA 3ABMB 1JVMA 1GH6A 2EINB 3H1IH 4R6ZA 2XAHA 2ADQB 2BCCH 3CCVV 4Z2WA 3LDCA 3E8GA 1WPBA 5E79Z 4KP4A 4F6RA 4LF5O 1Z5VA 1CEZA 2JEXA 4EFEA 4FPPA 3ZHSA 4DW0A 1IXMA 2OIGA 2AW9A 4LF8B 1MSWD 2QTOA 4UB6Z 1VEWA 2P6JA 2DWEC 2Z5UA 1RM1B 3SDLA 2PI5A 2QTSA 4DW1A 1T5EA 1NBMG 4QIWF 3SJCC 2Q7GA 2KQXA 5EBLC 5JJJB 1N0NA 2BSKA 1LUVA 1HW7A 2VWKA 2CTRA 1OCZB 4TSFG 1JA8A 3DC5A 2CGOA 3CJHB 3B77A 4DV1O 2HP8A 4N21A 1PD3A 4UCVA 4H13B 1XMOO 4MS2A 5J2TA 1HP8A 4P2ZA 2ZIOA 3TK1A 3FB8C 1Q90D 3VQWA 2JJ2G 1IBKO 3HKBA 4J7ZA 3E8BA 4PI2A 1EZVH 5KLVH 3B40A 1A32A 1M5IA 3TETA 3LNNA 4TV8B 1I94B 2ADPA 1FFXB 3FKSG 3X2QC 4JI0O 2DYRB 4LF9O 1YJWV 4WBNA 2XOKG 2DJVA 2LQTA 5D5PA 3UQ8A 3LUTB 2HHHB 1FFTB 3SYPA 4GKJB 4IGGA 2KKWA 1V9PA 2GHYA 2MK3A 1YDXA 2R72A 2JS5A 1S77D 1WB8A 1KKDA 2OCHA 1FKAO 3ZEDA 4D7TA 2IJJA 4UCUA 3KZIZ 1RFYA 2R9RB 3TGUH 4NXMO 4P9PA 4UCOA 4JYAO 2QKAA 3D3IA 4ZI7A 4O4LB 1YITV 2B5UA 4TUYA 2Y69C 2GUZB 2BE3A 1MMMA 1QR8A 1NH2D 1XNQB 4PDLA 2LJ2A 1B04A 1NR7A 1AI6A 3CEIA 1V55B 3IJ4A 4AILC 1FS0G 1YSCA 3CCEV 4JASA 2F4VB 2V1DA 2P4KA 2B1GA 2V4DA 2UUCB 1AP5A 1TVKA 3L74H 1Q86W 4KHPB 1NTMH 4AI8A 1FXKB 3JAKA 1JR9A 3GWKC 3W7WA 3JALB 4UUJC 2FTKA 2K9PA 1SESA 1Y66A 4XBFA 3K5LA 2RDCA 3JARA 3OGCC 3ZRVA 1H8HG 2UUAO 2LGWA 1GN2A 1IVSA 2ZXWC 1JMKC 2UXDO 1GTOA 1J95A 3ASOC 4CS4A 2VQFO 3LDDA 3SPJA 3K04A 4UVBA 1G6UA 5H2FZ 5E1AC 1QQCA 5CBFA 1PKXA 5B5EZ 1AJNA 1PNLA 3M8AA 2M7WA 4FM0A 3CXCU 4IHJA 4LF5B 1VQOV 2UXBB 2Y48A 1W2BU 5LGTA 1XMQO 1J5EB 3JCZA 2RN9A 2Y0IA 4PA6A 2G38A 3OFNG 3WB2A 3FD9A 4BAYA 1HR0O 5JH7B 1Y4MA 2X7RB 1XHXA 2Q7HA 4LP8A 2N05A 1KBHA 3D8CA 2UXNA 4ZBMA 1IX9A 3MHHC 4YY3B 3KCYA 2EIMB 4EEQA 3OR6C 4WFFA 4PDVA 1WA8B 4DV1B 4GZRB 4RAIA 1MOFA 1XMOB 4GT1A 4BIZA 4X65B 1M56B 4LNUB 3FB7C 2XUMA 1WP7A 3CC4V 3VOUA 4JF3A 5IJ9B 4YIOA 1QU7A 3DC6A 1E1QG 3FAVA 3CRRA 1V54B 5KA6A 4DV4O 3T4ZA 4DR7B 2ITDC 4L8JA 4HYOA 1YCIA 4LF9B 4CC6A 1XOUA 2WSSG 2QEXV 4J9ZB 3WB0A 4H44B 1B6QA 1SF9A 1EZJA 4Q20A 3QO8A 1SS3A 4X9QA 1N4CA 1Y76A 4FIPC 4UV8A 2JRIA 5LYJA 2D2CB 1R6KA 1MA1A 4O4HB 4JI8O 1QLEC 2OIEA 4H33A 2ZNIA 3ABKC 2YC0A 1GM8A 3AEIA 1R73A 1Q5OA 3GWOA 3MDSA 1GAXA 2GBOA 3H9VA 1AR4A 2DQ0A 4K3AA 3W7XA 3OD4A 4WFBV 2EIKB 4JI7O 3AG3B 1W0KG 1KQSU 4FVMA 2QWQB 1PM9A 4LF7B 1OHHG 4FK5C 1JJOA 3B4SA 2KB1A 5LP6A 1ORQC 3BA8A 4QNHB 2LW1A 4DV0O 4I5SA 2EJRA 5DM6V 4XDJA 3QNEA 1K97A 5BR8O 3VQXA 2FYUH 2UUAB 1VQKV 1AI7A 1K7DA 4DRXB 3JCUZ 2ETNA 1X4TA 4O4IB 4GX0A 2HJDA 3OMIB 2H8PC 3NXSA 1L0NH 2PTMA 2EX3A 2NN4A 3HKEB 2O57A 1XL6A 2ARHA 2HEPA 2RQ6A 3G71V 1Q3EA 4YHHB 1XHZA 4DK1A 1M93A 1QR9A 4PHZA 3K57A 1E1RG 1ZL8A 4IIJB 1S5JA 1Y67A 1QLEB 3J7AU 1XMQB 3ZCCA 1JFFB 1YF2A 2AZ2A 2EJ7A 1G4YB 3JASB 3L72H 3OT7A 4I55B 4DR2B 3H1HH 5JVDB 4C7UA 3E86A 3AG1B 5K1PA 3CRMA 2DMXA 5LA6A 1HR0B 1AR5A 1NI8A 4PJ0Z 1SC5B 2K1EA 2JVDA 2OCCC 5CBGA 5LOVB 1P84F 1Q6HA 1K3EA 4NXNO 4TV9B 5IY5C
chains in the Genus database with same CATH topology
3BY6A 1Q7YW 5C93A 4E2LA 3PJSK 3CCLV 5L3FA 4MTXA 3SJQC 2V7QG 3R65A 1I5XA 2ZD9A 3GB7C 3K0DA 3ZRWA 1BHBA 1E79G 5B3SC 2ITCC 2IH3C 1AI4A 4HZ3A 3T4DA 5J9PC 3ZRWB 5EC1C 4UVCA 1K4CC 1W0JG 4JYBA 1WPXA 2X0LA 1VQ8V 3ABMB 4X8AA 1JVMA 2EINB 3K06A 4R7CA 5EK0A 4R6ZA 2XAHA 3CCVV 3SYAA 2WLMA 1F4MA 2HJFC 3LDCA 4RQFA 3E8GA 3CPWU 4MTGA 4KP4A 3AG1C 4CBCA 4WFGA 1G8MA 2QKSA 1CEZA 3CMEV 3MHSC 1PL0A 3A0RA 2JEXA 4FPPA 1NVPD 2OT5A 2WAMA 1VQ5V 1IXMA 3FB5C 3OW2U 4GX5A 5H6QA 3FYEB 4JTDB 1MSWD 1R3KC 2HG5C 2Q6AA 5L3DA 2QTOA 2P6JA 2DWEC 2Z5UA 1RM1B 1JPXA 2XASA 2PI5A 4OXSA 2BOBC 2NLJC 3OUFA 3BEHA 1NBMG 1YTFB 2C2AA 4QIWF 2A79B 2CK3G 5EBLC 3X2QB 4J9YB 4RO2A 2HFEC 4PA9A 3E89A 3OMAB 4PDRA 3ZMTA 1OCCB 3CYOA 3WG7B 1FXHA 4QPKA 1KP3A 4JGSA 4QPJA 3JD4A 4TSFG 1OCZB 3ZJZA 2XAGA 3ABMC 1PNMA 3B77A 1GKFA 5IYCO 2EINC 3CC7V 3CCSV 4QJFB 2XNDG 4N21A 4MVRA 4UV9A 1PD3A 1K33A 5EC2C 5B1NA 1AJPA 4MS2A 3SYOA 3ZMZA 3RW0A 3ZMUA 4LCUC 1NR1A 4QE7A 4P2ZA 3TK1A 3E35A 3MD0A 2Y69B 3FB8C 1VQPV 5L3GA 3W7UA 1VQLV 2JJ2G 1F4NA 1PNKA 5KA5A 3F7YC 4U7NA 1S72V 1YIJV 1GK9A 2X6CA 3AG4B 3E8BA 3JD1A 5KUKA 4FMTA 5B3SB 3VBBA 1COWG 2XAQA 3TETA 2HVJC 1UJWB 1RM1C 2HKOA 1R3IC 3CCQV 2IU0A 2WPDG 2EZOA 3ZRSA 1SETA 3FKSG 3X2QC 2DYRB 4JPRA 1F23A 3WFVA 1YJWV 1OCOB 3SYCA 2NNUA 2XOKG 2IJHA 3G4SV 1XL4A 3CP1A 2HVKC 4MW8A 1KC8W 3H01A 3LUTB 2DWDC 2LFRA 1OCCC 1YHQV 5LHGA 1FFTB 2EBOA 3SYPA 4I9WA 3OMNB 1GM9A 2GHYA 2YEVA 2MK3A 4ZKIA 3LNMB 1LNQA 1S77D 1KKDA 1F51A 4HAMA 2ZXWB 1NVPB 2DW4A 1BMFG 2IJJA 3CC2V 5H9CA 2R9RB 3ASOB 1AI5A 3ABTA 4P9PA 3D3IA 5LGNA 1YITV 1I5YA 1GM7A 2B5UA 2Y69C 2WLHA 3AG2B 4KUMA 1QR8A 2X6BA 1NH2D 4MVZA 4PDLA 4R8CA 3G6EV 2HR3A 3STLC 1JOYA 1CP9A 1JX9A 1NR7A 3AG4C 3K9AA 1AI6A 4MW3A 2QM7A 1V55B 1OZ0A 2XAJA 1FS0G 1YSCA 1HWYA 3CCEV 4JASA 2V1DA 2B1GA 2IH1C 4DXWA 1Q86W 1FXKA 3ZN0A 3DGEA 1FXKB 5LGUA 2DYRC 3W7WA 1OCOC 4FJCC 4RUEA 1DTOA 4UUJC 3ZRXA 1OCRC 3RVZA 1BL8A 2FTKA 1SESA 1Y66A 3EFFK 4XBFA 2Q67A 4Z1MG 1SRYA 3OGCC 5IYBO 3SPIA 4DO2A 3ZRVA 2EILB 1ENVA 1H8HG 1MG1A 2ZXWC 3JD2A 4L87A 1YJ9V 5CMUA 1GTOA 3FB6C 1J95A 3ASOC 5H6RA 2P67A 1M90W 3LDDA 4WFHA 1M57B 3SPJA 4RUFA 2JEUA 4MVMA 3K04A 3KG2A 3OR7C 5CN0A 3AG2C 4UVBA 4RQEA 2IJIA 2R9IA 5E1AC 3SPGA 1QLNA 5DN6G 5IYDO 2WLJA 1DF5A 5CBFA 3RBZA 1PKXA 4F4LA 3LSQA 5CA3A 4GX1A 1V55C 5HFLA 1P4RA 1AJNA 3QO7A 1PNLA 4PA3A 4MTFA 2A0LA 2M7WA 3ZIAG 1N8RW 1KP2A 3CXCU 2AHZA 3E83A 1K4DC 3FYIB 3TCUA 2WLIA 1YJNV 3I55V 1DLBA 2IJKA 1K34A 5CBHA 2W0FC 1VQOV 2Y48A 2WLIB 3K03A 4TT3G 1RPOA 1FXKC 1RPRA 1W2BU 3K08A 2JJ1G 3LDEA 5LGTA 4N23A 2W6JG 2D3OW 2JK5C 3ABLB 2Q69A 3K0GA 1KD1W 3F5WC 3JCZA 5L3EA 2ZDIA 4PA6A 3OFNG 3E2EA 2EILC 1K8AW 4R50A 3K79A 4MVSA 3M99B 4BAYA 1NH2B 3JYCA 1Y4MA 2X7RB 2DYSB 4U7OA 2EIJB 4LP8A 2IW5A 3ZN1A 1NJIW 4P30A 1Q82W 2UXNA 4ZBMA 1M57C 1H38A 3MHHC 1P7BA 3OE7G 2WLLA 3ML0A 3HPLC 5GW7A 2EIMB 4JTCB 3OR6C 4WFFA 2ZR2A 4PDVA 2P90A 1GMGA 1OCRB 4RAIA 1MOFA 3D36A 5L3BA 1M9NA 4GT1A 4PELA 4BIZA 1M56B 1VQ7V 3EHBB 5LHIA 1S0VA 2YEVB 3ABKB 3T2MA 3E8HA 5BZBA 2W6IG 3FB7C 3LSSA 1L1FA 3CC4V 3SPCA 3VOUA 4JF3A 1H2GA 1AJQA 3ABLC 2QA4V 4PDMA 1ROPA 1DF4A 3CCUV 4JAUA 3CCRV 4MT8A 5KUMA 1E1QG 2ZDIC 1CPYA 1V54B 3CCMV 5KA6A 4P9OA 1K5SA 3T4ZA 2HLDG 3F7VC 3STZC 2ITDC 5L3CA 4HYOA 2DYSC 3P32A 2Z3YA 2EIJC 1QVFU 3JD0A 2AHYA 2WSSG 4ASUG 2QEXV 4J9ZB 3IFXA 1QCEA 2ZR3A 3ASNB 4XDKA 1B6QA 3T1CA 1EZJA 4Q20A 2LFSA 1R6NA 3HB3B 2EIMC 2ZQMA 3QO8A 1AROP 4FIPC 4UV8A 4MVUA 4JAVA 2GSMB 4EKWA 3B8MA 4X88A 1R6KA 3JD3A 2B1IA 4JYCA 4XDLA 1VQMV 3P30A 3W7TA 1VQNV 1M56C 3OEEG 1QLEC 4H33A 4WCEV 3ABKC 4YXWG 1MABG 1GM8A 4UXNA 5EBWC 4JTAB 3W7SA 1JJ2U 2EZPA 3AEIA 2OTLV 1R73A 3GWOA 1NKDA 1M1KW 1THZA 2DQ0A 3OEHG 5B1OA 4BW5A 3W7XA 2JDIG 4WFBV 1EFRG 1R3JC 4G27B 2EIKB 1VQ4V 4GX2A 1K9MW 1V54C 3AG3B 2XAFA 1W0KG 2ATKC 1KQSU 3OM3B 1WLEA 3SYQA 1OHHG 4FK5C 4PA4A 2KB1A 4TWKA 3ZMSA 1ORQC 4PA7A 3SPHA 1K5QA 4QNHB 3ASNC 4I5SA 2EJRA 5DM6V 4XDJA 3CCJV 5B1AB 5EBMC 2F43G 3QNEA 1K97A 3IC7A 2YSUB 1S3JA 1VQKV 4GCZA 1AI7A 1K7DA 3CD6V 3ETDA 2DQ3A 1R3LC 4H37A 3OUSA 3K3WA 4GX0A 3ETEA 2OCCB 3UKMA 2OTJV 3OMIB 2H8PC 2WWWA 1VQ9V 2A9HA 3B8NA 4G2KA 3ZMVA 1JCHA 1NQTA 3NXSA 3RVYA 1K73W 1H8EG 2P7TC 4WF9V 5B1BB 5IY5B 4MVOA 1XL6A 2QM8A 1BHAA 1QBZA 3G71V 1YI2V 3E8FA 4BIUA 3UM7A 2QE7G 2WLLB 2EIKC 4LC1A 2BOCC 3AG3C 3I56V 2H94A 1S76D 1TUEB 1FXVA 4WFEA 3ETGA 2X6AA 3ABUA 1QR9A 4QE9A 1E1RG 3IGAC 1YTFD 1SZTA 1VQ6V 1JQ0A 4MSWC 1QLEB 3QO5A 4X89A 4MVQA 3ZCCA 1ZWIC 5IDJA 1QVGU 5LBQA 4LBEC 1G4YB 2IU3A 5B1AC 3E86A 3OAAG 5FL7G 5HFMA 5LHHA 2WLNA 3AG1B 4MTOA 1Q81W 2PI4A 2WLKA 4G28B 3CMAV 2JIZG 3WG7C 4WFAV 2UXXA 1KECA 1OCZC 4KFMA 1GO3F 2K1EA 2OCCC 2LP7A 1S5HC 5CBGA 1AR1B 1K3EA 2Q68A 1K92A 4CZZA 1SERA 3DTUB 4UVAA 5B1BC 1EBOA 5IY5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  4Q20 A;  2LFS A;  2QM8 A;  5C93 A;  3TK1 A;  4KP4 A;  3MD0 A;  4BIU A;  5B1O A;  4MTX A;  3ZRX A;  4JAU A;  4MT8 A;  4JAV A;  2LFR A;  2FTK A;  4GCZ A;  3A0R A;  4LC1 A;  4FPP A;  4U7N A;  3D36 A;  3ZRW A;  1JOY A;  4JYC A;  4QPK A;  2QM7 A;  3ZRV A;  1IXM A;  4FMT A;  4GT1 A;  4QPJ A;  3ZRW B;  4JYB A;  4BIZ A;  4ZKI A;  4JAS A;  1F51 A;  2WWW A;  3P32 A;  3ZCC A;  4U7O A;  5IDJ A;  3NXS A;  5B1N A;  2P67 A;  3DGE A;  4I5S A; 
#chains in the Genus database with same CATH topology
 3BY6 A;  4LF8 O;  1Q7Y W;  3U0Z A;  1NTZ H;  3CCL V;  2YI8 A;  4MTX A;  3B2E E;  3GB7 C;  3ZRW A;  1O9H A;  1BHB A;  4GYC B;  2VRZ A;  1RP3 B;  1K4C C;  1W0J G;  2P06 A;  1DGS A;  3SJA C;  3K06 A;  4R7C A;  2YXH A;  4IYI A;  1GN4 A;  5JQG A;  2E74 B;  1FPO A;  3SYA A;  2WLM A;  2HJF C;  4RQF A;  3CPW U;  1XNR O;  1Q43 A;  4DV4 B;  2JGD A;  4X1I B;  4CBC A;  3G80 A;  1VF6 C;  2QKS A;  3MHS C;  1PL0 A;  4UCR A;  5A2Q N;  1VF5 B;  2OT5 A;  3OTO B;  3AK3 A;  4GX5 A;  4JTD B;  1EN4 A;  4OXS A;  2BOB C;  1BZK A;  3OUF A;  4A5U B;  2A79 B;  4J9Y B;  3BFR A;  1I94 O;  4JI8 B;  4PA9 A;  2DOS A;  3ZMT A;  1OCC B;  3CYO A;  1FXH A;  4FM1 A;  1BQZ A;  4QPJ A;  3JD4 A;  3ZJZ A;  2XAG A;  3ABM C;  1GKF A;  5IYC O;  2EIN C;  4QJF B;  2CAZ C;  1ZUQ A;  4UV9 A;  5EC2 C;  4GKJ O;  1AJP A;  3SYO A;  3ZMZ A;  3ZMU A;  4LCU C;  2YIB A;  4YJ3 B;  4BW9 A;  2E3C A;  3E35 A;  3MD0 A;  2RMK B;  5L3G A;  1FAF A;  3W7U A;  1QNM A;  2VQE B;  1F4N A;  2YXL A;  5EIB D;  3F7Y C;  2PZS A;  3JAT A;  3T1Y O;  4FMT A;  5KHH A;  4NB5 A;  4DV0 B;  1COW G;  4DR4 O;  2XAQ A;  3UCS C;  3OGI B;  5FPR A;  1RM1 C;  3B09 A;  1XNQ O;  5BR8 B;  2HKO A;  5A9G A;  2EZO A;  4ZOL B;  4IYH A;  2F4V O;  4JPR A;  3WFV A;  1OCO B;  3RWR D;  3SGI A;  2IJH A;  3CP1 A;  4MW8 A;  5J2U B;  2UUC O;  1KC8 W;  3H01 A;  2DWD C;  2LFR A;  3P3N A;  3M7M X;  5C8Y B;  4ZIB A;  5JJN B;  3OMN B;  4X66 B;  1BMF G;  3RYI A;  5H9C A;  1EM1 A;  1AI5 A;  5LGN A;  1I5Y A;  4LFC O;  4I4T A;  1SQB H;  1IBL O;  2QM7 A;  1B3Q A;  1AVM A;  4U3J B;  1VAR A;  2XAJ A;  3G6B A;  3BAA A;  2ZM6 O;  4HNA B;  3DGE A;  2R9A A;  2DYR C;  1IZ3 A;  3HKC B;  4FJC C;  4RUE A;  5EYP B;  1TGO A;  1IBM B;  1DTO A;  2UXB O;  3E22 B;  2Q67 A;  3JAW A;  4NXN B;  4GUN A;  1J5E O;  1MG1 A;  2ZE6 A;  1YJ9 V;  1IXB A;  1TUB B;  5CMU A;  2OYQ A;  1N0J A;  2XT9 A;  2AZ0 A;  2Q0O C;  4EB6 B;  1SA0 A;  2P4V A;  1N36 O;  3LSU A;  5CN0 A;  3N2G B;  5LXT B;  5FNV B;  2IJI A;  4O2B B;  5DN6 G;  5IYD O;  2WLJ A;  3LSQ A;  4YY3 O;  4LFB B;  4GX1 A;  1V55 C;  1S5L Z;  4PA3 A;  4MTF A;  3ZIA G;  4O2A B;  1XNR B;  3K5O A;  5FPO A;  3RYF A;  2ZE8 A;  2WLI A;  1YJN V;  3I55 V;  1HNZ O;  5BMV A;  5CBH A;  1BSM A;  2CH7 B;  4TT3 G;  5CA1 B;  1BT8 A;  1FXK C;  4X65 O;  3K08 A;  3LDE A;  3J81 N;  5CA0 A;  3F5W C;  2MW2 B;  1K8A W;  4JZ2 A;  4MVS A;  2KG7 B;  5EIB C;  1BGY H;  5D5Q A;  2DYS B;  2EIJ B;  2NR5 A;  2IW5 A;  3HKE A;  3ZN1 A;  1NJI W;  4P30 A;  1Q82 W;  4DR7 O;  1EN5 A;  4UFZ A;  2CTW A;  3HKD A;  1SQX H;  3ML0 A;  3CX5 F;  4GLX A;  4YJ2 A;  1RSO B;  3ZHT A;  4IIJ A;  5L3B A;  1M9N A;  4PEL A;  4OPH A;  1JFF A;  5LHI A;  1S0V A;  2YEV B;  1AIL A;  3JSN A;  2YS8 A;  5BZB A;  1N32 B;  5CB4 B;  5KAF Z;  3BVO A;  3SPC A;  4X20 B;  4X1Y B;  1Y74 B;  5KAI Z;  3T1Y B;  4PDM A;  4CC5 A;  4JAU A;  4MT8 A;  4DR4 B;  3L9D A;  4DR6 O;  5GON A;  4I50 A;  2ZDI C;  4P9O A;  1K5S A;  2HLD G;  4DUZ B;  4JI5 B;  3F7V C;  1BE3 H;  3JD0 A;  4TQD A;  2Q0A A;  3IFX A;  4XDK A;  4LF7 O;  2Q9L A;  2EIM C;  3D3Q A;  1ARO P;  3WU2 Z;  4MVU A;  3TJT A;  4XDL A;  3P30 A;  3W7T A;  1VQN V;  1M56 C;  3OEE G;  1Z5W A;  4YXW G;  4LFC B;  4JTA B;  2P22 C;  1JJ2 U;  2EZP A;  1H2K A;  4X1K B;  2RJZ A;  1IBL B;  1NKD A;  4JYY A;  5B1O A;  1THZ A;  3OEH G;  4BW5 A;  2A06 H;  4DR5 O;  2FB5 A;  1VQ4 V;  5KMG B;  4GX2 A;  1V54 C;  2ZM6 B;  5LMN O;  3QTC A;  4CH5 A;  5EZY A;  4YHH O;  4TWK A;  4UB8 Z;  1K5Q A;  1ZLZ A;  5KX5 B;  1FYJ A;  5B1A B;  2QWO B;  5FLX N;  3IC7 A;  2RNB A;  2YSU B;  5IYZ A;  3EXA A;  1KUQ A;  1S3J A;  4OGQ B;  4PI0 A;  4KL1 A;  3ZHU A;  3N2K B;  3CD6 V;  4DR2 O;  1R3L C;  1U96 A;  4AHC A;  3ETE A;  1BQ0 A;  3UKM A;  1N36 B;  1KU9 A;  4NKG B;  2A9H A;  3B8N A;  4G2K A;  3ZMV A;  4DV5 B;  1D5A A;  3RVY A;  1SZX A;  1H8E G;  4WF9 V;  5B1B B;  4I0X A;  3G67 A;  4BIO A;  2QM8 A;  3TXQ A;  1YI2 V;  1H2L A;  3CS5 A;  1R1B A;  2QE7 G;  2EIK C;  4X64 O;  1QHT A;  4BR6 A;  1MZF A;  3AG3 C;  3I56 V;  2H94 A;  3A0B Z;  1HNZ B;  1MSD A;  3ABU A;  3C3S A;  5ITZ A;  1SZT A;  1NS1 A;  2BTQ A;  1NZ6 A;  4UCS A;  5TIS Z;  5IDJ A;  4LBE C;  3EVK A;  1VP7 A;  1PP9 H;  4FFB B;  3RYC A;  5IJ0 A;  1IDS A;  3RFR A;  3OAA G;  4J41 A;  5FL7 G;  5HFM A;  5LHH A;  4K0K O;  2WLN A;  3L70 H;  1VF6 A;  3UT5 B;  1Q81 W;  4DR1 O;  2WLK A;  4G28 B;  3WG7 C;  4WFA V;  2UXX A;  3FFQ A;  4KFM A;  1GO3 F;  3OTF A;  2Q8V A;  2DN9 A;  1S5H C;  1SQP H;  1K92 A;  4CZZ A;  2L35 A;  3ZHQ A;  2CDY A;  1H2S B;  1SER A;  3DTU B;  4UVA A;  3OTO O;  2UXC O;  1AP6 A;  4E2L A;  2PF4 E;  5L3F A;  3SJQ C;  2QKC A;  2V7Q G;  4ZHQ B;  4DV6 B;  1EN6 A;  4B08 A;  5GTH Z;  2ITC C;  2IH3 C;  1AI4 A;  4HZ3 A;  3T4D A;  4LWS B;  2ZNJ A;  2X0L A;  1VQ8 V;  4JAA A;  5EK0 A;  4JV5 B;  1X59 A;  1YXB A;  3HKC A;  4DR6 B;  1HNX O;  3K5M A;  4MTG A;  3AG1 C;  1VIB A;  3SR2 C;  4WFG A;  4CS2 A;  4F6R B;  4B3M B;  3BPZ A;  2WAM A;  2QWP B;  1VQ5 V;  3OW2 U;  1R3K C;  2QM4 A;  5L3D A;  2H3O A;  2VQE O;  2XAS A;  3CHX A;  2LW7 A;  1AB3 A;  3BEH A;  1YTF B;  2C2A A;  1D5N A;  2CK3 G;  2A7W A;  4B3R O;  4RO2 A;  2VWJ A;  1B06 A;  4DV2 B;  3OMA B;  4PDR A;  2XHB A;  2BSK B;  2JS3 A;  3WG7 B;  4QPK A;  4JGS A;  3CJH A;  2Y4U A;  4B7E A;  1ZAU A;  3K58 A;  3A0H Z;  3K5N A;  1K33 A;  4TQF A;  4DR5 B;  4X66 O;  4QE7 A;  3DXR B;  5LMN B;  1KMI Z;  5KHK A;  5KA5 A;  1PNK A;  4U7N A;  1XBL A;  1S72 V;  3S3W A;  3AG4 B;  3HKB B;  3JD1 A;  4TV8 A;  4K8X A;  2HVJ C;  2RCV A;  1FFX A;  5KHG A;  1R3I C;  1LR1 A;  3CCQ V;  4DV7 O;  4PV1 B;  3ZRS A;  2AGA A;  1F23 A;  1FD9 A;  2NNU A;  1ZX3 A;  2UU9 O;  4WBN B;  4D7S A;  1WB7 A;  1OCC C;  2ILM A;  1YHQ V;  5LHG A;  2EBO A;  1I08 A;  4X62 O;  4I9W A;  5BXZ A;  1GM9 A;  2YEV A;  4DR3 B;  1IBM O;  4JI2 B;  3VQY A;  4ZKI A;  3LNM B;  1LNQ A;  1XQ8 A;  4HAM A;  1NVP B;  2DW4 A;  4X20 A;  2YDE A;  4O4J B;  4X64 B;  4O4L A;  3ABT A;  2GUZ A;  1GM7 A;  3I5D A;  4ZI7 B;  1OJH A;  3AG2 B;  4TUY B;  2N04 A;  1OV9 A;  4FLT A;  4MVZ A;  4R8C A;  3G6E V;  2HR3 A;  2KSD A;  3STL C;  1JOY A;  1CP9 A;  1JX9 A;  3C3T A;  3IC9 A;  4K0K B;  2IH1 C;  4DXW A;  1FXK A;  3ZN0 A;  4LFB O;  4DR1 B;  3BRC A;  3Q4H B;  3JAL A;  2GDS A;  3JAK B;  1OCO C;  3AK2 A;  1OCR C;  2Q73 A;  1BL8 A;  4JI6 O;  4NTX A;  1SRY A;  2L6L A;  5IYB O;  4DO2 A;  2EIL B;  3JAR B;  2IBZ H;  4DK0 A;  2AXT Z;  4FZ1 A;  2UXC B;  3JD2 A;  4L87 A;  1P7G A;  2P67 A;  4WFH A;  1M57 B;  4RUF A;  3OR7 C;  3BCC H;  4RQE A;  1QLN A;  3O9O A;  2Y4T A;  4CH6 A;  5CA3 A;  3THO A;  3QO7 A;  2M6Y A;  1HNX B;  2A0L A;  3K59 A;  2AHZ A;  2WA4 A;  2IJK A;  1NT2 B;  2W0F C;  3K03 A;  4IHJ B;  4W4K A;  2JJ1 G;  2GTS A;  3R66 A;  3ABL B;  2Q69 A;  3K0G A;  1KD1 W;  2PYJ A;  1N32 O;  2ZDI A;  3T1H O;  1N34 B;  3IAY A;  3E2E A;  5JH7 A;  1LUW A;  3ZHV A;  3JYC A;  2FL4 A;  4B3R B;  2A3Q A;  4DUZ O;  1H38 A;  3UO2 A;  4JI5 O;  2ZT9 B;  1P7B A;  3OE7 G;  3A2F A;  1WA8 A;  1WAZ A;  2ZR2 A;  2P90 A;  1GMG A;  1OCR B;  3K9S A;  3RT3 C;  1URF A;  4LNU A;  3EHB B;  3CXH F;  3T2M A;  1L1F A;  2JGU A;  1XUQ A;  1L8D A;  2Z0A A;  5IJ9 A;  1H2G A;  4HBN A;  1AJQ A;  1ROP A;  1DF4 A;  2ODM A;  3CCU V;  4DYL A;  4RWU A;  3CCR V;  1CPY A;  3CCM V;  4DV7 B;  3FAV B;  4B3T O;  3VQV A;  3STZ C;  5L3C A;  2DYS C;  4OX9 O;  1QVF U;  2EIJ C;  1WNS A;  4ABM A;  3CRA A;  2UU9 B;  4ASU G;  4J10 A;  3ASN B;  3T1C A;  4X62 B;  4JI3 B;  1R6N A;  2YID A;  4JAV A;  2QSA A;  1Y76 B;  3CB2 A;  4EKW A;  3B8M A;  4X88 A;  4O4H A;  5LYJ B;  2B1I A;  3D36 C;  1FJG B;  4FM2 A;  4WCE V;  4AQY B;  2UUB O;  4DV3 B;  1MAB G;  2QWN B;  5EBW C;  3W7S A;  4ICG A;  1I0H A;  2WA3 A;  1G1X B;  2LO1 A;  2QWR B;  4NYK A;  4DV5 O;  2ZIN A;  2CGN A;  2BTO A;  5KHJ A;  1Q6I A;  3JSL A;  3L75 H;  3AK1 A;  2XAF A;  2FKX A;  3AG7 A;  3OM3 B;  1HNW B;  2CTP A;  4FLV A;  5LP6 B;  3U11 A;  4JI1 O;  4JI6 B;  1Y6X A;  3CCJ V;  1Z2G A;  5EBM C;  2YUA A;  4I7Z B;  5KHI A;  4DRX A;  4GCZ A;  4Q6G A;  3ETD A;  2DQ3 A;  4O4I A;  3OUS A;  3H1J H;  1W59 A;  3DXR A;  1K73 W;  4J7K A;  1QBZ A;  3WB1 A;  4J42 A;  2LGQ A;  4B7K A;  1HDJ A;  3E8F A;  4BIU A;  3UM7 A;  2WLL B;  4FZ0 A;  5IWA O;  4LC1 A;  1TUE B;  1FXV A;  3ETG A;  2X6A A;  1KYO F;  5LMU O;  4QE9 A;  4Z1V A;  1YTF D;  1VQ6 V;  4MSW C;  1KKC A;  3ETQ A;  1ZL8 B;  4DV6 O;  4X89 A;  1QVG U;  5LBQ A;  3JAS A;  4I55 A;  5JVD A;  3T1H B;  4GKK O;  5B1A C;  3CE2 A;  4LFA B;  4JV5 O;  2F23 A;  3CMA V;  2JIZ G;  5LA6 B;  1CXZ B;  2GV9 A;  5LOV A;  3S3X A;  2QGN A;  2LP7 A;  3CSX A;  4O4J A;  4TV9 A;  4B3M O;  2Q68 A;  3FX7 A;  5B1B C;  3F5T A;  2F95 B;  1XEQ A;  1SKV A;  3L71 H;  3R65 A;  3K0D A;  5B3S C;  1WP8 A;  4KXR A;  3ZRW B;  5EC1 C;  4JYB A;  4NTW A;  2ZCE A;  1WPX A;  4X8A A;  4DV2 O;  1TA8 A;  2ZKO A;  1N33 O;  3Q4H A;  4H0L B;  1XRE A;  2QDO A;  3PN1 A;  3ZS8 C;  5JQG B;  1F4M A;  1XI1 A;  3GVM A;  4K35 A;  4X1I A;  4B3S O;  1BS3 A;  3O65 A;  4B3T B;  1G8M A;  2JGD B;  3RYH B;  1GN6 A;  3KKY A;  3CME V;  3A0R A;  1XIL A;  4FLU A;  3QVN A;  1NVP D;  4OX9 B;  3FB5 C;  5H6Q A;  3FYE B;  2Q6A A;  2HG5 C;  4NTY A;  5DEC A;  1JPX A;  2NLJ C;  1GRJ A;  2XTA A;  1IUR A;  3BA9 A;  3X2Q B;  1NU1 H;  2HFE C;  5JCO C;  3E89 A;  2CUG A;  3MAQ A;  3J80 N;  1YEW A;  2UUB B;  3KCX A;  1KP3 A;  1PNM A;  3CC7 V;  3CCS V;  2F93 B;  2XND G;  4MVR A;  5B1N A;  4YJ3 A;  3A8T A;  4DR3 O;  3RW0 A;  4JI2 O;  2E5L O;  1NR1 A;  2Y69 B;  1VQP V;  1VQL V;  2YI9 A;  3P3P A;  1ZTE A;  1GK9 A;  2R70 A;  1YIJ V;  2ZIM A;  3L73 H;  2X6C A;  5KUK A;  5B3S B;  4JI1 B;  2YIC A;  3JAT B;  3VBB A;  1GN3 A;  1UJW B;  2IU0 A;  2WPD G;  4ZOL A;  4FLZ A;  1SET A;  2B9Z A;  5J2U A;  3SYC A;  3G4S V;  1XL4 A;  1PPJ H;  2HVK C;  3N27 A;  5C8Y A;  1H2M A;  1DK1 A;  3ZX6 A;  2OWO A;  3UO3 A;  2PY5 A;  1F51 A;  2ZXW B;  1TAE A;  3CC2 V;  1D2D A;  1PL4 A;  5IWA B;  3ASO B;  3RYI B;  1IBK B;  1I7F A;  3H1K H;  4YIP A;  2WLH A;  1MZE A;  4J80 A;  5LMU B;  3ICX A;  2IM9 A;  4KUM A;  2X6B A;  4I4T B;  4IL6 Z;  4E4E A;  4U3J A;  1XDC A;  4MW3 A;  3AG4 C;  3K9A A;  2F1M A;  1OZ0 A;  1HWY A;  3TXS A;  4JI0 B;  4GKK B;  1MNG A;  4HNA A;  2E76 B;  5LGU A;  5EYP A;  4LF6 O;  3ZHR A;  4U3F H;  1U97 A;  3E22 A;  3ZRX A;  3RVZ A;  4UCT A;  2FML A;  3EFF K;  4CS3 A;  4I9Q A;  4Z1M G;  1VF7 A;  5BY1 A;  4NXM B;  2VS0 A;  3SPI A;  3JAW B;  1ZSP A;  5DED A;  1ENV A;  3QF7 A;  4BWA A;  4JYA B;  1TUB A;  2QJ1 A;  1N34 O;  3FB6 C;  4J7J A;  4EB6 A;  5H6R A;  1M90 W;  2PGG A;  3N2G A;  5LXT A;  2JEU A;  5FNV A;  4MVM A;  3KG2 A;  3AG2 C;  1SA0 B;  4O2B A;  2ZE5 A;  2R9I A;  3SPG A;  4LH7 A;  5B66 Z;  1DF5 A;  3RBZ A;  4F4L A;  1N33 B;  1F7Y A;  5HFL A;  1P4R A;  4O2A A;  4IT5 A;  1N8R W;  1KP2 A;  3E83 A;  3FYI B;  1K4D C;  3TCU A;  2CH7 A;  4CH3 A;  5CA1 A;  4B3S B;  1DLB A;  1K34 A;  5H5N A;  3RYF B;  2WLI B;  2PYL A;  1RPO A;  4TOI A;  5JWP A;  5BMV B;  1UPG A;  4CH4 A;  1RPR A;  3APQ A;  4N23 A;  1PV0 A;  2W6J G;  2ZE7 A;  2JK5 C;  2D3O W;  5J2T B;  4FLY A;  5CA0 B;  5L3E A;  4DUY O;  1M4U A;  2UXD B;  2Y0P A;  2EIL C;  2VQF B;  2KG7 A;  4R50 A;  3QG5 A;  3K79 A;  3M99 B;  1NH2 B;  2Q7E A;  4U7O A;  1R6T A;  3HR0 A;  5F2V O;  1M57 C;  1SQF A;  2WLL A;  4LF4 O;  3HPL C;  3HKD B;  5GW7 A;  1RSO A;  4JTC B;  1SQV H;  4D6T H;  4YJ2 B;  3D36 A;  4JI3 O;  1BCC H;  1VQ7 V;  2Q4P A;  2E5L B;  1L0L H;  4JI4 O;  3ABK B;  3E8H A;  5CB4 A;  2W6I G;  3LSS A;  4X1Y A;  1Y74 A;  1FJG O;  1UFI A;  3APO A;  5IT9 N;  3ABL C;  2QA4 V;  4AQY O;  4DV3 O;  5IE9 A;  3CWB H;  5KUM A;  3DSQ A;  5GON B;  4I50 B;  4W4L A;  1Q6U A;  1VMG A;  1WN7 A;  3P32 A;  2Z3Y A;  1WJZ A;  2AHY A;  1QCE A;  2F66 C;  2ZR3 A;  1HNW O;  1H2N A;  1TVK B;  3SJB C;  2LFS A;  4LR3 A;  3HB3 B;  2CTQ A;  2ZQM A;  4J11 A;  5K1X A;  2GSM B;  2EUL A;  4JZG A;  3JD3 A;  4JYC A;  1VQM V;  2PUS A;  4EFB A;  1O9G A;  4FFK A;  4X1K A;  4UXN A;  1Q8I A;  2OTL V;  3RYH A;  2YIA A;  1M1K W;  2JDI G;  5KMG A;  2CE4 A;  1EFR G;  1R3J C;  4G27 B;  1K9M W;  2ATK C;  3BHP A;  1WLE A;  3BAB A;  2GTA A;  3SYQ A;  1US6 A;  4PA4 A;  5EZY B;  4LF6 B;  3ZMS A;  4PA7 A;  5KX5 A;  2DE0 X;  3SPH A;  1P49 A;  3ASN C;  2F43 G;  4NR1 A;  2E75 B;  3N2K A;  5IYZ B;  5GTI Z;  4F6E A;  4LFA O;  4H37 A;  3K3W A;  2OCC B;  2HHH O;  2OTJ V;  2WWW A;  3CRQ A;  1VQ9 V;  1JCH A;  1NQT A;  2QR4 A;  4JI7 B;  2P7T C;  2P5O A;  5IY5 B;  4MVO A;  5AG2 A;  1BHA A;  4I0X B;  3JAM N;  3H1L H;  2BOC C;  1S76 D;  1YZB A;  1KB9 F;  4WFE A;  4PD4 F;  3NR7 A;  3IGA C;  1JQ0 A;  5ITZ B;  2BTQ B;  3QO5 A;  3RN4 A;  4MVQ A;  1ZWI C;  4QGP A;  2YXY A;  5LP6 C;  4NVP A;  4FFB A;  2Q5Z A;  4DUY B;  5LL6 Y;  3C90 A;  2IU3 A;  1SQQ H;  3RYC B;  5IJ0 B;  3RGB A;  3UT5 A;  4MTO A;  3ZBH A;  3CRC A;  4KHP O;  4FLX A;  2PI4 A;  1KEC A;  1OCZ C;  4FLW A;  2N74 A;  4LF4 B;  1AR1 B;  5JJE B;  2YIB D;  4LH6 A;  2W0X A;  1EBO A;  4K8Z A;  5C93 A;  3PJS K;  5JCO A;  4ZHQ A;  1YVW A;  4JI4 B;  1I5X A;  2ZD9 A;  1NTK H;  4LWS A;  4OPA A;  3U10 A;  1E79 G;  5J9P C;  1SQG A;  4UVC A;  3ABM B;  1JVM A;  1GH6 A;  2EIN B;  3H1I H;  4R6Z A;  2XAH A;  2ADQ B;  2BCC H;  3CCV V;  4Z2W A;  3LDC A;  3E8G A;  1WPB A;  5E79 Z;  4KP4 A;  4F6R A;  4LF5 O;  1Z5V A;  1CEZ A;  2JEX A;  4EFE A;  4FPP A;  3ZHS A;  4DW0 A;  1IXM A;  2OIG A;  2AW9 A;  4LF8 B;  1MSW D;  2QTO A;  4UB6 Z;  1VEW A;  2P6J A;  2DWE C;  2Z5U A;  1RM1 B;  3SDL A;  2PI5 A;  2QTS A;  4DW1 A;  1T5E A;  1NBM G;  4QIW F;  3SJC C;  2Q7G A;  2KQX A;  5EBL C;  5JJJ B;  1N0N A;  2BSK A;  1LUV A;  1HW7 A;  2VWK A;  2CTR A;  1OCZ B;  4TSF G;  1JA8 A;  3DC5 A;  2CGO A;  3CJH B;  3B77 A;  4DV1 O;  2HP8 A;  4N21 A;  1PD3 A;  4UCV A;  4H13 B;  1XMO O;  4MS2 A;  5J2T A;  1HP8 A;  4P2Z A;  2ZIO A;  3TK1 A;  3FB8 C;  1Q90 D;  3VQW A;  2JJ2 G;  1IBK O;  3HKB A;  4J7Z A;  3E8B A;  4PI2 A;  1EZV H;  5KLV H;  3B40 A;  1A32 A;  1M5I A;  3TET A;  3LNN A;  4TV8 B;  1I94 B;  2ADP A;  1FFX B;  3FKS G;  3X2Q C;  4JI0 O;  2DYR B;  4LF9 O;  1YJW V;  4WBN A;  2XOK G;  2DJV A;  2LQT A;  5D5P A;  3UQ8 A;  3LUT B;  2HHH B;  1FFT B;  3SYP A;  4GKJ B;  4IGG A;  2KKW A;  1V9P A;  2GHY A;  2MK3 A;  1YDX A;  2R72 A;  2JS5 A;  1S77 D;  1WB8 A;  1KKD A;  2OCH A;  1FKA O;  3ZED A;  4D7T A;  2IJJ A;  4UCU A;  3KZI Z;  1RFY A;  2R9R B;  3TGU H;  4NXM O;  4P9P A;  4UCO A;  4JYA O;  2QKA A;  3D3I A;  4ZI7 A;  4O4L B;  1YIT V;  2B5U A;  4TUY A;  2Y69 C;  2GUZ B;  2BE3 A;  1MMM A;  1QR8 A;  1NH2 D;  1XNQ B;  4PDL A;  2LJ2 A;  1B04 A;  1NR7 A;  1AI6 A;  3CEI A;  1V55 B;  3IJ4 A;  4AIL C;  1FS0 G;  1YSC A;  3CCE V;  4JAS A;  2F4V B;  2V1D A;  2P4K A;  2B1G A;  2V4D A;  2UUC B;  1AP5 A;  1TVK A;  3L74 H;  1Q86 W;  4KHP B;  1NTM H;  4AI8 A;  1FXK B;  3JAK A;  1JR9 A;  3GWK C;  3W7W A;  3JAL B;  4UUJ C;  2FTK A;  2K9P A;  1SES A;  1Y66 A;  4XBF A;  3K5L A;  2RDC A;  3JAR A;  3OGC C;  3ZRV A;  1H8H G;  2UUA O;  2LGW A;  1GN2 A;  1IVS A;  2ZXW C;  1JMK C;  2UXD O;  1GTO A;  1J95 A;  3ASO C;  4CS4 A;  2VQF O;  3LDD A;  3SPJ A;  3K04 A;  4UVB A;  1G6U A;  5H2F Z;  5E1A C;  1QQC A;  5CBF A;  1PKX A;  5B5E Z;  1AJN A;  1PNL A;  3M8A A;  2M7W A;  4FM0 A;  3CXC U;  4IHJ A;  4LF5 B;  1VQO V;  2UXB B;  2Y48 A;  1W2B U;  5LGT A;  1XMQ O;  1J5E B;  3JCZ A;  2RN9 A;  2Y0I A;  4PA6 A;  2G38 A;  3OFN G;  3WB2 A;  3FD9 A;  4BAY A;  1HR0 O;  5JH7 B;  1Y4M A;  2X7R B;  1XHX A;  2Q7H A;  4LP8 A;  2N05 A;  1KBH A;  3D8C A;  2UXN A;  4ZBM A;  1IX9 A;  3MHH C;  4YY3 B;  3KCY A;  2EIM B;  4EEQ A;  3OR6 C;  4WFF A;  4PDV A;  1WA8 B;  4DV1 B;  4GZR B;  4RAI A;  1MOF A;  1XMO B;  4GT1 A;  4BIZ A;  4X65 B;  1M56 B;  4LNU B;  3FB7 C;  2XUM A;  1WP7 A;  3CC4 V;  3VOU A;  4JF3 A;  5IJ9 B;  4YIO A;  1QU7 A;  3DC6 A;  1E1Q G;  3FAV A;  3CRR A;  1V54 B;  5KA6 A;  4DV4 O;  3T4Z A;  4DR7 B;  2ITD C;  4L8J A;  4HYO A;  1YCI A;  4LF9 B;  4CC6 A;  1XOU A;  2WSS G;  2QEX V;  4J9Z B;  3WB0 A;  4H44 B;  1B6Q A;  1SF9 A;  1EZJ A;  4Q20 A;  3QO8 A;  1SS3 A;  4X9Q A;  1N4C A;  1Y76 A;  4FIP C;  4UV8 A;  2JRI A;  5LYJ A;  2D2C B;  1R6K A;  1MA1 A;  4O4H B;  4JI8 O;  1QLE C;  2OIE A;  4H33 A;  2ZNI A;  3ABK C;  2YC0 A;  1GM8 A;  3AEI A;  1R73 A;  1Q5O A;  3GWO A;  3MDS A;  1GAX A;  2GBO A;  3H9V A;  1AR4 A;  2DQ0 A;  4K3A A;  3W7X A;  3OD4 A;  4WFB V;  2EIK B;  4JI7 O;  3AG3 B;  1W0K G;  1KQS U;  4FVM A;  2QWQ B;  1PM9 A;  4LF7 B;  1OHH G;  4FK5 C;  1JJO A;  3B4S A;  2KB1 A;  5LP6 A;  1ORQ C;  3BA8 A;  4QNH B;  2LW1 A;  4DV0 O;  4I5S A;  2EJR A;  5DM6 V;  4XDJ A;  3QNE A;  1K97 A;  5BR8 O;  3VQX A;  2FYU H;  2UUA B;  1VQK V;  1AI7 A;  1K7D A;  4DRX B;  3JCU Z;  2ETN A;  1X4T A;  4O4I B;  4GX0 A;  2HJD A;  3OMI B;  2H8P C;  3NXS A;  1L0N H;  2PTM A;  2EX3 A;  2NN4 A;  3HKE B;  2O57 A;  1XL6 A;  2ARH A;  2HEP A;  2RQ6 A;  3G71 V;  1Q3E A;  4YHH B;  1XHZ A;  4DK1 A;  1M93 A;  1QR9 A;  4PHZ A;  3K57 A;  1E1R G;  1ZL8 A;  4IIJ B;  1S5J A;  1Y67 A;  1QLE B;  3J7A U;  1XMQ B;  3ZCC A;  1JFF B;  1YF2 A;  2AZ2 A;  2EJ7 A;  1G4Y B;  3JAS B;  3L72 H;  3OT7 A;  4I55 B;  4DR2 B;  3H1H H;  5JVD B;  4C7U A;  3E86 A;  3AG1 B;  5K1P A;  3CRM A;  2DMX A;  5LA6 A;  1HR0 B;  1AR5 A;  1NI8 A;  4PJ0 Z;  1SC5 B;  2K1E A;  2JVD A;  2OCC C;  5CBG A;  5LOV B;  1P84 F;  1Q6H A;  1K3E A;  4NXN O;  4TV9 B;  5IY5 C; 
#chains in the Genus database with same CATH homology
 3BY6 A;  1Q7Y W;  5C93 A;  4E2L A;  3PJS K;  3CCL V;  5L3F A;  4MTX A;  3SJQ C;  2V7Q G;  3R65 A;  1I5X A;  2ZD9 A;  3GB7 C;  3K0D A;  3ZRW A;  1BHB A;  1E79 G;  5B3S C;  2ITC C;  2IH3 C;  1AI4 A;  4HZ3 A;  3T4D A;  5J9P C;  3ZRW B;  5EC1 C;  4UVC A;  1K4C C;  1W0J G;  4JYB A;  1WPX A;  2X0L A;  1VQ8 V;  3ABM B;  4X8A A;  1JVM A;  2EIN B;  3K06 A;  4R7C A;  5EK0 A;  4R6Z A;  2XAH A;  3CCV V;  3SYA A;  2WLM A;  1F4M A;  2HJF C;  3LDC A;  4RQF A;  3E8G A;  3CPW U;  4MTG A;  4KP4 A;  3AG1 C;  4CBC A;  4WFG A;  1G8M A;  2QKS A;  1CEZ A;  3CME V;  3MHS C;  1PL0 A;  3A0R A;  2JEX A;  4FPP A;  1NVP D;  2OT5 A;  2WAM A;  1VQ5 V;  1IXM A;  3FB5 C;  3OW2 U;  4GX5 A;  5H6Q A;  3FYE B;  4JTD B;  1MSW D;  1R3K C;  2HG5 C;  2Q6A A;  5L3D A;  2QTO A;  2P6J A;  2DWE C;  2Z5U A;  1RM1 B;  1JPX A;  2XAS A;  2PI5 A;  4OXS A;  2BOB C;  2NLJ C;  3OUF A;  3BEH A;  1NBM G;  1YTF B;  2C2A A;  4QIW F;  2A79 B;  2CK3 G;  5EBL C;  3X2Q B;  4J9Y B;  4RO2 A;  2HFE C;  4PA9 A;  3E89 A;  3OMA B;  4PDR A;  3ZMT A;  1OCC B;  3CYO A;  3WG7 B;  1FXH A;  4QPK A;  1KP3 A;  4JGS A;  4QPJ A;  3JD4 A;  4TSF G;  1OCZ B;  3ZJZ A;  2XAG A;  3ABM C;  1PNM A;  3B77 A;  1GKF A;  5IYC O;  2EIN C;  3CC7 V;  3CCS V;  4QJF B;  2XND G;  4N21 A;  4MVR A;  4UV9 A;  1PD3 A;  1K33 A;  5EC2 C;  5B1N A;  1AJP A;  4MS2 A;  3SYO A;  3ZMZ A;  3RW0 A;  3ZMU A;  4LCU C;  1NR1 A;  4QE7 A;  4P2Z A;  3TK1 A;  3E35 A;  3MD0 A;  2Y69 B;  3FB8 C;  1VQP V;  5L3G A;  3W7U A;  1VQL V;  2JJ2 G;  1F4N A;  1PNK A;  5KA5 A;  3F7Y C;  4U7N A;  1S72 V;  1YIJ V;  1GK9 A;  2X6C A;  3AG4 B;  3E8B A;  3JD1 A;  5KUK A;  4FMT A;  5B3S B;  3VBB A;  1COW G;  2XAQ A;  3TET A;  2HVJ C;  1UJW B;  1RM1 C;  2HKO A;  1R3I C;  3CCQ V;  2IU0 A;  2WPD G;  2EZO A;  3ZRS A;  1SET A;  3FKS G;  3X2Q C;  2DYR B;  4JPR A;  1F23 A;  3WFV A;  1YJW V;  1OCO B;  3SYC A;  2NNU A;  2XOK G;  2IJH A;  3G4S V;  1XL4 A;  3CP1 A;  2HVK C;  4MW8 A;  1KC8 W;  3H01 A;  3LUT B;  2DWD C;  2LFR A;  1OCC C;  1YHQ V;  5LHG A;  1FFT B;  2EBO A;  3SYP A;  4I9W A;  3OMN B;  1GM9 A;  2GHY A;  2YEV A;  2MK3 A;  4ZKI A;  3LNM B;  1LNQ A;  1S77 D;  1KKD A;  1F51 A;  4HAM A;  2ZXW B;  1NVP B;  2DW4 A;  1BMF G;  2IJJ A;  3CC2 V;  5H9C A;  2R9R B;  3ASO B;  1AI5 A;  3ABT A;  4P9P A;  3D3I A;  5LGN A;  1YIT V;  1I5Y A;  1GM7 A;  2B5U A;  2Y69 C;  2WLH A;  3AG2 B;  4KUM A;  1QR8 A;  2X6B A;  1NH2 D;  4MVZ A;  4PDL A;  4R8C A;  3G6E V;  2HR3 A;  3STL C;  1JOY A;  1CP9 A;  1JX9 A;  1NR7 A;  3AG4 C;  3K9A A;  1AI6 A;  4MW3 A;  2QM7 A;  1V55 B;  1OZ0 A;  2XAJ A;  1FS0 G;  1YSC A;  1HWY A;  3CCE V;  4JAS A;  2V1D A;  2B1G A;  2IH1 C;  4DXW A;  1Q86 W;  1FXK A;  3ZN0 A;  3DGE A;  1FXK B;  5LGU A;  2DYR C;  3W7W A;  1OCO C;  4FJC C;  4RUE A;  1DTO A;  4UUJ C;  3ZRX A;  1OCR C;  3RVZ A;  1BL8 A;  2FTK A;  1SES A;  1Y66 A;  3EFF K;  4XBF A;  2Q67 A;  4Z1M G;  1SRY A;  3OGC C;  5IYB O;  3SPI A;  4DO2 A;  3ZRV A;  2EIL B;  1ENV A;  1H8H G;  1MG1 A;  2ZXW C;  3JD2 A;  4L87 A;  1YJ9 V;  5CMU A;  1GTO A;  3FB6 C;  1J95 A;  3ASO C;  5H6R A;  2P67 A;  1M90 W;  3LDD A;  4WFH A;  1M57 B;  3SPJ A;  4RUF A;  2JEU A;  4MVM A;  3K04 A;  3KG2 A;  3OR7 C;  5CN0 A;  3AG2 C;  4UVB A;  4RQE A;  2IJI A;  2R9I A;  5E1A C;  3SPG A;  1QLN A;  5DN6 G;  5IYD O;  2WLJ A;  1DF5 A;  5CBF A;  3RBZ A;  1PKX A;  4F4L A;  3LSQ A;  5CA3 A;  4GX1 A;  1V55 C;  5HFL A;  1P4R A;  1AJN A;  3QO7 A;  1PNL A;  4PA3 A;  4MTF A;  2A0L A;  2M7W A;  3ZIA G;  1N8R W;  1KP2 A;  3CXC U;  2AHZ A;  3E83 A;  1K4D C;  3FYI B;  3TCU A;  2WLI A;  1YJN V;  3I55 V;  1DLB A;  2IJK A;  1K34 A;  5CBH A;  2W0F C;  1VQO V;  2Y48 A;  2WLI B;  3K03 A;  4TT3 G;  1RPO A;  1FXK C;  1RPR A;  1W2B U;  3K08 A;  2JJ1 G;  3LDE A;  5LGT A;  4N23 A;  2W6J G;  2D3O W;  2JK5 C;  3ABL B;  2Q69 A;  3K0G A;  1KD1 W;  3F5W C;  3JCZ A;  5L3E A;  2ZDI A;  4PA6 A;  3OFN G;  3E2E A;  2EIL C;  1K8A W;  4R50 A;  3K79 A;  4MVS A;  3M99 B;  4BAY A;  1NH2 B;  3JYC A;  1Y4M A;  2X7R B;  2DYS B;  4U7O A;  2EIJ B;  4LP8 A;  2IW5 A;  3ZN1 A;  1NJI W;  4P30 A;  1Q82 W;  2UXN A;  4ZBM A;  1M57 C;  1H38 A;  3MHH C;  1P7B A;  3OE7 G;  2WLL A;  3ML0 A;  3HPL C;  5GW7 A;  2EIM B;  4JTC B;  3OR6 C;  4WFF A;  2ZR2 A;  4PDV A;  2P90 A;  1GMG A;  1OCR B;  4RAI A;  1MOF A;  3D36 A;  5L3B A;  1M9N A;  4GT1 A;  4PEL A;  4BIZ A;  1M56 B;  1VQ7 V;  3EHB B;  5LHI A;  1S0V A;  2YEV B;  3ABK B;  3T2M A;  3E8H A;  5BZB A;  2W6I G;  3FB7 C;  3LSS A;  1L1F A;  3CC4 V;  3SPC A;  3VOU A;  4JF3 A;  1H2G A;  1AJQ A;  3ABL C;  2QA4 V;  4PDM A;  1ROP A;  1DF4 A;  3CCU V;  4JAU A;  3CCR V;  4MT8 A;  5KUM A;  1E1Q G;  2ZDI C;  1CPY A;  1V54 B;  3CCM V;  5KA6 A;  4P9O A;  1K5S A;  3T4Z A;  2HLD G;  3F7V C;  3STZ C;  2ITD C;  5L3C A;  4HYO A;  2DYS C;  3P32 A;  2Z3Y A;  2EIJ C;  1QVF U;  3JD0 A;  2AHY A;  2WSS G;  4ASU G;  2QEX V;  4J9Z B;  3IFX A;  1QCE A;  2ZR3 A;  3ASN B;  4XDK A;  1B6Q A;  3T1C A;  1EZJ A;  4Q20 A;  2LFS A;  1R6N A;  3HB3 B;  2EIM C;  2ZQM A;  3QO8 A;  1ARO P;  4FIP C;  4UV8 A;  4MVU A;  4JAV A;  2GSM B;  4EKW A;  3B8M A;  4X88 A;  1R6K A;  3JD3 A;  2B1I A;  4JYC A;  4XDL A;  1VQM V;  3P30 A;  3W7T A;  1VQN V;  1M56 C;  3OEE G;  1QLE C;  4H33 A;  4WCE V;  3ABK C;  4YXW G;  1MAB G;  1GM8 A;  4UXN A;  5EBW C;  4JTA B;  3W7S A;  1JJ2 U;  2EZP A;  3AEI A;  2OTL V;  1R73 A;  3GWO A;  1NKD A;  1M1K W;  1THZ A;  2DQ0 A;  3OEH G;  5B1O A;  4BW5 A;  3W7X A;  2JDI G;  4WFB V;  1EFR G;  1R3J C;  4G27 B;  2EIK B;  1VQ4 V;  4GX2 A;  1K9M W;  1V54 C;  3AG3 B;  2XAF A;  1W0K G;  2ATK C;  1KQS U;  3OM3 B;  1WLE A;  3SYQ A;  1OHH G;  4FK5 C;  4PA4 A;  2KB1 A;  4TWK A;  3ZMS A;  1ORQ C;  4PA7 A;  3SPH A;  1K5Q A;  4QNH B;  3ASN C;  4I5S A;  2EJR A;  5DM6 V;  4XDJ A;  3CCJ V;  5B1A B;  5EBM C;  2F43 G;  3QNE A;  1K97 A;  3IC7 A;  2YSU B;  1S3J A;  1VQK V;  4GCZ A;  1AI7 A;  1K7D A;  3CD6 V;  3ETD A;  2DQ3 A;  1R3L C;  4H37 A;  3OUS A;  3K3W A;  4GX0 A;  3ETE A;  2OCC B;  3UKM A;  2OTJ V;  3OMI B;  2H8P C;  2WWW A;  1VQ9 V;  2A9H A;  3B8N A;  4G2K A;  3ZMV A;  1JCH A;  1NQT A;  3NXS A;  3RVY A;  1K73 W;  1H8E G;  2P7T C;  4WF9 V;  5B1B B;  5IY5 B;  4MVO A;  1XL6 A;  2QM8 A;  1BHA A;  1QBZ A;  3G71 V;  1YI2 V;  3E8F A;  4BIU A;  3UM7 A;  2QE7 G;  2WLL B;  2EIK C;  4LC1 A;  2BOC C;  3AG3 C;  3I56 V;  2H94 A;  1S76 D;  1TUE B;  1FXV A;  4WFE A;  3ETG A;  2X6A A;  3ABU A;  1QR9 A;  4QE9 A;  1E1R G;  3IGA C;  1YTF D;  1SZT A;  1VQ6 V;  1JQ0 A;  4MSW C;  1QLE B;  3QO5 A;  4X89 A;  4MVQ A;  3ZCC A;  1ZWI C;  5IDJ A;  1QVG U;  5LBQ A;  4LBE C;  1G4Y B;  2IU3 A;  5B1A C;  3E86 A;  3OAA G;  5FL7 G;  5HFM A;  5LHH A;  2WLN A;  3AG1 B;  4MTO A;  1Q81 W;  2PI4 A;  2WLK A;  4G28 B;  3CMA V;  2JIZ G;  3WG7 C;  4WFA V;  2UXX A;  1KEC A;  1OCZ C;  4KFM A;  1GO3 F;  2K1E A;  2OCC C;  2LP7 A;  1S5H C;  5CBG A;  1AR1 B;  1K3E A;  2Q68 A;  1K92 A;  4CZZ A;  1SER A;  3DTU B;  4UVA A;  5B1B C;  1EBO A;  5IY5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...