2LFSA

Solution structure of the chimeric af1503 hamp- envz dhp homodimer; a219f variant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of regulation of receptor histidine kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus, shigella flexneri
molecule tags Transferase
molecule keywords Uncharacterized protein, Osmolarity sensor protein envZ chim
total genus 42
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF00672 HAMP HAMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2lfsA00
4JYBA 3ZRWA 5C93A 4BIUA 4FMTA 3ZRXA 4KP4A 4QPKA 4GT1A 5IDJA 2FTKA 3A0RA 4JAVA 4I5SA 2LFRA 4FPPA 4QPJA 4ZKIA 4Q20A 2QM7A 3D36A 3MD0A 3DGEA 4JASA 4JYCA 4JAUA 1F51A 3P32A 1IXMA 2WWWA 4U7NA 2P67A 3ZRWB 2LFSA 2C2AA 3NXSA 5B1NA 4BIZA 4MT8A 4U7OA 4MTXA 1JOYA 3TK1A 4GCZA 4LC1A 5B1OA 3ZCCA 3ZRVA 2QM8A
chains in the Genus database with same CATH superfamily
4UCOA 1QLNA 2UUBO 1NBMG 1ZSPA 1WNSA 2YSUB 2Q73A 4JASA 3QO5A 2XAHA 3OT7A 3FB8C 5KAFZ 1OCRB 5EBLC 2QSAA 3L75H 1HNZO 3JAKA 4LF4O 4AQYO 4J42A 1QU7A 1NT2B 3SJQC 2Q67A 4QNHB 3H1LH 2ZINA 3IJ4A 2RMKB 4JZGA 2QE7G 3VBBA 1VQ9V 2OTJV 2RNBA 2AW9A 3ZRWB 3A0HZ 2QTOA 1KU9A 1S72V 1QLEC 1N34O 2P06A 1YSCA 4I55A 1LR1A 2X6CA 4TV8B 5KMGA 2FTKA 4YJ3B 4QPJA 2DOSA 2ZR2A 1HNWO 3CE2A 2VS0A 2CTPA 5H6RA 2ADPA 2JIZG 1S76D 4DR6O 1FS0G 4NXNB 1F4MA 4XBFA 4JI8O 4MW3A 2DJVA 4XDJA 5J2UA 2P6JA 2KG7B 1V9PA 4RAIA 1HP8A 2FKXA 4DR1O 1KECA 4IT5A 3E35A 3JSLA 3MHSC 1VQ4V 4UB8Z 2QM7A 3MD0A 1P4RA 2PF4E 1XEQA 4O2AB 1OCOB 4J41A 3JD4A 4FM2A 1YJ9V 5L3FA 1KUQA 4K8XA 1M56C 4OPHA 2P4KA 3K57A 4BIUA 2D2CB 4EFBA 5EZYB 5IYBO 3X2QB 1NZ6A 1Q8IA 4JYYA 4TWKA 2EILB 2IJIA 3N2GB 1N36B 4DRXB 5KHGA 4E4EA 4R6ZA 4QPKA 1Q6IA 3BRCA 1XBLA 1GMGA 5JQGA 4LFBO 1A32A 1CPYA 4LNUB 1XUQA 1SA0A 1H2MA 2A7WA 4GCZA 2P90A 3BFRA 4DR5O 2Y69C 1V55C 4XDKA 4UV9A 4LF8B 4GUNA 1DK1A 2HKOA 3E22A 1P84F 4H33A 4O4JA 5BMVB 3E86A 4W4KA 3CYOA 3ZHRA 1EN6A 3AEIA 1HNXB 1M57B 3QNEA 5KMGB 4KHPB 5KX5B 2DE0X 1KP2A 4X64B 3QVNA 1GTOA 3FB5C 1VARA 4EFEA 3F5TA 3Q4HA 1TVKA 1BGYH 5LHHA 2ADQB 1QR9A 4O4LA 2BTQA 2N04A 3CHXA 2ETNA 4AILC 2A06H 3O9OA 2GTAA 4UVCA 3OUFA 3J81N 2HLDG 4MVQA 5LA6A 1EN5A 3WU2Z 4RWUA 4DRXA 2OYQA 1HNXO 1EFRG 1PL0A 1JVMA 2ZXWB 4HBNA 3P3PA 2VQFB 4DW1A 3CCVV 2W0FC 1AR5A 3CCLV 3HKDB 1R3IC 4EB6A 4JAVA 1BSMA 3OTOB 4YY3O 4D7SA 5CBFA 2EIKB 1WLEA 3DXRA 5KUKA 5EBWC 2YICA 2AHZA 3E89A 4DV6O 2E75B 5KHHA 3JD0A 4CBCA 2AXTZ 2P22C 2XUMA 4DV7B 3SPIA 5IJ0B 2BE3A 4JI6O 4WFGA 4Q6GA 1J95A 4LF4B 3K08A 3MDSA 4X64O 2GHYA 1SQFA 2WLMA 2XAFA 1XNRB 1ZUQA 3L70H 1YDXA 2XHBA 3ZRWA 4ZHQA 4ICGA 3LSQA 3N27A 4MTGA 1K7DA 3CB2A 1XL6A 1KQSU 4LF9B 1AR4A 4JI7O 5BY1A 2CE4A 2YI9A 3KKYA 4JF3A 4WFBV 4WFAV 1I5YA 4FLTA 5IJ0A 3CMEV 3CWBH 1SZXA 2QR4A 3M7MX 3RVZA 1RPOA 2D3OW 4B08A 5CMUA 3UQ8A 2EBOA 1XNQO 5FPRA 3E8FA 1M57C 1SA0B 1V54C 3HKBA 3LDEA 5LGUA 1SQXH 1ZX3A 1IBMO 5LL6Y 3D8CA 4JI3B 3OUSA 5JJEB 5IE9A 2EIKC 4JPRA 5JVDA 1OCCB 1MA1A 1N8RW 1VQ6V 2LGWA 2V1DA 4OXSA 1Q82W 3DC6A 2YIAA 4X65B 2A79B 1RSOB 4LH7A 2DW4A 1VF6C 1NR7A 2E74B 5B1BB 2R9AA 3J80N 1EN4A 3FD9A 4H44B 2W0XA 3FB7C 2FB5A 2ZDIA 3W7UA 4H37A 1K73W 1FAFA 1SF9A 1FJGB 1KD1W 1KP3A 1WN7A 4F6EA 4N23A 3HR0A 3CEIA 1KMIZ 4PA3A 4MS2A 4KHPO 2ZE6A 2W6IG 3CRCA 4U3FH 1AJQA 2VQFO 1JOYA 1HW7A 1WAZA 1BMFG 2EIJC 3LUTB 5A9GA 3I5DA 3DXRB 3VQVA 2QJ1A 4QGPA 1I94B 4TT3G 4NR1A 1PNMA 3U11A 2P5OA 3OMAB 3OGIB 2F4VO 2Q7HA 4ZOLA 4U7NA 2AZ0A 2AGAA 4BIOA 4FLYA 5LYJA 2ZCEA 1OHHG 5LYJB 3HKEB 4UCRA 4GYCB 4NTYA 1F7YA 2UU9O 5C8YB 3WG7B 2UUCB 4X1KA 4DR2B 3SDLA 5DECA 2HJDA 1FFXA 5L3BA 4GKKB 5JJNB 1LUVA 2JK5C 4IGGA 1IXMA 4DXWA 2CGOA 2XT9A 4YHHO 4UB6Z 1Q6HA 2NN4A 3E8GA 2DMXA 4JI3O 3CC2V 4UCTA 2M7WA 4JI1O 2PGGA 1YTFD 4KP4A 4CH3A 2UUBB 4J7KA 3BCCH 1BL8A 1XNQB 4CZZA 4Z1MG 3JAKB 3P32A 4DR7O 4LFAB 2DYRB 3RGBA 1GN6A 2HEPA 4TUYB 4O2BA 2HFEC 5CA0B 1EZJA 1V55B 1QVGU 3S3WA 3R65A 4J7JA 2JJ2G 5CBGA 2RJZA 1FXKC 3CRMA 2MW2B 1QBZA 5BXZA 3H01A 1GAXA 1FFTB 1KKCA 3T4ZA 1N33B 1WJZA 4IHJA 1SQGA 4IL6Z 1FXHA 4QE9A 4UCSA 1Y6XA 4GLXA 2XAGA 2QTSA 5B1AB 1VQPV 4MVUA 1G6UA 3DSQA 4KXRA 2QKCA 1VF7A 1JMKC 1NR1A 2DYSB 5C93A 2L6LA 4DUYO 4KFMA 4NXMB 2QA4V 4NB5A 5B3SB 5EYPA 4UXNA 3STZC 1JJ2U 1VQ8V 1TUBA 3RBZA 4U3JB 2KG7A 4UCVA 3JATA 4J80A 1NVPD 1AR1B 1R73A 5B5EZ 2Q0OC 3T1CA 2B1IA 3ZJZA 2K9PA 1IZ3A 1NS1A 1VF6A 1FJGO 2LFRA 2WLJA 4D7TA 1W0KG 2NNUA 1Q81W 4DR7B 4WCEV 2YDEA 5J2TA 2KSDA 1M56B 2YEVB 4O4LB 1TUEB 2CTQA 3HB3B 3E8HA 2WAMA 2UXCO 5GTIZ 4ZI7B 3IAYA 3CCQV 5LBQA 3K0GA 3AG2C 5LXTB 3OM3B 4TQFA 1BQ0A 1JJOA 4X66B 2WA4A 1MSWD 1RM1B 4CS4A 2EZPA 3ABMC 1XQ8A 4J7ZA 1MG1A 1GM8A 2LFSA 4FFKA 2LP7A 5J9PC 5B3SC 4B3TB 1PD3A 1T5EA 3G71V 2X6AA 5IJ9B 5KHJA 3EFFK 4H0LB 3KCYA 4I50B 2EIMB 1XI1A 1L0LH 1BQZA 4JYAB 1NU1H 1JX9A 1Q90D 2JJ1G 3GWOA 5EK0A 1UPGA 2LQTA 5LGTA 2ZM6O 4WFHA 2WSSG 5IYCO 2PTMA 2L35A 2OCCB 4K0KO 4LNUA 1NTKH 4X62B 1LNQA 3K0DA 4PI2A 3M8AA 1H8HG 4LFCO 1SRYA 2A0LA 3SYPA 5CA1A 2HHHO 3OTFA 3CS5A 2ZQMA 4FZ0A 3BHPA 3C90A 5CN0A 2ATKC 1YF2A 2BOCC 2O57A 3T1HO 3N2GA 4DR4O 3SPCA 4B7KA 5L3CA 2RQ6A 5FNVA 1GN2A 4FJCC 4NXNO 4X1KB 3CRAA 2ZNJA 4J9YB 1N4CA 2ZIOA 4B3RO 5EIBD 3AG1B 1AJPA 4DV3B 1NVPB 1YJWV 5A2QN 4GT1A 2A9HA 4GX2A 1WB7A 3THOA 3ABMB 1HNWB 1PL4A 1VEWA 3LSSA 4FFBB 5LA6B 4R50A 3ZRSA 4FZ1A 5CB4A 4J9ZB 2R70A 2C2AA 1YHQV 4PI0A 5KHKA 1OCRC 2GSMB 5DM6V 4TV9A 3ZRVA 1NH2D 3CX5F 1Y74A 1PKXA 5ITZA 2ZM6B 1GM7A 2Z5UA 4TQDA 3H1HH 4PDMA 3FB6C 5JWPA 3T1YB 3JASB 4PELA 3SJAC 3I56V 2LJ2A 4I9WA 1CXZB 1AI4A 5EZYA 1SESA 2XAJA 2CUGA 4JI4O 5IDJA 2QM4A 3SPHA 4J10A 5K1XA 2NLJC 2JGDA 1R6TA 2HJFC 3B40A 5ITZB 1MZEA 2N05A 1Q5OA 3TCUA 1WPBA 3JAMN 1R3LC 5C8YA 1OCCC 2UXBO 3DTUB 1N32O 4HNAB 1FFXB 1K4DC 1H2NA 2ZR3A 1XMOB 3MAQA 1V54B 3B8NA 5J2UB 1BHAA 3JD3A 2WLLB 3JALA 2ZE7A 2UXDB 1W59A 1P49A 4QE7A 1I94O 2R72A 4MVZA 1SQPH 3OR7C 3TETA 2DN9A 3W7TA 2F95B 1VQKV 3ABKB 4LH6A 1F51A 4O4IB 4PDLA 3PN1A 1E1QG 4P2ZA 4BR6A 2GBOA 2R9RB 1QHTA 2F93B 4IIJB 1YEWA 1DLBA 1BZKA 4RO2A 4U7OA 4JTDB 4O4HA 3L9DA 1Y66A 4DUYB 4P30A 2IJHA 1EZVH 2Y4TA 2WLKA 4O4JB 5E79Z 4X9QA 2EZOA 2WLNA 3RYCB 4CC5A 4NKGB 3B2EE 3E8BA 4F6RB 3CC4V 5H5NA 2CTRA 1SQVH 5LMNB 1CEZA 3B8MA 1QR8A 4NTXA 3CCEV 4ZBMA 5EYPB 2OT5A 3SR2C 3RWRD 1VIBA 4NXMO 3L74H 3AK3A 1BS3A 2DQ0A 3R66A 1DF4A 5CB4B 3FAVB 4PA4A 2YXHA 2H3OA 2DWDC 3BA8A 1WA8A 2ZXWC 3BEHA 2YEVA 1B3QA 2VWJA 3GB7C 1XMOO 4JI0B 1E1RG 5IY5C 1OCZB 2DWEC 4JI5O 3RYIB 3N2KA 3VOUA 3UT5A 4MW8A 2FYUH 2B1GA 2Z0AA 3T1YO 3K03A 1PPJH 3ASOC 5B1NA 4JAAA 3JALB 3AK1A 2JRIA 3OAAG 1URFA 3PJSK 4G27B 4DK1A 1QCEA 3BVOA 4IHJB 4JI0O 3T1HB 5EC2C 4DUZO 3K5LA 4F4LA 2IH1C 3ZMVA 1N0NA 3HKCB 3TGUH 4NTWA 1MABG 3WB0A 3JSNA 4DV7O 5KHIA 3ICXA 3K5NA 3CJHB 5IWAO 1HDJA 5LHIA 1L0NH 2EINC 3P3NA 4GX1A 1B6QA 1YJNV 4UCUA 1JQ0A 5BR8B 1XHXA 1K9MW 1WPXA 3H1IH 1IBLB 1K4CC 4TSFG 2X0LA 5JCOA 4WFFA 4JAUA 3G6BA 3APOA 4FLZA 1IVSA 5IY5B 1F23A 4PD4F 2LW7A 5D5QA 1SERA 3STLC 3ZEDA 4B7EA 2ZDIC 5KX5A 1YCIA 2UXDO 2ZKOA 4IYIA 3CC7V 2OTLV 1VF5B 1Z5VA 2Q7GA 4LFBB 2BTQB 2EIJB 2Y48A 1QVFU 3OEHG 3X2QC 1U96A 4LBEC 2EX3A 3AG2B 1MMMA 5DEDA 4B3MO 3K79A 1N32B 1OJHA 2Y0PA 1I08A 3JD1A 1Y76A 1RM1C 1MZFA 3FAVA 3CSXA 2HG5C 4LF6O 2QKAA 3FKSG 4X20A 4P9OA 3JCZA 5JH7A 4JV5B 5GONB 1KBHA 3T4DA 1AI5A 4JI5B 1L8DA 1VQOV 1TGOA 3CP1A 2Q68A 4MTFA 2UU9B 4JI1B 1JA8A 2JS3A 4LF5O 3JAWB 2ILMA 2WLLA 1ZTEA 4CH5A 1K5QA 2JEXA 3T2MA 3FFQA 2BTOA 4Z1VA 4CS3A 1Q6UA 1OV9A 3NXSA 3A8TA 5IYZB 2XASA 1HNZB 5H2FZ 4IYHA 1SC5B 4LR3A 4HNAA 4LWSB 3ZN0A 3F5WC 2WLIA 2VQEB 2VWKA 1DF5A 1ZL8B 4LF5B 1SQBH 2Q69A 4PDRA 1JPXA 5IJ9A 3N2KB 4XDLA 3ETQA 3ZMZA 1Z5WA 5E1AC 1IBKO 1YI2V 3FX7A 1Y67A 2EIMC 4X1YA 1Z2GA 1IXBA 4R8CA 4DV4B 4CS2A 3KZIZ 4BW9A 2QGNA 3OE7G 3UKMA 4C7UA 3OTOO 4L8JA 4BAYA 4OX9B 4GKKO 3E83A 1JFFB 4UVBA 4K8ZA 3UO3A 1X4TA 3RVYA 4TUYA 2CGNA 3ZN1A 4DR6B 2IBZH 3JAWA 1NI8A 1B06A 1VMGA 5HFLA 1UFIA 1OCOC 3ZIAG 4DW0A 3W7SA 3ABTA 2HVJC 3SYAA 1G1XB 5GTHZ 5KUMA 1XMQB 2CDYA 3CD6V 3HKBB 2H94A 1FPOA 1NH2B 2GTSA 4CH6A 4BW5A 4LFAO 1S5LZ 3OD4A 4X62O 1N0JA 4X89A 3W7WA 1HR0O 3APQA 2PUSA 1ZL8A 3ABKC 3UO2A 3ABUA 2LO1A 3ZCCA 2UXNA 3OGCC 4G28B 3SYCA 4JYBA 5CA3A 5JH7B 1KB9F 4LF8O 1D5AA 4I5SA 3ZMUA 3K59A 2DYSC 4O4HB 3CCJV 1ZAUA 2Q5ZA 3ETEA 1O9GA 2P67A 2XTAA 4ZI7A 1AB3A 1HR0B 1IBMB 5FPOA 2F43G 1PNLA 4ABMA 4PV1B 4X1IB 1N34B 5LP6A 4YJ2B 1K97A 1M9NA 2F66C 5B1BC 1K34A 1TAEA 4FPPA 3EVKA 3SJBC 4X66O 4DV6B 1JCHA 3ZHUA 2Q4PA 3A0BZ 2FMLA 2B5UA 2EINB 4DK0A 1S5JA 2HP8A 1R3JC 2W6JG 1SQQH 1US6A 3VQWA 5CBHA 5KA5A 4GKJB 2IU0A 2BSKA 3D3IA 3ZHVA 1S0VA 1R3KC 2UUCO 2XNDG 2OWOA 1K92A 3CRQA 1D2DA 5FNVB 1XMQO 3OW2U 1BHBA 4N21A 4RUEA 3RYHA 1IBLO 3TJTA 3QO7A 2M6YA 2YIDA 3AG7A 1UJWB 4UV8A 3QG5A 2CTWA 3CCMV 3ZX6A 4JI6B 2R9IA 2QWOB 4O2BB 4I4TB 2WLIB 1K5SA 3ASOB 3UM7A 3A0RA 4LP8A 4OX9O 4PHZA 2PYLA 4JZ2A 1WP7A 3RYIA 1ORQC 3UCSC 2A3QA 1NJIW 3AG3C 1OZ0A 1VQLV 3L73H 4I55B 3ZBHA 3HKDA 3BPZA 4MT8A 2FL4A 1F4NA 3FYEB 4O2AA 4DV4O 3CCRV 2H8PC 1GM9A 4MSWC 4YIOA 1I0HA 5LHGA 5J2TB 4YY3B 3HKCA 1RSOA 3OEEG 5IYDO 2Y0IA 2JS5A 4X65O 3AG1C 2JEUA 1AVMA 3RYHB 3FYIB 4RQEA 1FXVA 5CA1B 3ABLC 2QKSA 1GKFA 1XILA 1AJNA 4W4LA 4UVAA 4Q20A 1U97A 1H2SB 4I0XA 2EJRA 2ODMA 3F7VC 4DYLA 4EKWA 2RN9A 4LF9O 3QTCA 3CXHF 3IFXA 1KKDA 2AHYA 1WA8B 3JARB 1B04A 2Q6AA 4QIWF 5AG2A 4UFZA 2YIBA 1R6NA 2OIGA 1N36O 2IJKA 2G38A 4JI2O 3AG3B 1QLEB 1M93A 3H1JH 4JTAB 1AI6A 2E5LO 1FXKB 2E5LB 2HR3A 3IC9A 3WB2A 2X7RB 2XOKG 3K04A 4JI7B 2Z3YA 3VQXA 5TISZ 4I0XB 4YJ2A 1X59A 4KL1A 2CAZC 4DO2A 4B3MB 1R6KA 3B77A 3TXSA 3K9SA 4O4IA 1GN3A 1NTMH 3WFVA 3LSUA 4JV5O 4TOIA 1NKDA 1OCZC 3SPGA 4Z2WA 1FD9A 1BT8A 3OMNB 3K5OA 2YI8A 4LC1A 2X6BA 2GDSA 4I7ZB 3B4SA 2QM8A 1S3JA 1FKAO 1S77D 5JVDB 3QO8A 4ZHQB 4YIPA 1JFFA 3ASNC 2OCHA 1VQ5V 1PV0A 3JARA 2JDIG 1Y76B 3CCSV 4RUFA 3NR7A 4FK5C 5BZBA 1ZWIC 1GN4A 5IYZA 3ML0A 3G6EV 4FM0A 4X20B 1S5HC 1VP7A 3K58A 5JJJB 3CMAV 4X88A 3OMIB 3E22B 4JI2B 3P30A 4NVPA 5K1PA 4DUZB 5LMUO 1J5EB 3GVMA 4IIJA 2ZE5A 2IH3C 3JATB 1YZBA 2GUZB 2LGQA 4K0KB 2QWPB 3A2FA 4FLXA 5L3GA 3CRRA 3G80A 2QWQB 4CH4A 1RP3B 1YITV 2UXBB 3SYQA 1EBOA 1DTOA 3ZHQA 4JGSA 1SZTA 1NTZH 1BE3H 3B09A 3Q4HB 3ZHTA 5H6QA 4B3SO 1GK9A 1TUBB 3M99B 3ETGA 5F2VO 4U3JA 1TA8A 3WG7C 1THZA 4HZ3A 1ENVA 4GKJO 1QQCA 4JTCB 3ZRXA 2KQXA 1AP6A 4CC6A 3I55V 3OR6C 4B3SB 2YC0A 3U0ZA 3BA9A 2CH7A 3KCXA 3SPJA 4ZIBA 2OCCC 3EXAA 3AG4B 1H2KA 3RN4A 3CCUV 1I7FA 3ZS8C 4DR2O 1ZLZA 2WPDG 3IGAC 2UXCB 4YXWG 2JGUA 5LMUB 1J5EO 4WBNB 4ZKIA 2WA3A 1XOUA 3K9AA 4FFBA 2DQ3A 2DYRC 2BOBC 4HYOA 1AP5A 3F7YC 4A5UB 4YHHB 4ZOLB 3EHBB 3L71H 1R1BA 4DV0O 2YIBD 4MTOA 4LWSA 4WF9V 4K3AA 4PA7A 1E79G 2ZD9A 3JASA 3JD2A 5LMNO 2WLHA 4FLWA 4FLVA 2BSKB 4DV2B 1AI7A 3D3QA 2QWRB 4I50A 4PDVA 4DV1B 2MK3A 4DV1O 1H38A 3S3XA 2QDOA 5IWAB 1PP9H 4LFCB 5EC1C 2PYJA 1M1KW 4FMTA 4X8AA 1M4UA 3VQYA 1RFYA 4D6TH 2E3CA 4MVOA 1I5XA 4JYCA 2V4DA 4LCUC 4FM1A 4DV0B 3J7AU 5KA6A 1HWYA 1YVWA 2ITDC 5EBMC 1WP8A 3SYOA 2RCVA 3IC7A 4H13B 3H1KH 4J11A 1XREA 1VQNV 3RFRA 1IDSA 4MVMA 2F1MA 3SJCC 4X1IA 1MOFA 3OFNG 5KAIZ 5JCOC 4BIZA 1M90W 3C3SA 4B3TO 3KG2A 3BY6A 1K3EA 4QJFB 4OPAA 2PI5A 3LDDA 5DN6G 3C3TA 3RYFA 2Y4UA 1GO3F 1FXKA 3RYFB 3D36A 4X1YB 3DGEA 2ZE8A 1SETA 1KYOF 4OGQB 1G4YB 2P4VA 1WB8A 1VQ7V 2GUZA 2XAQA 3QF7A 4JI8B 3WB1A 1AROP 1PM9A 2ZNIA 1XNRO 5LGNA 2OIEA 4EB6B 1AILA 4TV8A 2Q7EA 4ASUG 2UUAB 5GONA 2ZIMA 3LNMB 1H2GA 2IJJA 1TVKB 1Q86W 1BCCH 2E76B 4B3RB 4AI8A 4DV3O 2JGDB 2PI4A 3ZMTA 4GZRB 3ETDA 1W2BU 1L1FA 5HFMA 1KC8W 2BCCH 4WBNA 4MVRA 2WWWA 4UUJC 3W7XA 2UXXA 4PA9A 2EILC 3BABA 4DR3B 4DR3O 3BAAA 5CA0A 2NR5A 4DR5B 3H9VA 3ZHSA 3RYCA 4GX5A 1DGSA 2PY5A 1M5IA 3JCUZ 2IU3A 3LNNA 2QWNB 2V7QG 2AZ2A 2CK3G 1K8AW 1PNKA 3O65A 1YTFB 5L3DA 3ASNB 1Y74B 3U10A 1XL4A 5FLXN 4I9QA 3JYCA 4JYAO 3ABLB 1Q43A 4AQYB 2LW1A 1JR9A 2HHHB 1QNMA 2QEXV 1K33A 3HKEA 3CJHA 2CH7B 1MNGA 3D36C 5FL7G 4P9PA 2KB1A 5LOVA 1N33O 3DC5A 5D5PA 3G4SV 2P7TC 2JVDA 1Y4MA 3TK1A 5IT9N 1XHZA 2GV9A 4AHCA 4FIPC 1COWG 5B1AC 5LP6B 2F23A 2HVKC 1IURA 4LF6B 3K3WA 2F4VB 3RW0A 3SGIA 5B66Z 1P7BA 2IM9A 2B9ZA 1H2LA 2N74A 2EULA 4TV9B 2YXLA 1FYJA 1LUWA 4NYKA 4E2LA 3CXCU 2YXYA 2KKWA 3E2EA 4MTXA 2VRZA 4FLUA 3K5MA 1EM1A 4EEQA 1GRJA 1VQMV 2Q0AA 2UUAO 2Y69B 1D5NA 1Q3EA 4PJ0Z 4R7CA 5GW7A 1ROPA 2RDCA 4YJ3A 1W0JG 1NQTA 5BMVA 4DV5B 1G8MA 4HAMA 1CP9A 2ITCC 4I4TA 5B1OA 2VQEO 2IW5A 2ARHA 1RPRA 4G2KA 1IX9A 3AG4C 1MSDA 5L3EA 4K35A 5LP6C 1O9HA 2EJ7A 1YIJV 4DR4B 2K1EA 4KUMA 3G67A 4FVMA 2PZSA 4RQFA 3ZMSA 1IBKB 1XDCA 3HPLC 3MHHC 3CPWU 3L72H 4LF7B 4LF7O 1GH6A 3AK2A 4L87A 4PA6A 4DR1B 1YXBA 2YS8A 5LXTA 4JI4B 4WFEA 4DV2O 3GWKC 5KLVH 4F6RA 4MVSA 2ZT9B 1H8EG 1SS3A 3TXQA 1Q7YW 2Q8VA 1SKVA 4BWAA 5JQGB 4DV5O 5EIBC 2YUAA 3LDCA 3K06A 2Q9LA 1P7GA 3UT5B 5BR8O 5H9CA 4GX0A 3RT3C 5LOVB
chains in the Genus database with same CATH topology
3CMAV 1FXKC 4X88A 3OMIB 1QLNA 3P30A 1K9MW 1WPXA 1QBZA 1NBMG 3H01A 1FFTB 2YSUB 2IH3C 1K4CC 3QO5A 4JASA 2X0LA 2XAHA 4TSFG 4WFFA 3FB8C 3T4ZA 4JAUA 1OCRB 1FXHA 4QE9A 1F23A 5IY5B 5L3GA 5EBLC 2XAGA 5B1AB 1VQPV 1SERA 4MVUA 3STLC 1YITV 2ZDIC 3SJQC 3SYQA 1EBOA 1DTOA 1NR1A 2Q67A 4QNHB 2DYSB 5C93A 4JGSA 3CC7V 1SZTA 2OTLV 4KFMA 2QA4V 5B3SB 5H6QA 1GK9A 2QE7G 4UXNA 3STZC 1JJ2U 3VBBA 1VQ9V 2OTJV 1VQ8V 3M99B 3ETGA 3RBZA 2EIJB 2Y48A 3ZRWB 2QTOA 1QVFU 3WG7C 1THZA 3OEHG 3X2QC 4HZ3A 1NVPD 1AR1B 1ENVA 1QLEC 4LBEC 1S72V 3AG2B 3K79A 1R73A 1YSCA 3JD1A 3T1CA 2X6CA 1RM1C 4JTCB 2B1IA 3ZJZA 3ZRXA 2FTKA 2LFRA 3I55V 2HG5C 2WLJA 3OR6C 2ZR2A 4QPJA 1W0KG 2NNUA 3FKSG 1Q81W 4P9OA 3JCZA 5H6RA 1AI5A 3T4DA 4WCEV 2JIZG 1S76D 3SPJA 1VQOV 1M56B 1FS0G 2OCCC 2YEVB 3AG4B 1F4MA 4XBFA 3CCUV 1TUEB 4MW3A 3HB3B 3CP1A 2Q68A 2WAMA 3E8HA 4MTFA 4XDJA 2P6JA 2WPDG 3IGAC 4RAIA 1KECA 4YXWG 3CCQV 3E35A 5LBQA 3K0GA 3AG2C 3MHSC 1VQ4V 3OM3B 2WLLA 4ZKIA 3K9AA 2QM7A 2DQ3A 1K5QA 1P4RA 2BOBC 2DYRC 3MD0A 2JEXA 4HYOA 1RM1B 1MSWD 3T2MA 3F7YC 3EHBB 2EZPA 3ABMC 1OCOB 1MG1A 3JD4A 1GM8A 2LFSA 3NXSA 4MTOA 2LP7A 2XASA 5J9PC 4WF9V 1YJ9V 5L3FA 3ZN0A 5B3SC 4PA7A 3F5WC 1E79G 2ZD9A 2WLIA 1PD3A 1M56C 3JD2A 3G71V 2WLHA 1DF5A 2X6AA 4BIUA 3EFFK 4PDRA 2Q69A 1JPXA 1AI7A 5IYBO 4XDLA 2EIMB 3X2QB 3ZMZA 4PDVA 5E1AC 1YI2V 2MK3A 2EIMC 1H38A 1YJNV 1JX9A 2JJ1G 3GWOA 5EK0A 4R8CA 4TWKA 2EILB 2IJIA 5EC1C 1M1KW 4R6ZA 3OE7G 4FMTA 4X8AA 5LGTA 4QPKA 3UKMA 4WFHA 2WSSG 4BAYA 5IYCO 3E83A 4UVBA 2OCCB 4MVOA 1GMGA 1I5XA 4JYCA 3RVYA 4LCUC 3ZN1A 1CPYA 1LNQA 5KA6A 1HWYA 3K0DA 2ITDC 5EBMC 5HFLA 1OCOC 3ZIAG 4GCZA 2P90A 1H8HG 3W7SA 1SRYA 2A0LA 2Y69C 3SYPA 3ABTA 3SYOA 1V55C 2HVJC 3SYAA 4XDKA 4UV9A 2ZQMA 3IC7A 5CN0A 5KUMA 2ATKC 2HKOA 2BOCC 4H33A 1VQNV 3CD6V 2H94A 3E86A 1NH2B 3CYOA 4MVMA 3SPCA 4BW5A 5L3CA 1MOFA 3OFNG 3AEIA 4FJCC 4X89A 3W7WA 1M57B 3QNEA 3ABKC 3ABUA 4BIZA 1M90W 4J9YB 1KP2A 3KG2A 3BY6A 1K3EA 3AG1B 2UXNA 1AJPA 1GTOA 3FB5C 3ZCCA 4QJFB 3OGCC 4G28B 3LDDA 4JYBA 3SYCA 5CA3A 1YJWV 1NVPB 5DN6G 4GT1A 4I5SA 2A9HA 1GO3F 4GX2A 5LHHA 1FXKA 3ZMUA 2DYSC 3D36A 3ABMB 1QR9A 3DGEA 3CCJV 3LSSA 1SETA 4R50A 1G4YB 3ZRSA 4UVCA 3OUFA 3ETEA 2HLDG 4MVQA 1VQ7V 2P67A 4J9ZB 2C2AA 1EFRG 1YHQV 2XAQA 1PL0A 2F43G 1PNLA 1JVMA 2ZXWB 3CCVV 1AROP 1OCRC 2GSMB 2W0FC 5DM6V 1K97A 3ZRVA 3CCLV 1NH2D 5LGNA 1M9NA 1PKXA 5B1BC 1R3IC 1GM7A 1K34A 4JAVA 4ASUG 4FPPA 2Z5UA 5CBFA 2EIKB 1WLEA 5KUKA 5EBWC 3LNMB 2AHZA 3E89A 1JCHA 1H2GA 3JD0A 2B5UA 4PDMA 2IJJA 2EINB 3FB6C 4CBCA 1R3JC 2W6JG 3SPIA 4WFGA 4PELA 1Q86W 1J95A 3I56V 5CBHA 4I9WA 3K08A 1AI4A 5KA5A 2GHYA 2IU0A 2WLMA 2XAFA 3D3IA 1SESA 2XAJA 1S0VA 1R3KC 3ZRWA 3ZMTA 2XNDG 2PI4A 1K92A 5IDJA 3LSQA 3SPHA 3ETDA 2NLJC 1W2BU 4MTGA 1K7DA 1L1FA 3OW2U 5HFMA 1BHBA 4N21A 2HJFC 4RUEA 1KC8W 3QO7A 1XL6A 4MVRA 1KQSU 2WWWA 4UUJC 1UJWB 4UV8A 3W7XA 2UXXA 4PA9A 3TCUA 2EILC 3CCMV 2R9IA 4JF3A 1R3LC 4WFBV 1OCCC 2WLIB 4WFAV 1I5YA 3DTUB 1K5SA 4GX5A 3CMEV 3ASOB 1K4DC 2ZR3A 3UM7A 2IU3A 3A0RA 2V7QG 4LP8A 3RVZA 1RPOA 1V54B 2D3OW 3B8NA 5CMUA 2CK3G 1K8AW 2EBOA 1ORQC 1PNKA 3E8FA 1M57C 1NJIW 3AG3C 1V54C 1OZ0A 3LDEA 1YTFB 1VQLV 1BHAA 5L3DA 3JD3A 5LGUA 3ASNB 2WLLB 2PI5A 1XL4A 3JYCA 4MT8A 3ABLB 3OUSA 1F4NA 3FYEB 2EIKC 4JPRA 2H8PC 1GM9A 4MSWC 3CCRV 2QEXV 4QE7A 1K33A 1OCCB 1N8RW 1VQ6V 5LHGA 4MVZA 5FL7G 3OR7C 4P9PA 3TETA 2KB1A 3W7TA 1VQKV 2V1DA 4OXSA 3ABKB 1Q82W 1F51A 4PDLA 3OEEG 1E1QG 4P2ZA 5IYDO 2A79B 2R9RB 3AG1C 3G4SV 2DW4A 2P7TC 1DLBA 4RO2A 4U7OA 1NR7A 4JTDB 1Y4MA 5B1BB 3TK1A 2JEUA 3FYIB 1COWG 3FB7C 4FIPC 5B1AC 4RQEA 2ZDIA 3W7UA 1Y66A 1FXVA 4H37A 1K73W 2HVKC 3ABLC 2QKSA 1GKFA 1AJNA 4UVAA 3K3WA 4P30A 2IJHA 4Q20A 1KD1W 3RW0A 1KP3A 2EJRA 2WLKA 4N23A 3F7VC 4EKWA 1P7BA 2EZOA 2WLNA 3IFXA 1KKDA 2AHYA 4PA3A 3E8BA 4MS2A 4E2LA 3CC4V 2W6IG 2Q6AA 4QIWF 3CXCU 1AJQA 3E2EA 4MTXA 1R6NA 1JOYA 1BMFG 2EIJC 3LUTB 1CEZA 2IJKA 3B8MA 1QR8A 3CCEV 3AG3B 1QLEB 4TT3G 4ZBMA 1VQMV 1PNMA 2OT5A 2Y69B 3OMAB 4JTAB 2DQ0A 1AI6A 1FXKB 1DF4A 2HR3A 4R7CA 5GW7A 4U7NA 1ROPA 2X7RB 2XOKG 3K04A 4PA4A 2Z3YA 1W0JG 1OHHG 1NQTA 1G8MA 4HAMA 1CP9A 2ITCC 4DO2A 1R6KA 3B77A 2DWDC 2IW5A 5B1OA 3WG7B 1RPRA 4G2KA 3AG4C 2ZXWC 3BEHA 2YEVA 3GB7C 5L3EA 5L3BA 1YIJV 1E1RG 2K1EA 2JK5C 5IY5C 4KUMA 1OCZB 1IXMA 2DWEC 3VOUA 3WFVA 4MW8A 4DXWA 3ZMSA 4RQFA 2B1GA 3HPLC 3MHHC 3CPWU 1NKDA 1OCZC 3K03A 3SPGA 3OMNB 3ASOC 5B1NA 3E8GA 3OAAG 4LC1A 4L87A 2X6BA 3PJSK 3CC2V 4G27B 4PA6A 2QM8A 1S3JA 2M7WA 1QCEA 4WFEA 1YTFD 4KP4A 1S77D 3QO8A 3ASNC 5EC2C 1VQ5V 4MVSA 2IH1C 1BL8A 3ZMVA 4CZZA 4F4LA 1H8EG 2JDIG 4Z1MG 3CCSV 3P32A 4RUFA 4FK5C 1Q7YW 5BZBA 1ZWIC 2DYRB 1MABG 3ML0A 3G6EV 2HFEC 3LDCA 1EZJA 1V55B 1QVGU 3K06A 1S5HC 3R65A 5LHIA 2EINC 2JJ2G 4GX1A 1B6QA 5H9CA 4GX0A 5CBGA 1JQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYB A;  3ZRW A;  5C93 A;  4BIU A;  4FMT A;  3ZRX A;  4KP4 A;  4QPK A;  4GT1 A;  5IDJ A;  2FTK A;  3A0R A;  4JAV A;  4I5S A;  2LFR A;  4FPP A;  4QPJ A;  4ZKI A;  4Q20 A;  2QM7 A;  3D36 A;  3MD0 A;  3DGE A;  4JAS A;  4JYC A;  4JAU A;  1F51 A;  3P32 A;  1IXM A;  2WWW A;  4U7N A;  2P67 A;  3ZRW B;  2LFS A;  2C2A A;  3NXS A;  5B1N A;  4BIZ A;  4MT8 A;  4U7O A;  4MTX A;  1JOY A;  3TK1 A;  4GCZ A;  4LC1 A;  5B1O A;  3ZCC A;  3ZRV A;  2QM8 A; 
#chains in the Genus database with same CATH topology
 4UCO A;  1QLN A;  2UUB O;  1NBM G;  1ZSP A;  1WNS A;  2YSU B;  2Q73 A;  4JAS A;  3QO5 A;  2XAH A;  3OT7 A;  3FB8 C;  5KAF Z;  1OCR B;  5EBL C;  2QSA A;  3L75 H;  1HNZ O;  3JAK A;  4LF4 O;  4AQY O;  4J42 A;  1QU7 A;  1NT2 B;  3SJQ C;  2Q67 A;  4QNH B;  3H1L H;  2ZIN A;  3IJ4 A;  2RMK B;  4JZG A;  2QE7 G;  3VBB A;  1VQ9 V;  2OTJ V;  2RNB A;  2AW9 A;  3ZRW B;  3A0H Z;  2QTO A;  1KU9 A;  1S72 V;  1QLE C;  1N34 O;  2P06 A;  1YSC A;  4I55 A;  1LR1 A;  2X6C A;  4TV8 B;  5KMG A;  2FTK A;  4YJ3 B;  4QPJ A;  2DOS A;  2ZR2 A;  1HNW O;  3CE2 A;  2VS0 A;  2CTP A;  5H6R A;  2ADP A;  2JIZ G;  1S76 D;  4DR6 O;  1FS0 G;  4NXN B;  1F4M A;  4XBF A;  4JI8 O;  4MW3 A;  2DJV A;  4XDJ A;  5J2U A;  2P6J A;  2KG7 B;  1V9P A;  4RAI A;  1HP8 A;  2FKX A;  4DR1 O;  1KEC A;  4IT5 A;  3E35 A;  3JSL A;  3MHS C;  1VQ4 V;  4UB8 Z;  2QM7 A;  3MD0 A;  1P4R A;  2PF4 E;  1XEQ A;  4O2A B;  1OCO B;  4J41 A;  3JD4 A;  4FM2 A;  1YJ9 V;  5L3F A;  1KUQ A;  4K8X A;  1M56 C;  4OPH A;  2P4K A;  3K57 A;  4BIU A;  2D2C B;  4EFB A;  5EZY B;  5IYB O;  3X2Q B;  1NZ6 A;  1Q8I A;  4JYY A;  4TWK A;  2EIL B;  2IJI A;  3N2G B;  1N36 B;  4DRX B;  5KHG A;  4E4E A;  4R6Z A;  4QPK A;  1Q6I A;  3BRC A;  1XBL A;  1GMG A;  5JQG A;  4LFB O;  1A32 A;  1CPY A;  4LNU B;  1XUQ A;  1SA0 A;  1H2M A;  2A7W A;  4GCZ A;  2P90 A;  3BFR A;  4DR5 O;  2Y69 C;  1V55 C;  4XDK A;  4UV9 A;  4LF8 B;  4GUN A;  1DK1 A;  2HKO A;  3E22 A;  1P84 F;  4H33 A;  4O4J A;  5BMV B;  3E86 A;  4W4K A;  3CYO A;  3ZHR A;  1EN6 A;  3AEI A;  1HNX B;  1M57 B;  3QNE A;  5KMG B;  4KHP B;  5KX5 B;  2DE0 X;  1KP2 A;  4X64 B;  3QVN A;  1GTO A;  3FB5 C;  1VAR A;  4EFE A;  3F5T A;  3Q4H A;  1TVK A;  1BGY H;  5LHH A;  2ADQ B;  1QR9 A;  4O4L A;  2BTQ A;  2N04 A;  3CHX A;  2ETN A;  4AIL C;  2A06 H;  3O9O A;  2GTA A;  4UVC A;  3OUF A;  3J81 N;  2HLD G;  4MVQ A;  5LA6 A;  1EN5 A;  3WU2 Z;  4RWU A;  4DRX A;  2OYQ A;  1HNX O;  1EFR G;  1PL0 A;  1JVM A;  2ZXW B;  4HBN A;  3P3P A;  2VQF B;  4DW1 A;  3CCV V;  2W0F C;  1AR5 A;  3CCL V;  3HKD B;  1R3I C;  4EB6 A;  4JAV A;  1BSM A;  3OTO B;  4YY3 O;  4D7S A;  5CBF A;  2EIK B;  1WLE A;  3DXR A;  5KUK A;  5EBW C;  2YIC A;  2AHZ A;  3E89 A;  4DV6 O;  2E75 B;  5KHH A;  3JD0 A;  4CBC A;  2AXT Z;  2P22 C;  2XUM A;  4DV7 B;  3SPI A;  5IJ0 B;  2BE3 A;  4JI6 O;  4WFG A;  4Q6G A;  1J95 A;  4LF4 B;  3K08 A;  3MDS A;  4X64 O;  2GHY A;  1SQF A;  2WLM A;  2XAF A;  1XNR B;  1ZUQ A;  3L70 H;  1YDX A;  2XHB A;  3ZRW A;  4ZHQ A;  4ICG A;  3LSQ A;  3N27 A;  4MTG A;  1K7D A;  3CB2 A;  1XL6 A;  1KQS U;  4LF9 B;  1AR4 A;  4JI7 O;  5BY1 A;  2CE4 A;  2YI9 A;  3KKY A;  4JF3 A;  4WFB V;  4WFA V;  1I5Y A;  4FLT A;  5IJ0 A;  3CME V;  3CWB H;  1SZX A;  2QR4 A;  3M7M X;  3RVZ A;  1RPO A;  2D3O W;  4B08 A;  5CMU A;  3UQ8 A;  2EBO A;  1XNQ O;  5FPR A;  3E8F A;  1M57 C;  1SA0 B;  1V54 C;  3HKB A;  3LDE A;  5LGU A;  1SQX H;  1ZX3 A;  1IBM O;  5LL6 Y;  3D8C A;  4JI3 B;  3OUS A;  5JJE B;  5IE9 A;  2EIK C;  4JPR A;  5JVD A;  1OCC B;  1MA1 A;  1N8R W;  1VQ6 V;  2LGW A;  2V1D A;  4OXS A;  1Q82 W;  3DC6 A;  2YIA A;  4X65 B;  2A79 B;  1RSO B;  4LH7 A;  2DW4 A;  1VF6 C;  1NR7 A;  2E74 B;  5B1B B;  2R9A A;  3J80 N;  1EN4 A;  3FD9 A;  4H44 B;  2W0X A;  3FB7 C;  2FB5 A;  2ZDI A;  3W7U A;  4H37 A;  1K73 W;  1FAF A;  1SF9 A;  1FJG B;  1KD1 W;  1KP3 A;  1WN7 A;  4F6E A;  4N23 A;  3HR0 A;  3CEI A;  1KMI Z;  4PA3 A;  4MS2 A;  4KHP O;  2ZE6 A;  2W6I G;  3CRC A;  4U3F H;  1AJQ A;  2VQF O;  1JOY A;  1HW7 A;  1WAZ A;  1BMF G;  2EIJ C;  3LUT B;  5A9G A;  3I5D A;  3DXR B;  3VQV A;  2QJ1 A;  4QGP A;  1I94 B;  4TT3 G;  4NR1 A;  1PNM A;  3U11 A;  2P5O A;  3OMA B;  3OGI B;  2F4V O;  2Q7H A;  4ZOL A;  4U7N A;  2AZ0 A;  2AGA A;  4BIO A;  4FLY A;  5LYJ A;  2ZCE A;  1OHH G;  5LYJ B;  3HKE B;  4UCR A;  4GYC B;  4NTY A;  1F7Y A;  2UU9 O;  5C8Y B;  3WG7 B;  2UUC B;  4X1K A;  4DR2 B;  3SDL A;  5DEC A;  2HJD A;  1FFX A;  5L3B A;  4GKK B;  5JJN B;  1LUV A;  2JK5 C;  4IGG A;  1IXM A;  4DXW A;  2CGO A;  2XT9 A;  4YHH O;  4UB6 Z;  1Q6H A;  2NN4 A;  3E8G A;  2DMX A;  4JI3 O;  3CC2 V;  4UCT A;  2M7W A;  4JI1 O;  2PGG A;  1YTF D;  4KP4 A;  4CH3 A;  2UUB B;  4J7K A;  3BCC H;  1BL8 A;  1XNQ B;  4CZZ A;  4Z1M G;  3JAK B;  3P32 A;  4DR7 O;  4LFA B;  2DYR B;  3RGB A;  1GN6 A;  2HEP A;  4TUY B;  4O2B A;  2HFE C;  5CA0 B;  1EZJ A;  1V55 B;  1QVG U;  3S3W A;  3R65 A;  4J7J A;  2JJ2 G;  5CBG A;  2RJZ A;  1FXK C;  3CRM A;  2MW2 B;  1QBZ A;  5BXZ A;  3H01 A;  1GAX A;  1FFT B;  1KKC A;  3T4Z A;  1N33 B;  1WJZ A;  4IHJ A;  1SQG A;  4IL6 Z;  1FXH A;  4QE9 A;  4UCS A;  1Y6X A;  4GLX A;  2XAG A;  2QTS A;  5B1A B;  1VQP V;  4MVU A;  1G6U A;  3DSQ A;  4KXR A;  2QKC A;  1VF7 A;  1JMK C;  1NR1 A;  2DYS B;  5C93 A;  2L6L A;  4DUY O;  4KFM A;  4NXM B;  2QA4 V;  4NB5 A;  5B3S B;  5EYP A;  4UXN A;  3STZ C;  1JJ2 U;  1VQ8 V;  1TUB A;  3RBZ A;  4U3J B;  2KG7 A;  4UCV A;  3JAT A;  4J80 A;  1NVP D;  1AR1 B;  1R73 A;  5B5E Z;  2Q0O C;  3T1C A;  2B1I A;  3ZJZ A;  2K9P A;  1IZ3 A;  1NS1 A;  1VF6 A;  1FJG O;  2LFR A;  2WLJ A;  4D7T A;  1W0K G;  2NNU A;  1Q81 W;  4DR7 B;  4WCE V;  2YDE A;  5J2T A;  2KSD A;  1M56 B;  2YEV B;  4O4L B;  1TUE B;  2CTQ A;  3HB3 B;  3E8H A;  2WAM A;  2UXC O;  5GTI Z;  4ZI7 B;  3IAY A;  3CCQ V;  5LBQ A;  3K0G A;  3AG2 C;  5LXT B;  3OM3 B;  4TQF A;  1BQ0 A;  1JJO A;  4X66 B;  2WA4 A;  1MSW D;  1RM1 B;  4CS4 A;  2EZP A;  3ABM C;  1XQ8 A;  4J7Z A;  1MG1 A;  1GM8 A;  2LFS A;  4FFK A;  2LP7 A;  5J9P C;  5B3S C;  4B3T B;  1PD3 A;  1T5E A;  3G71 V;  2X6A A;  5IJ9 B;  5KHJ A;  3EFF K;  4H0L B;  3KCY A;  4I50 B;  2EIM B;  1XI1 A;  1L0L H;  1BQZ A;  4JYA B;  1NU1 H;  1JX9 A;  1Q90 D;  2JJ1 G;  3GWO A;  5EK0 A;  1UPG A;  2LQT A;  5LGT A;  2ZM6 O;  4WFH A;  2WSS G;  5IYC O;  2PTM A;  2L35 A;  2OCC B;  4K0K O;  4LNU A;  1NTK H;  4X62 B;  1LNQ A;  3K0D A;  4PI2 A;  3M8A A;  1H8H G;  4LFC O;  1SRY A;  2A0L A;  3SYP A;  5CA1 A;  2HHH O;  3OTF A;  3CS5 A;  2ZQM A;  4FZ0 A;  3BHP A;  3C90 A;  5CN0 A;  2ATK C;  1YF2 A;  2BOC C;  2O57 A;  3T1H O;  3N2G A;  4DR4 O;  3SPC A;  4B7K A;  5L3C A;  2RQ6 A;  5FNV A;  1GN2 A;  4FJC C;  4NXN O;  4X1K B;  3CRA A;  2ZNJ A;  4J9Y B;  1N4C A;  2ZIO A;  4B3R O;  5EIB D;  3AG1 B;  1AJP A;  4DV3 B;  1NVP B;  1YJW V;  5A2Q N;  4GT1 A;  2A9H A;  4GX2 A;  1WB7 A;  3THO A;  3ABM B;  1HNW B;  1PL4 A;  1VEW A;  3LSS A;  4FFB B;  5LA6 B;  4R50 A;  3ZRS A;  4FZ1 A;  5CB4 A;  4J9Z B;  2R70 A;  2C2A A;  1YHQ V;  4PI0 A;  5KHK A;  1OCR C;  2GSM B;  5DM6 V;  4TV9 A;  3ZRV A;  1NH2 D;  3CX5 F;  1Y74 A;  1PKX A;  5ITZ A;  2ZM6 B;  1GM7 A;  2Z5U A;  4TQD A;  3H1H H;  4PDM A;  3FB6 C;  5JWP A;  3T1Y B;  3JAS B;  4PEL A;  3SJA C;  3I56 V;  2LJ2 A;  4I9W A;  1CXZ B;  1AI4 A;  5EZY A;  1SES A;  2XAJ A;  2CUG A;  4JI4 O;  5IDJ A;  2QM4 A;  3SPH A;  4J10 A;  5K1X A;  2NLJ C;  2JGD A;  1R6T A;  2HJF C;  3B40 A;  5ITZ B;  1MZE A;  2N05 A;  1Q5O A;  3TCU A;  1WPB A;  3JAM N;  1R3L C;  5C8Y A;  1OCC C;  2UXB O;  3DTU B;  1N32 O;  4HNA B;  1FFX B;  1K4D C;  1H2N A;  2ZR3 A;  1XMO B;  3MAQ A;  1V54 B;  3B8N A;  5J2U B;  1BHA A;  3JD3 A;  2WLL B;  3JAL A;  2ZE7 A;  2UXD B;  1W59 A;  1P49 A;  4QE7 A;  1I94 O;  2R72 A;  4MVZ A;  1SQP H;  3OR7 C;  3TET A;  2DN9 A;  3W7T A;  2F95 B;  1VQK V;  3ABK B;  4LH6 A;  1F51 A;  4O4I B;  4PDL A;  3PN1 A;  1E1Q G;  4P2Z A;  4BR6 A;  2GBO A;  2R9R B;  1QHT A;  2F93 B;  4IIJ B;  1YEW A;  1DLB A;  1BZK A;  4RO2 A;  4U7O A;  4JTD B;  4O4H A;  3L9D A;  1Y66 A;  4DUY B;  4P30 A;  2IJH A;  1EZV H;  2Y4T A;  2WLK A;  4O4J B;  5E79 Z;  4X9Q A;  2EZO A;  2WLN A;  3RYC B;  4CC5 A;  4NKG B;  3B2E E;  3E8B A;  4F6R B;  3CC4 V;  5H5N A;  2CTR A;  1SQV H;  5LMN B;  1CEZ A;  3B8M A;  1QR8 A;  4NTX A;  3CCE V;  4ZBM A;  5EYP B;  2OT5 A;  3SR2 C;  3RWR D;  1VIB A;  4NXM O;  3L74 H;  3AK3 A;  1BS3 A;  2DQ0 A;  3R66 A;  1DF4 A;  5CB4 B;  3FAV B;  4PA4 A;  2YXH A;  2H3O A;  2DWD C;  3BA8 A;  1WA8 A;  2ZXW C;  3BEH A;  2YEV A;  1B3Q A;  2VWJ A;  3GB7 C;  1XMO O;  4JI0 B;  1E1R G;  5IY5 C;  1OCZ B;  2DWE C;  4JI5 O;  3RYI B;  3N2K A;  3VOU A;  3UT5 A;  4MW8 A;  2FYU H;  2B1G A;  2Z0A A;  3T1Y O;  3K03 A;  1PPJ H;  3ASO C;  5B1N A;  4JAA A;  3JAL B;  3AK1 A;  2JRI A;  3OAA G;  1URF A;  3PJS K;  4G27 B;  4DK1 A;  1QCE A;  3BVO A;  4IHJ B;  4JI0 O;  3T1H B;  5EC2 C;  4DUZ O;  3K5L A;  4F4L A;  2IH1 C;  3ZMV A;  1N0N A;  3HKC B;  3TGU H;  4NTW A;  1MAB G;  3WB0 A;  3JSN A;  4DV7 O;  5KHI A;  3ICX A;  3K5N A;  3CJH B;  5IWA O;  1HDJ A;  5LHI A;  1L0N H;  2EIN C;  3P3N A;  4GX1 A;  1B6Q A;  1YJN V;  4UCU A;  1JQ0 A;  5BR8 B;  1XHX A;  1K9M W;  1WPX A;  3H1I H;  1IBL B;  1K4C C;  4TSF G;  2X0L A;  5JCO A;  4WFF A;  4JAU A;  3G6B A;  3APO A;  4FLZ A;  1IVS A;  5IY5 B;  1F23 A;  4PD4 F;  2LW7 A;  5D5Q A;  1SER A;  3STL C;  3ZED A;  4B7E A;  2ZDI C;  5KX5 A;  1YCI A;  2UXD O;  2ZKO A;  4IYI A;  3CC7 V;  2OTL V;  1VF5 B;  1Z5V A;  2Q7G A;  4LFB B;  2BTQ B;  2EIJ B;  2Y48 A;  1QVF U;  3OEH G;  3X2Q C;  1U96 A;  4LBE C;  2EX3 A;  3AG2 B;  1MMM A;  5DED A;  4B3M O;  3K79 A;  1N32 B;  1OJH A;  2Y0P A;  1I08 A;  3JD1 A;  1Y76 A;  1RM1 C;  1MZF A;  3FAV A;  3CSX A;  2HG5 C;  4LF6 O;  2QKA A;  3FKS G;  4X20 A;  4P9O A;  3JCZ A;  5JH7 A;  4JV5 B;  5GON B;  1KBH A;  3T4D A;  1AI5 A;  4JI5 B;  1L8D A;  1VQO V;  1TGO A;  3CP1 A;  2Q68 A;  4MTF A;  2UU9 B;  4JI1 B;  1JA8 A;  2JS3 A;  4LF5 O;  3JAW B;  2ILM A;  2WLL A;  1ZTE A;  4CH5 A;  1K5Q A;  2JEX A;  3T2M A;  3FFQ A;  2BTO A;  4Z1V A;  4CS3 A;  1Q6U A;  1OV9 A;  3NXS A;  3A8T A;  5IYZ B;  2XAS A;  1HNZ B;  5H2F Z;  4IYH A;  1SC5 B;  4LR3 A;  4HNA A;  4LWS B;  3ZN0 A;  3F5W C;  2WLI A;  2VQE B;  2VWK A;  1DF5 A;  1ZL8 B;  4LF5 B;  1SQB H;  2Q69 A;  4PDR A;  1JPX A;  5IJ9 A;  3N2K B;  4XDL A;  3ETQ A;  3ZMZ A;  1Z5W A;  5E1A C;  1IBK O;  1YI2 V;  3FX7 A;  1Y67 A;  2EIM C;  4X1Y A;  1Z2G A;  1IXB A;  4R8C A;  4DV4 B;  4CS2 A;  3KZI Z;  4BW9 A;  2QGN A;  3OE7 G;  3UKM A;  4C7U A;  3OTO O;  4L8J A;  4BAY A;  4OX9 B;  4GKK O;  3E83 A;  1JFF B;  4UVB A;  4K8Z A;  3UO3 A;  1X4T A;  3RVY A;  4TUY A;  2CGN A;  3ZN1 A;  4DR6 B;  2IBZ H;  3JAW A;  1NI8 A;  1B06 A;  1VMG A;  5HFL A;  1UFI A;  1OCO C;  3ZIA G;  4DW0 A;  3W7S A;  3ABT A;  2HVJ C;  3SYA A;  1G1X B;  5GTH Z;  5KUM A;  1XMQ B;  2CDY A;  3CD6 V;  3HKB B;  2H94 A;  1FPO A;  1NH2 B;  2GTS A;  4CH6 A;  4BW5 A;  4LFA O;  1S5L Z;  3OD4 A;  4X62 O;  1N0J A;  4X89 A;  3W7W A;  1HR0 O;  3APQ A;  2PUS A;  1ZL8 A;  3ABK C;  3UO2 A;  3ABU A;  2LO1 A;  3ZCC A;  2UXN A;  3OGC C;  4G28 B;  3SYC A;  4JYB A;  5CA3 A;  5JH7 B;  1KB9 F;  4LF8 O;  1D5A A;  4I5S A;  3ZMU A;  3K59 A;  2DYS C;  4O4H B;  3CCJ V;  1ZAU A;  2Q5Z A;  3ETE A;  1O9G A;  2P67 A;  2XTA A;  4ZI7 A;  1AB3 A;  1HR0 B;  1IBM B;  5FPO A;  2F43 G;  1PNL A;  4ABM A;  4PV1 B;  4X1I B;  1N34 B;  5LP6 A;  4YJ2 B;  1K97 A;  1M9N A;  2F66 C;  5B1B C;  1K34 A;  1TAE A;  4FPP A;  3EVK A;  3SJB C;  4X66 O;  4DV6 B;  1JCH A;  3ZHU A;  2Q4P A;  3A0B Z;  2FML A;  2B5U A;  2EIN B;  4DK0 A;  1S5J A;  2HP8 A;  1R3J C;  2W6J G;  1SQQ H;  1US6 A;  3VQW A;  5CBH A;  5KA5 A;  4GKJ B;  2IU0 A;  2BSK A;  3D3I A;  3ZHV A;  1S0V A;  1R3K C;  2UUC O;  2XND G;  2OWO A;  1K92 A;  3CRQ A;  1D2D A;  5FNV B;  1XMQ O;  3OW2 U;  1BHB A;  4N21 A;  4RUE A;  3RYH A;  1IBL O;  3TJT A;  3QO7 A;  2M6Y A;  2YID A;  3AG7 A;  1UJW B;  4UV8 A;  3QG5 A;  2CTW A;  3CCM V;  3ZX6 A;  4JI6 B;  2R9I A;  2QWO B;  4O2B B;  4I4T B;  2WLI B;  1K5S A;  3ASO B;  3UM7 A;  3A0R A;  4LP8 A;  4OX9 O;  4PHZ A;  2PYL A;  4JZ2 A;  1WP7 A;  3RYI A;  1ORQ C;  3UCS C;  2A3Q A;  1NJI W;  3AG3 C;  1OZ0 A;  1VQL V;  3L73 H;  4I55 B;  3ZBH A;  3HKD A;  3BPZ A;  4MT8 A;  2FL4 A;  1F4N A;  3FYE B;  4O2A A;  4DV4 O;  3CCR V;  2H8P C;  1GM9 A;  4MSW C;  4YIO A;  1I0H A;  5LHG A;  5J2T B;  4YY3 B;  3HKC A;  1RSO A;  3OEE G;  5IYD O;  2Y0I A;  2JS5 A;  4X65 O;  3AG1 C;  2JEU A;  1AVM A;  3RYH B;  3FYI B;  4RQE A;  1FXV A;  5CA1 B;  3ABL C;  2QKS A;  1GKF A;  1XIL A;  1AJN A;  4W4L A;  4UVA A;  4Q20 A;  1U97 A;  1H2S B;  4I0X A;  2EJR A;  2ODM A;  3F7V C;  4DYL A;  4EKW A;  2RN9 A;  4LF9 O;  3QTC A;  3CXH F;  3IFX A;  1KKD A;  2AHY A;  1WA8 B;  3JAR B;  1B04 A;  2Q6A A;  4QIW F;  5AG2 A;  4UFZ A;  2YIB A;  1R6N A;  2OIG A;  1N36 O;  2IJK A;  2G38 A;  4JI2 O;  3AG3 B;  1QLE B;  1M93 A;  3H1J H;  4JTA B;  1AI6 A;  2E5L O;  1FXK B;  2E5L B;  2HR3 A;  3IC9 A;  3WB2 A;  2X7R B;  2XOK G;  3K04 A;  4JI7 B;  2Z3Y A;  3VQX A;  5TIS Z;  4I0X B;  4YJ2 A;  1X59 A;  4KL1 A;  2CAZ C;  4DO2 A;  4B3M B;  1R6K A;  3B77 A;  3TXS A;  3K9S A;  4O4I A;  1GN3 A;  1NTM H;  3WFV A;  3LSU A;  4JV5 O;  4TOI A;  1NKD A;  1OCZ C;  3SPG A;  4Z2W A;  1FD9 A;  1BT8 A;  3OMN B;  3K5O A;  2YI8 A;  4LC1 A;  2X6B A;  2GDS A;  4I7Z B;  3B4S A;  2QM8 A;  1S3J A;  1FKA O;  1S77 D;  5JVD B;  3QO8 A;  4ZHQ B;  4YIP A;  1JFF A;  3ASN C;  2OCH A;  1VQ5 V;  1PV0 A;  3JAR A;  2JDI G;  1Y76 B;  3CCS V;  4RUF A;  3NR7 A;  4FK5 C;  5BZB A;  1ZWI C;  1GN4 A;  5IYZ A;  3ML0 A;  3G6E V;  4FM0 A;  4X20 B;  1S5H C;  1VP7 A;  3K58 A;  5JJJ B;  3CMA V;  4X88 A;  3OMI B;  3E22 B;  4JI2 B;  3P30 A;  4NVP A;  5K1P A;  4DUZ B;  5LMU O;  1J5E B;  3GVM A;  4IIJ A;  2ZE5 A;  2IH3 C;  3JAT B;  1YZB A;  2GUZ B;  2LGQ A;  4K0K B;  2QWP B;  3A2F A;  4FLX A;  5L3G A;  3CRR A;  3G80 A;  2QWQ B;  4CH4 A;  1RP3 B;  1YIT V;  2UXB B;  3SYQ A;  1EBO A;  1DTO A;  3ZHQ A;  4JGS A;  1SZT A;  1NTZ H;  1BE3 H;  3B09 A;  3Q4H B;  3ZHT A;  5H6Q A;  4B3S O;  1GK9 A;  1TUB B;  3M99 B;  3ETG A;  5F2V O;  4U3J A;  1TA8 A;  3WG7 C;  1THZ A;  4HZ3 A;  1ENV A;  4GKJ O;  1QQC A;  4JTC B;  3ZRX A;  2KQX A;  1AP6 A;  4CC6 A;  3I55 V;  3OR6 C;  4B3S B;  2YC0 A;  3U0Z A;  3BA9 A;  2CH7 A;  3KCX A;  3SPJ A;  4ZIB A;  2OCC C;  3EXA A;  3AG4 B;  1H2K A;  3RN4 A;  3CCU V;  1I7F A;  3ZS8 C;  4DR2 O;  1ZLZ A;  2WPD G;  3IGA C;  2UXC B;  4YXW G;  2JGU A;  5LMU B;  1J5E O;  4WBN B;  4ZKI A;  2WA3 A;  1XOU A;  3K9A A;  4FFB A;  2DQ3 A;  2DYR C;  2BOB C;  4HYO A;  1AP5 A;  3F7Y C;  4A5U B;  4YHH B;  4ZOL B;  3EHB B;  3L71 H;  1R1B A;  4DV0 O;  2YIB D;  4MTO A;  4LWS A;  4WF9 V;  4K3A A;  4PA7 A;  1E79 G;  2ZD9 A;  3JAS A;  3JD2 A;  5LMN O;  2WLH A;  4FLW A;  4FLV A;  2BSK B;  4DV2 B;  1AI7 A;  3D3Q A;  2QWR B;  4I50 A;  4PDV A;  4DV1 B;  2MK3 A;  4DV1 O;  1H38 A;  3S3X A;  2QDO A;  5IWA B;  1PP9 H;  4LFC B;  5EC1 C;  2PYJ A;  1M1K W;  4FMT A;  4X8A A;  1M4U A;  3VQY A;  1RFY A;  4D6T H;  2E3C A;  4MVO A;  1I5X A;  4JYC A;  2V4D A;  4LCU C;  4FM1 A;  4DV0 B;  3J7A U;  5KA6 A;  1HWY A;  1YVW A;  2ITD C;  5EBM C;  1WP8 A;  3SYO A;  2RCV A;  3IC7 A;  4H13 B;  3H1K H;  4J11 A;  1XRE A;  1VQN V;  3RFR A;  1IDS A;  4MVM A;  2F1M A;  3SJC C;  4X1I A;  1MOF A;  3OFN G;  5KAI Z;  5JCO C;  4BIZ A;  1M90 W;  3C3S A;  4B3T O;  3KG2 A;  3BY6 A;  1K3E A;  4QJF B;  4OPA A;  2PI5 A;  3LDD A;  5DN6 G;  3C3T A;  3RYF A;  2Y4U A;  1GO3 F;  1FXK A;  3RYF B;  3D36 A;  4X1Y B;  3DGE A;  2ZE8 A;  1SET A;  1KYO F;  4OGQ B;  1G4Y B;  2P4V A;  1WB8 A;  1VQ7 V;  2GUZ A;  2XAQ A;  3QF7 A;  4JI8 B;  3WB1 A;  1ARO P;  1PM9 A;  2ZNI A;  1XNR O;  5LGN A;  2OIE A;  4EB6 B;  1AIL A;  4TV8 A;  2Q7E A;  4ASU G;  2UUA B;  5GON A;  2ZIM A;  3LNM B;  1H2G A;  2IJJ A;  1TVK B;  1Q86 W;  1BCC H;  2E76 B;  4B3R B;  4AI8 A;  4DV3 O;  2JGD B;  2PI4 A;  3ZMT A;  4GZR B;  3ETD A;  1W2B U;  1L1F A;  5HFM A;  1KC8 W;  2BCC H;  4WBN A;  4MVR A;  2WWW A;  4UUJ C;  3W7X A;  2UXX A;  4PA9 A;  2EIL C;  3BAB A;  4DR3 B;  4DR3 O;  3BAA A;  5CA0 A;  2NR5 A;  4DR5 B;  3H9V A;  3ZHS A;  3RYC A;  4GX5 A;  1DGS A;  2PY5 A;  1M5I A;  3JCU Z;  2IU3 A;  3LNN A;  2QWN B;  2V7Q G;  2AZ2 A;  2CK3 G;  1K8A W;  1PNK A;  3O65 A;  1YTF B;  5L3D A;  3ASN B;  1Y74 B;  3U10 A;  1XL4 A;  5FLX N;  4I9Q A;  3JYC A;  4JYA O;  3ABL B;  1Q43 A;  4AQY B;  2LW1 A;  1JR9 A;  2HHH B;  1QNM A;  2QEX V;  1K33 A;  3HKE A;  3CJH A;  2CH7 B;  1MNG A;  3D36 C;  5FL7 G;  4P9P A;  2KB1 A;  5LOV A;  1N33 O;  3DC5 A;  5D5P A;  3G4S V;  2P7T C;  2JVD A;  1Y4M A;  3TK1 A;  5IT9 N;  1XHZ A;  2GV9 A;  4AHC A;  4FIP C;  1COW G;  5B1A C;  5LP6 B;  2F23 A;  2HVK C;  1IUR A;  4LF6 B;  3K3W A;  2F4V B;  3RW0 A;  3SGI A;  5B66 Z;  1P7B A;  2IM9 A;  2B9Z A;  1H2L A;  2N74 A;  2EUL A;  4TV9 B;  2YXL A;  1FYJ A;  1LUW A;  4NYK A;  4E2L A;  3CXC U;  2YXY A;  2KKW A;  3E2E A;  4MTX A;  2VRZ A;  4FLU A;  3K5M A;  1EM1 A;  4EEQ A;  1GRJ A;  1VQM V;  2Q0A A;  2UUA O;  2Y69 B;  1D5N A;  1Q3E A;  4PJ0 Z;  4R7C A;  5GW7 A;  1ROP A;  2RDC A;  4YJ3 A;  1W0J G;  1NQT A;  5BMV A;  4DV5 B;  1G8M A;  4HAM A;  1CP9 A;  2ITC C;  4I4T A;  5B1O A;  2VQE O;  2IW5 A;  2ARH A;  1RPR A;  4G2K A;  1IX9 A;  3AG4 C;  1MSD A;  5L3E A;  4K35 A;  5LP6 C;  1O9H A;  2EJ7 A;  1YIJ V;  4DR4 B;  2K1E A;  4KUM A;  3G67 A;  4FVM A;  2PZS A;  4RQF A;  3ZMS A;  1IBK B;  1XDC A;  3HPL C;  3MHH C;  3CPW U;  3L72 H;  4LF7 B;  4LF7 O;  1GH6 A;  3AK2 A;  4L87 A;  4PA6 A;  4DR1 B;  1YXB A;  2YS8 A;  5LXT A;  4JI4 B;  4WFE A;  4DV2 O;  3GWK C;  5KLV H;  4F6R A;  4MVS A;  2ZT9 B;  1H8E G;  1SS3 A;  3TXQ A;  1Q7Y W;  2Q8V A;  1SKV A;  4BWA A;  5JQG B;  4DV5 O;  5EIB C;  2YUA A;  3LDC A;  3K06 A;  2Q9L A;  1P7G A;  3UT5 B;  5BR8 O;  5H9C A;  4GX0 A;  3RT3 C;  5LOV B; 
#chains in the Genus database with same CATH homology
 3CMA V;  1FXK C;  4X88 A;  3OMI B;  1QLN A;  3P30 A;  1K9M W;  1WPX A;  1QBZ A;  1NBM G;  3H01 A;  1FFT B;  2YSU B;  2IH3 C;  1K4C C;  3QO5 A;  4JAS A;  2X0L A;  2XAH A;  4TSF G;  4WFF A;  3FB8 C;  3T4Z A;  4JAU A;  1OCR B;  1FXH A;  4QE9 A;  1F23 A;  5IY5 B;  5L3G A;  5EBL C;  2XAG A;  5B1A B;  1VQP V;  1SER A;  4MVU A;  3STL C;  1YIT V;  2ZDI C;  3SJQ C;  3SYQ A;  1EBO A;  1DTO A;  1NR1 A;  2Q67 A;  4QNH B;  2DYS B;  5C93 A;  4JGS A;  3CC7 V;  1SZT A;  2OTL V;  4KFM A;  2QA4 V;  5B3S B;  5H6Q A;  1GK9 A;  2QE7 G;  4UXN A;  3STZ C;  1JJ2 U;  3VBB A;  1VQ9 V;  2OTJ V;  1VQ8 V;  3M99 B;  3ETG A;  3RBZ A;  2EIJ B;  2Y48 A;  3ZRW B;  2QTO A;  1QVF U;  3WG7 C;  1THZ A;  3OEH G;  3X2Q C;  4HZ3 A;  1NVP D;  1AR1 B;  1ENV A;  1QLE C;  4LBE C;  1S72 V;  3AG2 B;  3K79 A;  1R73 A;  1YSC A;  3JD1 A;  3T1C A;  2X6C A;  1RM1 C;  4JTC B;  2B1I A;  3ZJZ A;  3ZRX A;  2FTK A;  2LFR A;  3I55 V;  2HG5 C;  2WLJ A;  3OR6 C;  2ZR2 A;  4QPJ A;  1W0K G;  2NNU A;  3FKS G;  1Q81 W;  4P9O A;  3JCZ A;  5H6R A;  1AI5 A;  3T4D A;  4WCE V;  2JIZ G;  1S76 D;  3SPJ A;  1VQO V;  1M56 B;  1FS0 G;  2OCC C;  2YEV B;  3AG4 B;  1F4M A;  4XBF A;  3CCU V;  1TUE B;  4MW3 A;  3HB3 B;  3CP1 A;  2Q68 A;  2WAM A;  3E8H A;  4MTF A;  4XDJ A;  2P6J A;  2WPD G;  3IGA C;  4RAI A;  1KEC A;  4YXW G;  3CCQ V;  3E35 A;  5LBQ A;  3K0G A;  3AG2 C;  3MHS C;  1VQ4 V;  3OM3 B;  2WLL A;  4ZKI A;  3K9A A;  2QM7 A;  2DQ3 A;  1K5Q A;  1P4R A;  2BOB C;  2DYR C;  3MD0 A;  2JEX A;  4HYO A;  1RM1 B;  1MSW D;  3T2M A;  3F7Y C;  3EHB B;  2EZP A;  3ABM C;  1OCO B;  1MG1 A;  3JD4 A;  1GM8 A;  2LFS A;  3NXS A;  4MTO A;  2LP7 A;  2XAS A;  5J9P C;  4WF9 V;  1YJ9 V;  5L3F A;  3ZN0 A;  5B3S C;  4PA7 A;  3F5W C;  1E79 G;  2ZD9 A;  2WLI A;  1PD3 A;  1M56 C;  3JD2 A;  3G71 V;  2WLH A;  1DF5 A;  2X6A A;  4BIU A;  3EFF K;  4PDR A;  2Q69 A;  1JPX A;  1AI7 A;  5IYB O;  4XDL A;  2EIM B;  3X2Q B;  3ZMZ A;  4PDV A;  5E1A C;  1YI2 V;  2MK3 A;  2EIM C;  1H38 A;  1YJN V;  1JX9 A;  2JJ1 G;  3GWO A;  5EK0 A;  4R8C A;  4TWK A;  2EIL B;  2IJI A;  5EC1 C;  1M1K W;  4R6Z A;  3OE7 G;  4FMT A;  4X8A A;  5LGT A;  4QPK A;  3UKM A;  4WFH A;  2WSS G;  4BAY A;  5IYC O;  3E83 A;  4UVB A;  2OCC B;  4MVO A;  1GMG A;  1I5X A;  4JYC A;  3RVY A;  4LCU C;  3ZN1 A;  1CPY A;  1LNQ A;  5KA6 A;  1HWY A;  3K0D A;  2ITD C;  5EBM C;  5HFL A;  1OCO C;  3ZIA G;  4GCZ A;  2P90 A;  1H8H G;  3W7S A;  1SRY A;  2A0L A;  2Y69 C;  3SYP A;  3ABT A;  3SYO A;  1V55 C;  2HVJ C;  3SYA A;  4XDK A;  4UV9 A;  2ZQM A;  3IC7 A;  5CN0 A;  5KUM A;  2ATK C;  2HKO A;  2BOC C;  4H33 A;  1VQN V;  3CD6 V;  2H94 A;  3E86 A;  1NH2 B;  3CYO A;  4MVM A;  3SPC A;  4BW5 A;  5L3C A;  1MOF A;  3OFN G;  3AEI A;  4FJC C;  4X89 A;  3W7W A;  1M57 B;  3QNE A;  3ABK C;  3ABU A;  4BIZ A;  1M90 W;  4J9Y B;  1KP2 A;  3KG2 A;  3BY6 A;  1K3E A;  3AG1 B;  2UXN A;  1AJP A;  1GTO A;  3FB5 C;  3ZCC A;  4QJF B;  3OGC C;  4G28 B;  3LDD A;  4JYB A;  3SYC A;  5CA3 A;  1YJW V;  1NVP B;  5DN6 G;  4GT1 A;  4I5S A;  2A9H A;  1GO3 F;  4GX2 A;  5LHH A;  1FXK A;  3ZMU A;  2DYS C;  3D36 A;  3ABM B;  1QR9 A;  3DGE A;  3CCJ V;  3LSS A;  1SET A;  4R50 A;  1G4Y B;  3ZRS A;  4UVC A;  3OUF A;  3ETE A;  2HLD G;  4MVQ A;  1VQ7 V;  2P67 A;  4J9Z B;  2C2A A;  1EFR G;  1YHQ V;  2XAQ A;  1PL0 A;  2F43 G;  1PNL A;  1JVM A;  2ZXW B;  3CCV V;  1ARO P;  1OCR C;  2GSM B;  2W0F C;  5DM6 V;  1K97 A;  3ZRV A;  3CCL V;  1NH2 D;  5LGN A;  1M9N A;  1PKX A;  5B1B C;  1R3I C;  1GM7 A;  1K34 A;  4JAV A;  4ASU G;  4FPP A;  2Z5U A;  5CBF A;  2EIK B;  1WLE A;  5KUK A;  5EBW C;  3LNM B;  2AHZ A;  3E89 A;  1JCH A;  1H2G A;  3JD0 A;  2B5U A;  4PDM A;  2IJJ A;  2EIN B;  3FB6 C;  4CBC A;  1R3J C;  2W6J G;  3SPI A;  4WFG A;  4PEL A;  1Q86 W;  1J95 A;  3I56 V;  5CBH A;  4I9W A;  3K08 A;  1AI4 A;  5KA5 A;  2GHY A;  2IU0 A;  2WLM A;  2XAF A;  3D3I A;  1SES A;  2XAJ A;  1S0V A;  1R3K C;  3ZRW A;  3ZMT A;  2XND G;  2PI4 A;  1K92 A;  5IDJ A;  3LSQ A;  3SPH A;  3ETD A;  2NLJ C;  1W2B U;  4MTG A;  1K7D A;  1L1F A;  3OW2 U;  5HFM A;  1BHB A;  4N21 A;  2HJF C;  4RUE A;  1KC8 W;  3QO7 A;  1XL6 A;  4MVR A;  1KQS U;  2WWW A;  4UUJ C;  1UJW B;  4UV8 A;  3W7X A;  2UXX A;  4PA9 A;  3TCU A;  2EIL C;  3CCM V;  2R9I A;  4JF3 A;  1R3L C;  4WFB V;  1OCC C;  2WLI B;  4WFA V;  1I5Y A;  3DTU B;  1K5S A;  4GX5 A;  3CME V;  3ASO B;  1K4D C;  2ZR3 A;  3UM7 A;  2IU3 A;  3A0R A;  2V7Q G;  4LP8 A;  3RVZ A;  1RPO A;  1V54 B;  2D3O W;  3B8N A;  5CMU A;  2CK3 G;  1K8A W;  2EBO A;  1ORQ C;  1PNK A;  3E8F A;  1M57 C;  1NJI W;  3AG3 C;  1V54 C;  1OZ0 A;  3LDE A;  1YTF B;  1VQL V;  1BHA A;  5L3D A;  3JD3 A;  5LGU A;  3ASN B;  2WLL B;  2PI5 A;  1XL4 A;  3JYC A;  4MT8 A;  3ABL B;  3OUS A;  1F4N A;  3FYE B;  2EIK C;  4JPR A;  2H8P C;  1GM9 A;  4MSW C;  3CCR V;  2QEX V;  4QE7 A;  1K33 A;  1OCC B;  1N8R W;  1VQ6 V;  5LHG A;  4MVZ A;  5FL7 G;  3OR7 C;  4P9P A;  3TET A;  2KB1 A;  3W7T A;  1VQK V;  2V1D A;  4OXS A;  3ABK B;  1Q82 W;  1F51 A;  4PDL A;  3OEE G;  1E1Q G;  4P2Z A;  5IYD O;  2A79 B;  2R9R B;  3AG1 C;  3G4S V;  2DW4 A;  2P7T C;  1DLB A;  4RO2 A;  4U7O A;  1NR7 A;  4JTD B;  1Y4M A;  5B1B B;  3TK1 A;  2JEU A;  3FYI B;  1COW G;  3FB7 C;  4FIP C;  5B1A C;  4RQE A;  2ZDI A;  3W7U A;  1Y66 A;  1FXV A;  4H37 A;  1K73 W;  2HVK C;  3ABL C;  2QKS A;  1GKF A;  1AJN A;  4UVA A;  3K3W A;  4P30 A;  2IJH A;  4Q20 A;  1KD1 W;  3RW0 A;  1KP3 A;  2EJR A;  2WLK A;  4N23 A;  3F7V C;  4EKW A;  1P7B A;  2EZO A;  2WLN A;  3IFX A;  1KKD A;  2AHY A;  4PA3 A;  3E8B A;  4MS2 A;  4E2L A;  3CC4 V;  2W6I G;  2Q6A A;  4QIW F;  3CXC U;  1AJQ A;  3E2E A;  4MTX A;  1R6N A;  1JOY A;  1BMF G;  2EIJ C;  3LUT B;  1CEZ A;  2IJK A;  3B8M A;  1QR8 A;  3CCE V;  3AG3 B;  1QLE B;  4TT3 G;  4ZBM A;  1VQM V;  1PNM A;  2OT5 A;  2Y69 B;  3OMA B;  4JTA B;  2DQ0 A;  1AI6 A;  1FXK B;  1DF4 A;  2HR3 A;  4R7C A;  5GW7 A;  4U7N A;  1ROP A;  2X7R B;  2XOK G;  3K04 A;  4PA4 A;  2Z3Y A;  1W0J G;  1OHH G;  1NQT A;  1G8M A;  4HAM A;  1CP9 A;  2ITC C;  4DO2 A;  1R6K A;  3B77 A;  2DWD C;  2IW5 A;  5B1O A;  3WG7 B;  1RPR A;  4G2K A;  3AG4 C;  2ZXW C;  3BEH A;  2YEV A;  3GB7 C;  5L3E A;  5L3B A;  1YIJ V;  1E1R G;  2K1E A;  2JK5 C;  5IY5 C;  4KUM A;  1OCZ B;  1IXM A;  2DWE C;  3VOU A;  3WFV A;  4MW8 A;  4DXW A;  3ZMS A;  4RQF A;  2B1G A;  3HPL C;  3MHH C;  3CPW U;  1NKD A;  1OCZ C;  3K03 A;  3SPG A;  3OMN B;  3ASO C;  5B1N A;  3E8G A;  3OAA G;  4LC1 A;  4L87 A;  2X6B A;  3PJS K;  3CC2 V;  4G27 B;  4PA6 A;  2QM8 A;  1S3J A;  2M7W A;  1QCE A;  4WFE A;  1YTF D;  4KP4 A;  1S77 D;  3QO8 A;  3ASN C;  5EC2 C;  1VQ5 V;  4MVS A;  2IH1 C;  1BL8 A;  3ZMV A;  4CZZ A;  4F4L A;  1H8E G;  2JDI G;  4Z1M G;  3CCS V;  3P32 A;  4RUF A;  4FK5 C;  1Q7Y W;  5BZB A;  1ZWI C;  2DYR B;  1MAB G;  3ML0 A;  3G6E V;  2HFE C;  3LDC A;  1EZJ A;  1V55 B;  1QVG U;  3K06 A;  1S5H C;  3R65 A;  5LHI A;  2EIN C;  2JJ2 G;  4GX1 A;  1B6Q A;  5H9C A;  4GX0 A;  5CBG A;  1JQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...