2LG7A

Nmr structure of the protein yp_001302112.1 from parabacteroides distasonis
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
129
Chain Sequence
b'GDDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVYKNGKEIEKKSLVFRDGKEISTDDLNLYYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein YP_001302112.1 from Parabacteroides Distasonis
rcsb
source organism Parabacteroides distasonis
molecule tags Metal binding protein
total genus 11
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.50 Mainly Beta Sandwich Lipoxygenase-1 Lipoxygenase-1 2lg7A00
2LG7A 2LGEA
chains in the Genus database with same CATH superfamily
2LGEA 2KXVA 1IK3A 1LNHA 2WY6A 3V92A 1RP1A 2PPLA 2LG7A 1QMDA 1FGRA 3FG4A 1LOXA 2XHHA 1FGQA 3BNBA 2LRGA 3VF1A 3FG1A 4NREA 1KHOA 3BNDA 4QWTA 3V98A 1HPLA 2WXUA 1LPBB 1CA1A 3V99A 1YGEA 1F8NA 2KXTA 1FGOA 2SBLA 3BNCA 1NO3A 1FGTA 1QM6A 3BNEA 3O8YA 1W52X 1GYGA 2QZ7A 1JNQA 1ROVA 5EEOA 3U6GA 2XFDA 3IBZA 1ETHA 2OXEA 3FG3A 1GPLA 1BU8A 3CWZB 1OLPA 2P0MA 3PZWA 1N8QA 2XHJA 4WHAA 1RRLA 2IUJA 1Y4KA 4WFOA 2FNQA 1FGMA 1N8SA 2WXTA 1RRHA 2PVSA 2QNGA 4QEYA 2XFEA 2IUKA 1HU9A 1LPAB
chains in the Genus database with same CATH topology
2LRGA 2XHJA 2LGEA 3U6GA 2XFDA 4QEYA 2XFEA 2XHHA 2LG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LG7 A;  2LGE A; 
#chains in the Genus database with same CATH topology
 2LGE A;  2KXV A;  1IK3 A;  1LNH A;  2WY6 A;  3V92 A;  1RP1 A;  2PPL A;  2LG7 A;  1QMD A;  1FGR A;  3FG4 A;  1LOX A;  2XHH A;  1FGQ A;  3BNB A;  2LRG A;  3VF1 A;  3FG1 A;  4NRE A;  1KHO A;  3BND A;  4QWT A;  3V98 A;  1HPL A;  2WXU A;  1LPB B;  1CA1 A;  3V99 A;  1YGE A;  1F8N A;  2KXT A;  1FGO A;  2SBL A;  3BNC A;  1NO3 A;  1FGT A;  1QM6 A;  3BNE A;  3O8Y A;  1W52 X;  1GYG A;  2QZ7 A;  1JNQ A;  1ROV A;  5EEO A;  3U6G A;  2XFD A;  3IBZ A;  1ETH A;  2OXE A;  3FG3 A;  1GPL A;  1BU8 A;  3CWZ B;  1OLP A;  2P0M A;  3PZW A;  1N8Q A;  2XHJ A;  4WHA A;  1RRL A;  2IUJ A;  1Y4K A;  4WFO A;  2FNQ A;  1FGM A;  1N8S A;  2WXT A;  1RRH A;  2PVS A;  2QNG A;  4QEY A;  2XFE A;  2IUK A;  1HU9 A;  1LPA B; 
#chains in the Genus database with same CATH homology
 2LRG A;  2XHJ A;  2LGE A;  3U6G A;  2XFD A;  4QEY A;  2XFE A;  2XHH A;  2LG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...