2LGDA

The high resolution structure of ubiquitin like domain of ublcp1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
b'MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
publication title The High Resolution Structure of Ubiquitin Like Dom Ublcp1
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 12
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgdA00
3QA8A 2NPTA 4I6PA 1P0RA 4WWPA 5DPRA 5J18A 3ML9A 2YLMA 3ONSA 4GMVA 2J7QB 2GBJA 2LD9A 4BBNC 2KN5A 1SE9A 4MDKE 5AZFA 1WFYA 2WDTB 2LVPA 3RD2A 4FADA 1XD3B 2DAJA 2CHZA 2KFKA 2EMTA 2WX0A 3B0AA 4ZYNA 4E74A 3A9JA 4IWOA 1X1MA 1WXSA 2V1YA 4GDLB 3ZNZB 3ALBA 2DHZA 4I6NB 1ZKHA 2KQSA 2GBNA 3PTFC 2I1KA 1F9JA 3SHQA 4EZLA 3ZKJC 1I42A 3I3TB 4W9HA 4E71A 2HTHA 5J2RA 1OEYA 1V81A 2KZRA 2ZCCA 2ZNVB 2KLGA 2O2VB 4K7UA 4W9JA 1M94A 3VXWA 1C1YB 2RPQA 4HDOA 4F7ZA 5L95C 2K8HA 2KWUB 1T0YA 2GBKA 5JZEB 3DBHI 3QIJA 3MJWA 3QHTA 2N4FA 2REXA 1V86A 3R66C 3KH0A 1EO6A 2MQJA 2FCQA 3QWZB 4HPMB 4II3B 4KIKA 2KWVB 1E7VA 3HHMA 4HCPB 1WZ3A 3V62A 2A4ZA 3IG3A 2KDIA 4ICUA 2G45B 4XC2A 5D2MB 2MBEA 1J8CA 5J17A 1VD2A 3N32A 2MP2A 4K7WA 4MSMB 1GNUA 3QC8B 1WF9A 4WJPA 2BYVE 5E6PA 1Q5WB 2FUHB 2NCNA 4NQLB 3UQBA 4GU2A 4ANXA 5E6NA 3DVGX 4FBJB 3KUZA 1G6JA 1R4NI 2IO2B 2N7DA 2YVCA 2BPSA 3TIXA 3VUYA 1RAXA 2JRIB 4AJWA 1GC6A 1TGZB 2KLCA 5FR6A 2C5LC 4HXDA 2DX5B 1I35A 3KW5B 4FHKA 2DYBA 1NI2A 2C7MB 3AI5A 3KVFB 2LZ6A 3H7PB 2G4DB 3OAWA 3RULA 2BKRB 2A5UA 2ZPYA 2FAZA 2KWCA 1E8ZA 2DENB 1LM8B 2N7EA 3AULA 1TZ1A 4IWQA 3MTNB 2D11A 2N1VA 4N9F4 1P1AA 3AU5A 1J0GA 2K39A 4DWFA 4IC7B 3OJ3A 1WJ4A 5KHQA 1Y8RC 1NDDA 3TMPB 3PLUA 4HWIB 3UF8A 2FCNA 2LGDA 1WJ6A 3AXCA 1WX9A 3JW0X 2VRRB 3R3MA 4W9FA 3VTWA 3RT3B 2KTRB 1WX7A 4JGHB 3PVLA 5CHFA 3X0WA 3N30A 4X57B 4F1SA 4FULA 3KYDD 3WAPA 1WMHA 3A4SC 4K81A 2MCNB 4W9IA 1OEYJ 4HVBA 1KJTA 2DZJA 5DPSA 2BWFA 1FXTB 2NR2A 3H9DA 1LFDA 3EFUA 2M17A 4XZ4A 1WM2A 4G11A 2BYFA 2L7RA 2N9XA 2UYZB 1E8WA 2C7NB 1S1QB 3DVNV 2KMAA 2AL6A 3OLMD 3RYTA 1L7YA 3B1LX 5IA7A 1WJUA 4MJSB 3MHSD 3WAOA 4IM3A 4A20A 5C1ZA 4NJ6A 5AZHA 4K7SA 4EUTA 1P98A 1R4MI 2CHXA 2WWZA 3A33B 2ZPNA 3TBLD 2IYDB 1V80A 3U8ZA 2RD0A 3V6CB 3TL5A 4G50A 4MGYE 2G3QB 3R7QA 2DZMA 2M8SA 3VQIA 1UD7A 3HM6X 3K9PB 3L08A 2KC1A 2D10A 5TR5A 1AARA 1RFAA 3VUXA 5LXHA 5D7GA 4ANWA 2NS5A 2ZVNA 3DOWA 3A9KA 3BINA 2CU1A 2NPTB 2RSUA 3RCZA 1H4RA 3PRPB 5D6JB 1WE6A 4EOYA 5L83A 3ZNGC 4GN1A 1UGMA 4MELA 4WWNA 2MBBB 4I6LB 3A1QA 2C7HA 1U4AA 1UELA 1UZXB 2LGYA 1C3TA 2KFKB 2W9NA 3A9JB 2NBVB 2Y5BB 4BKTA 2JT4B 3OJ4B 1YIWA 3PRMB 3DBSA 5DPTA 2RGFA 2LRWA 3A4RA 2J0JA 3X23A 4DHZB 1E90A 3ENEA 2FIFA 4BOZB 4IG7B 2DYMA 3HIZA 4HLEA 3QQ8B 1YX5B 2N9PC 3L16A 1YX6B 3QCAA 1V5TA 2M1MA 1WJNA 1RRBA 3ZNHB 4MH0E 2KDEB 3SDLC 4BKGA 4GSWA 4ZRIA 4TQ0A 2KJRA 1WXAA 4WWOA 1YD8U 2AEHA 2G4SA 1Z2MA 3QX1A 4NNJB 1A5RA 1GC7A 4MGIE 2Z0EB 2KVRA 2LXCA 4AUQC 1WGHA 4W9CA 2CS4A 3CSTA 3PS6A 2JXXA 2IBIB 4AOFA 3VFKA 3NS8A 5DCNA 5C23A 3VTVA 3PLVA 2BWES 4II2B 4KIKB 4AP4C 3DDCB 4KVGB 4EEWA 2ASQA 2IY1B 4DK5A 2O6VA 4K1RB 2QHOA 3PT2B 3IBEA 4LJPB 4P7IA 2MBHA 1GG3A 1VCBA 5KHOA 3HM3A 3ZVVA 3ZW3A 4NJ7A 4ZDVA 2MP2B 1UBQA 2LVOA 3KUDB 5GMVA 2JWZA 1WH3A 3M63B 4LDTD 4KSKC 1V49A 1Q0WB 2K6QA 1E8YA 1WYWB 1EUVB 3ZTDA 3ZRCA 4BKSA 2BKFA 4G0NB 3QARA 3QJZA 1IPGA 3VAWA 1GUAB 3ZTCA 3UQAA 2DZKA 1ZW7A 3ZO5B 2MX2A 4CO7A 2KHWB 4HCNB 4NPNA 3TCAA 4LDTB 3WALA 4CHKA 4ZRJA 4NQKE 3S2AA 3T9LA 3LJ3A 3U30A 3PPAA 1LXDA 2NVUI 2MRPA 2FCMA 2M4NA 3DVNU 3GOEA 4BBNF 4FA6A 2MWSB 2FCSA 2IO1B 2KJHB 1P9DU 4J6IA 1V6EA 3IFWB 2LI5A 1WGRA 3DCGA 5IAAC 5E6OA 3H6NA 1QZEA 4URKA 2L76A 2JVCA 2LVQA 1H8CA 3APDA 1GJZA 2MW5A 2HE7A 3ZLZA 2OOBB 2NBWB 4FJYA 3RUIB 3DQVA 3GZNI 4MM3A 5JHBA 3DBLI 4WJQA 4NAWA 4HJKA 2D2QA 2KD0A 3Q3FA 4KSLC 3D32A 3VHTC 2KK8A 3PHXB 4KDIC 2V3SA 2KX3A 2XK5A 3V6EB 4E3CA 2LWPA 2KTFA 3JVZX 2AYOB 4GDKA 4MGKE 4WJNA 4TKNA 1MG8A 1WMHB 4XX5A 4GXBA 1V2YA 2PPHA 3VDZA 4YL8A 1UBIA 3KUCB 1SIFA 1SGHA 3SU8X 2IO3B 1WIAA 2KXJA 3EHVA 3L0WB 3VH3B 3WA0A 1E7UA 1ZGUB 3ZIMA 1YJ1A 1HE8A 2HJ8A 1K8RB 1KM7A 1EF1A 4DBGA 5AZGA 2MSED 2AWTA 2CKHB 1WR1A 2Z59B 1E8XA 3N3KB 4FJZA 3NY5A 4IWPA 2LXAA 3V61A 4B9KA 1JRUA 2JPHA 4JLCA 5BO4B 4ANVA 1LQBA 2BYEA 4TQ1A 3L13A 2JZ3B 4HDQA 2LASA 4MGZE 4B95A 3L54A 2JY6A 2KC2A 1ISNA 3L10B 3VVWB 2L8JA 3KYCD 1J19A 1XQQA 2KNBA 4DDID 2DZIA 1WR6E 3PZDA 3EECA 3RZWC 1Z5SB 4B6WA 4DDGD 4IM2A 3VUWA 3WAMA 2J0KA 3U7DA 2K8BA 3PV1A 3PGEA 4BOSC 4W9KA 2MBQA 4W9LA 2L0TA 1WM3A 2GMIC 5AEKB 3A9KB 1TTNA 1V5OA 2EKEC 2LJ5A 3ZDTA 2I1JA 2N1WA 1UH6A 1EF5A 4GDLA 1WE7A 2AL3A 3WANA 1WI0A 3R7RA 4M0WB 4CYEA 5HKHA 3IVFA 2KDFB 4M8MA 3PHWB 3A1QB 3APCA 2DYOA 3W1SA 2JUOA 1XT9B 2XBBC 3M3JA 3TJPA 4PYZA 4DXAB 1OTRB 1V9JA 2LUEA 4ZRKA 2C9WB 4RM8A 4ASWC 2PEAA 2ZJDA 3APFA 5LLIA 3UGBB 2O2VA 3DPDA 3Q3JA 4W9EA 3CF6E 2MA9B 2GOWA 2K6DB 3BY4B 4MSQB 2JZZA 4PS7A 5JHAA 2PJHA 1L2NA 1PQSA 4EZKA 4LJOB 3H1UA 2O6VD 3H7SA 5G55A 4DHJD 4HK2A 3UIOB 2DAFA 5CTRC 3ML8A 3VTUA 2ZVOA 4NY0A 4OVVA 1WY8A 3NZSA 2CR5A 3W1SC 3ZUNA 3VH4B 3PRZA 2D3GA 2ZZPB 4F8CB 2IZVB 4KV2A 2D07B 4IM0A 2WX1A 2O6VB 2ZNVC 3O65B 3ZNID 4KDLB 4DHJB 4RM9A 3PREA 4BKSD 2MLBA 4DHZE 1WGGA 2KDBA 5CHWA 2KOXA 4AWJA 4JL9A 5JH5C 3DBRI 2GBMA 2ZEQA 2IY0B 4KZCA 2BF8B 2XEWA 4FN2A 4JQWC 2IO0B 3WIMA 2UWQA 5D94A 3ZDMC 3W1YA 2K25A 2ZCBA 3L17A 2K1FA 2RR9A 4G3XB 3LDZE 2L05A 5EDSA 3QAQA 3H7PA 4FJVB 2PE6B 1D3ZA 1KOTA 3JYUA 1Q1OA 4W9DA 1E5WA 2B3AA 4PYUA 1KLVA 3JSVA 1OQYA 3AU4A 2L3ZA 4EKUA 1WXVA 2KKCA 3NZUA 2Z0DB 3NHEB 1WGDA 4GGQA 2K8CA 2KANA 2PE9A 4W9GA 1S3SG 2J0MA 3IHPC 3JSVB 2L00B 2JF5A 2GBRA 4BFRA 3ECIA 4AJYB 4A3OA 2EMSA 2N9EB 2LGXA 2V4LA 3ZRFA 2JRHA 3NOBA 2KTRA 1WRDB 4FLHA 2OJRA 1WZ0A 4JIOU 1IYFA 4NAWB 4OVUA 3DVGY 2LRUA 5DPWA 3M95A 4KZ0A 4MEMA 2C60A 2R2OA 2FIDA 4EFOA 3P2BA 2XK5B 3CMMB 3T8MA 2KFJA 3C0RB 4PS8A 3M62B 3K9OB 2M0XA 4GDKB 2BGFA 4IUMB 3QK0A 4HPLB 5CHVC 4A3PA 4PS3A 2WYQA 2KX0A 3PSEB 3UIPB 2KMCA 1WXMA 1TBEA 4IW0A 4WAAA 4RMAA 4EZJA 1WX8A 3V60A 2CHWA 3SD5A 2R2QA 2KJ6A 4MJSA 3RZFA 4FHJA 2MBOA 5G2NA 1YQBA 4GB9A 4ANUA 1NBFC 4TUUA 4BVUC 2KQ7A 3EC8A 2HD5B 2FNJB 1IP9A 3CSFA 4WJOA 2L0FA 1BT0A 4GOCA 4ICVA 1CMXB 1RLFA 2NBUA 4LCDE 4M8NA 5LXIB 1WGYA 4WQOB 3HK0A 3UINB 1P3QU 4GIVA 5CX3A 2KO3A 3B08A 1OGWA 4TV3A
chains in the Genus database with same CATH superfamily
3QA8A 3ML9A 2YLMA 4GMVA 2KN5A 1IGDA 2LVPA 1N61A 2DAJA 2CHZA 3B0AA 5H92C 4IWOA 1X1MA 1LO5D 2V1YA 4GDLB 4L2YA 5I4DA 1T6BX 4HPPA 1ZKHA 3PTFC 1F9JA 1E7PB 1D5ZC 1I42A 4E71A 2KZRA 3VXWA 3R2IA 1I4HA 2WXGA 3DBHI 3W2DA 2REXA 1SJHD 1V86A 1EO6A 3QWZB 2FCQA 3PZ7A 3DWMA 1WZ3A 3IG3A 1QOFA 4XC2A 2WXJA 2D3CA 3BVGA 3OG5A 1WGKA 4MSMB 2LGSA 1GNUA 3QC8B 4B0MA 1PYWD 2M19A 2IDYA 4FBJB 3KUZA 4S0RA 2W82A 1R4NI 2IO2B 5D3IB 1RAXA 1GC6A 1RWSA 1I35A 2DYBA 3H7PB 2G4DB 3OAWA 3RNBC 2X8XX 2A5UA 2FAZA 2KWCA 3AE8B 1TZ1A 5BMIA 3RMKC 2N1VA 4N9F4 1J0GA 4ZOHC 1NVID 3TMPB 4BZAA 4HWIB 3UF8A 1T5XD 2IPKD 1WX9A 4N59A 1QQRA 2PIAA 5CHFA 3N30A 1NENB 3WAPA 1WMHA 4K81A 1SXTA 4W9IA 4HVBA 2V3NA 5DPSA 2WXOA 4AS1A 2WDQB 3EFUA 2LJIA 4QAYA 1E8WA 2C7NB 2KMAA 3AEGB 3RYTA 1L7YA 3NRZA 3DWGC 3MHSD 3WAOA 2ZW1A 4NJ6A 4UDUC 4EUTA 1V1PA 1GPXA 1T0SC 3KWVA 3R7QA 3HM6X 3VUXA 4ZYSA 3BVMA 3A9KA 3BINA 2QEJC 3RCZA 1PUTA 1H4RA 4XE0A 3PRPB 2J42A 4EOYA 5L83A 4GN1A 4WWNA 2MBBB 4I6LB 4M0WA 3A1QA 2LGYA 4RFBA 3SEBA 2Y5BB 4KGSA 1YIWA 5DPTA 5G5GA 1E90A 2LFIA 3ENEA 1T3QA 4HLEA 2KWDA 1YX6B 3ABVB 2M1MA 4MH0E 2KDEB 2G4SA 1Z2MA 3QX1A 2WU5B 1F2RI 3NG0A 4AOFA 4II2B 4AP4C 1E0ZA 3DDCB 2ASQA 1ET6A 2IY1B 1FNVA 3PT2B 4OW0A 3IBEA 4MH8A 4JPSA 2E6XA 2QSDA 1ZP0B 1C78A 3HM3A 3ZVVA 3ZW3A 4ZDVA 5GMVA 2JWZA 1WH3A 1DYQA 4M02A 4OZCA 1XCTL 1FCLA 3ZO5B 1XO3A 1TS2A 1UWMA 2WS3B 4IOIE 3R8BA 3ZXVA 4XGAB 1MHHE 2ONQA 3PO0A 4BBNF 2CJOA 2IO1B 4OVZA 2KJHB 1WGRA 5IAAC 1QZEA 2JVCA 2LVQA 3APDA 4KKJA 2NBWB 4FJYA 4A90A 3DQVA 2Y3AA 3GZNI 5JHBA 2MJEA 1TIFA 2D2QA 3Q3FA 3EUB2 4KDIC 2V0GA 3N1ZC 4E3CA 2LWPA 1GB4A 2KTFA 3JVZX 4GDKA 4MM3B 4A6QA 4TKNA 1MG8A 2WXQA 5FR3A 1WMHB 2PPHA 3L0WB 1ZGUB 3ZQ4A 1EF1A 4DBGA 1Q10A 2MSED 1E8XA 4FJZA 5JXVA 3RPFC 4ANVA 1LQBA 1TY2A 2BYEA 3N1XC 1TJEA 4ARCA 4TQ1A 3L13A 3L54A 1WYGA 3L10B 3TEYA 3VVWB 1V1PB 2KNBA 1FNUA 4DDID 3RFZB 1C76A 4DDGD 4WH4A 2QC8A 3A9KB 3IAM1 1WSPA 4YTMB 1V5OA 4ARIA 2I1JA 1DOYA 2D3BA 1FD6A 1OFFA 3WANA 4M0WB 2N9KA 3IVFA 4L1BA 3A1QB 2K5PA 3W1SA 2JUOA 2X38A 1XT9B 2GLSA 1RM6C 3I5JC 4ZRKA 2C9WB 4RM8A 3DPDA 2LGIA 1UNSA 1PQSA 4EZKA 4LJOB 3H1UA 5G55A 3P4SB 3UIOB 2ZVOA 1HZ5A 1XLOA 1T0QC 3NZSA 3W1SC 3ZUNA 3PRZA 1VR9A 2LHDA 2WX1A 4M00A 2J52A 4RM9A 1XEEA 3PREA 4DHZE 5JH5C 3DBRI 2N7JA 2ZEQA 2WLBA 4HEA1 3AE5B 2JWUA 1FO4A 2IO0B 2UWQA 2M0AA 2K25A 3E9SA 5EDSA 3QAQA 2NMQA 2L32A 1JW9D 3JSVA 2K3UA 3P4PB 3U52E 1CK1A 2CJNA 3NHEB 2NTSA 5IN7A 2HJ1A 2K8CA 3O13A 2J0MA 1MPEA 5FKAC 4BFRA 3AE7B 5IO9A 1L5PA 3Q2AC 4C00A 2V4LA 3IT6B 2OJRA 2QJLA 3GP7A 1KH0A 1KF6B 1HTQA 3M95A 4KZ0A 2R2OA 2FIDA 3P2BA 3K9OB 4GDKB 1L4ZB 3Q8FA 2BGFA 4A3PA 2KX0A 2V9HA 3UIPB 4RMAA 4DXFA 2CHWA 2CU3A 2WU2B 4MJSA 4ZRPA 1NBFC 4BVUC 2BTEA 3EC8A 3C19A 2H89B 2INDC 3Q3MC 1YQ3B 3FAHA 3EGRA 4GOCA 1TKGA 4LCDE 1QF6A 3R2TA 3W5UB 4GIVA 1UF0A 4KX6B 3B08A 1OGWA 3HUIA 3AMZA 2NPTA 5J18A 2WXNA 2J7QB 2LD9A 3RD2A 3MC0B 2KFKA 4ZYNA 3A9JA 2DNFA 3HVZA 2GBNA 2I1KA 1JQ4A 4EZLA 5HI1A 5J2RA 1OEYA 2KAJA 5MPOA 1YMHE 2KLGA 2IJ0A 1C1YB 2G1EA 5L95C 2K8HA 2KWUB 2KACA 2JXTA 3R66C 4XWTA 1E7VA 3HHMA 4HCPB 3V62A 2KDIA 2G45B 5D2MB 1SB3C 2MBEA 1D6EC 1VD2A 3N32A 4ITKA 1WF9A 5GXGB 1JWSD 2FUHB 2NCNA 4GU2A 5E6NA 1I4XA 1ESFA 1R7SA 2JU6X 3C8YA 2BPSA 1N5WA 3TIXA 3RNAC 3RNFC 4FHKA 3AI5A 3KVFB 2YEPF 3P63A 2MJDA 1N60A 2D11A 3AEAB 1Y8RC 1FCCC 3RNCC 3PLUA 3AXCA 4W9FA 3RT3B 1EWCA 1WX7A 4JGHB 3TSSA 3PVLA 4F1SA 2DZJA 2BWFA 3H9DA 3AB5A 4G11A 1MG4A 3Q14C 2UYZB 3N1YC 2LUMA 5IA7A 4MJSB 3U7ZA 1AWDA 2D5GA 4IM3A 2WXRA 4A20A 5C1ZA 2CHXA 3A33B 1C79A 3TBLD 5E6JA 3VQIA 3TL5A 4MGYE 1KLUD 3K9PB 1ZDVA 1SE4A 1AARA 1RFAA 5LXHA 5D7GA 2NPTB 2RSUA 4YT0B 5D6JB 1SEBD 4MELA 3ETRA 2C7HA 1U4AA 4FXCA 1UELA 2KFKB 3A9JB 2NBVB 4BKTA 2JT4B 1I4RA 3OJ4B 2INCC 1Y56A 3DBSA 4GLSC 1FRDA 2RGFA 2LRWA 2FIFA 1TT5B 2WXKA 3AV8A 4IG7B 1F0ZA 3L16A 3QCAA 1V5TA 1WJNA 3URYA 5BMHA 2B76B 1YD8U 2WDVB 1XLPA 2V4IB 4IKGA 4RF1A 2CS4A 2BB6A 2BB5A 3CSTA 2JXXA 1M4VA 5DCNA 5C23A 3VTVA 2PLPA 2SEBD 4KVGB 1DOXA 1MJDA 1KTKA 4LJPB 1B1ZA 2MBHA 4P7IA 2FUG1 2N9LA 5KHOA 2LVOA 1YN4A 2XNAC 4P1BC 1AN8A 4YSYB 2INPE 2KN4A 4LNOA 5HG2A 4BKSA 4G0NB 1A70A 3QARA 4A55A 1IGCA 3B2GA 3UQAA 2DZKA 3AE6B 2MX2A 2Y5PA 4HCNB 4J3OD 3WALA 3LJ3A 2VH1A 4AQ7A 1LXDA 2NVUI 3DVNU 3MHZA 1WRIA 2MWSB 2FCSA 4J6IA 1P9DU 1V6EA 2LI5A 2Q5WD 3DCGA 2AQ1B 3H6NA 4URKA 1H8CA 1GJZA 1E10A 3RUIB 4MM3A 4LNIA 3DBLI 1I4GA 4NAWA 1STEA 4HJKA 2KD0A 3VHTC 3PHXB 1ZXHA 3TUOA 2XK5A 3E56A 3AEFB 2BQQA 3B9JA 4XX5A 4GXBA 4C56C 3VDZA 4YL8A 4RF0A 1SGHA 3SU8X 2IO3B 1WIAA 2KXJA 3VH3B 3ZIMA 4PK1A 2HJ8A 5AZGA 4IWPA 2CKHB 2Z59B 1HTOA 4B9KA 3NY5A 2LXAA 5HFYA 1C4AA 1JRUA 5D3DA 2WGSA 4WAFA 2WP9B 5TSSA 2LASA 2KC2A 1ISNA 2VZKD 1XQQA 3WCQA 1WR6E 1KRHA 3RZWC 3U7DA 3PV1A 4BOSC 4A9AA 2MBQA 1JROA 4W9LA 1XXGA 4D2KA 1GOZA 2RPVA 2EKEC 2VZKB 2G9HD 3PZ8A 4CYEA 1K50A 4M8MA 3T3NA 3APCA 1B9RA 2JYTA 3TJPA 1BMLC 1OTRB 1V9JA 4TMAB 2ZJDA 3APFA 3RI7C 1F2RC 5LLIA 2O2VA 3UGBB 3CF6E 2MA9B 1J7BA 4H2AA 3BY4B 1AW7A 2PJHA 4REZA 1P7FA 4DHJD 2MEKA 5CTRC 3VTUA 1VDVA 1V1OA 2WDRB 3VH4B 2ZZPB 5BMGA 4IM0A 2ZNVC 1L6VA 4P16A 4KDLB 4DHJB 2WXPA 4BKSD 1JWMD 1WGGA 2KDBA 5CHWA 4AWJA 1FEHA 3DHGC 4KZCA 1J7AA 2NTTA 3ZDMC 4G3XB 2PE6B 1KOTA 4N58A 2K9XA 2B3AA 1KLVA 5BYSA 4EKUA 1WXVA 4RGMA 1D5XC 3Q3NC 2Z0DB 4NZLB 2KANA 4W9GA 4ZHPA 3IHPC 4C80A 2GBRA 1JCKB 2I38A 4AJYB 4A3OA 4S17A 2KTRA 4FLHA 1WZ0A 1C4PA 2H88B 4NAWB 2EELA 2PVGC 2W54A 4MEMA 1FFVA 4EFOA 2XK5B 3CMMB 3Q8BA 4PS8A 4CQNA 2PW9A 2M0XA 4P1CC 3VR9B 3I9V1 5CHVC 3QK0A 3PSEB 4LNKA 1ZXIA 1WXMA 1TBEA 3ZJTA 4ACFA 3BVZA 2OEDA 2KJ6A 4FHJA 5G2NA 1BUIC 3V3XA 1YQBA 4ANUA 4XDDA 2FNJB 2HTME 4ICVA 1HEZE 1RLFA 2NBUA 4L23A 3AE3B 5LXIB 3UINB 3HK0A 1F77A 2KO3A 4WWPA 5DPRA 3B2FA 1L6UA 4BBNC 1SE9A 4MDKE 1WFYA 2WDTB 3TEZA 3SFDB 4FADA 4P6VF 1XD3B 3FILA 4E74A 2N0SB 4I6NB 1EWYC 2KQSA 3P4RB 4W9HA 2K0PA 2ZCCA 1YN5A 2ZNVB 2WQYB 2O2VB 4W9JA 4B0EA 4HDOA 3UI3A 3MJ5A 2L52A 4HRSA 1T0YA 2GBKA 5JZEB 3QHTA 4Q2JA 5LNK1 4HROA 3KH0A 4HPMB 4II3B 1AYFA 2A4ZA 2XN9C 1LGRA 1HA5A 5J17A 4K7WA 1Q5WB 1HXYD 3UQBA 3DVGX 1G6JA 2QCZA 2OJWA 3NVYA 3ZGZA 2N7DA 3VUYA 4YSXB 3VRBB 4YTNB 5FR6A 4HXDA 5EE0A 3P1MA 1NI2A 2C7MB 2LZ6A 1ZDXA 1ACCA 3RULA 2V3PA 2BW2A 2BKRB 1E6EB 2DENB 2L1AA 3AULA 4IWQA 3AU5A 4DWFA 1WJ4A 1NDDA 3H8HA 2FCNA 2LGDA 1WJ6A 4MACA 5H8YE 2VRRB 1SSNA 3R3MA 2KTRB 4FULA 3KYDD 1FXTB 2NR2A 3GS2A 2M17A 4XZ4A 2BYFA 1ENFA 2L7RA 2N9XA 3DVNV 1S1QB 3Q8EA 2KYWA 1C4CA 1L0VB 1WJUA 1PGAA 2E3TA 2MH7A 1EU4A 5FK9C 1R4MI 1WWTA 2WWZA 3NVWA 2IYDB 3U8ZA 3V6CB 4G50A 2G3QB 2DZMA 2M8SA 1UD7A 3J9CA 2KC1A 1MI0A 2LEKA 2NS5A 4MT5A 2ZVNA 3DOWA 2QIEB 3Q6BA 3Q69A 1ROEA 2CU1A 2AQ2B 3L4PA 2MHJA 3ZNGC 2BYTA 4LK0M 1YQ4B 3AEDB 3FILB 4XDCA 4RGTA 1TKEA 3PRMB 1SE2A 1I4QA 3DBRB 4DHZB 1GAQB 2DYMA 3HIZA 4JE3B 1YX5B 2N9PC 3HVDA 2DWQA 1SBBB 1FXAA 2GI9A 3FKYA 4BKGA 1FMAD 4GSWA 4ZRIA 4TQ0A 1WXAA 2JX5A 4WWOA 3IXSA 2GB1A 1UWXA 1PGBA 1A5RA 4MGIE 1ZOYB 2Z0EB 2KVRA 2LXCA 4AUQC 1DOIA 4W9CA 3PS6A 4C7ZA 2IBIB 1SIJA 3VFKA 1MFWA 2WXLA 3AH7A 4K1RB 2ACZB 2QHOA 1GG3A 1VCBA 1UBQA 3KUDB 3M63B 4US8A 4KSKC 4US9A 4YSZB 1E8YA 2ON8A 4K3BA 1WYWB 1EUVB 3EA6A 3P4QB 4R3DA 3ZRCA 1IPGA 3VAWA 3ZTCA 4NPNA 3TCAA 4CHKA 2FBWB 3S2AA 4ZHOA 4XWWA 3GOEA 4FA6A 3IFWB 1FFUA 2L76A 1YNTE 1OQRA 2MW5A 2HE7A 2OOBB 3U4EG 5C2TB 1L0YB 4KSLC 3D32A 5EE9A 2V3SA 1PGXA 2JZPA 3EFCA 2AYOB 2J53A 1L0XB 2KQ4X 1XF5L 1OQQA 1V2YA 2DBYA 3KUCB 5IKCM 3EHVA 3WA0A 3W9CB 1YJ1A 3RNEC 3V61A 4JLCA 5BO4B 2JZ3B 4HDQA 4B95A 2JY6A 3W5VB 2L8JA 3KYCD 3FC4A 2DZIA 1V8CA 3EECA 1Z5SB 4B6WA 3AE4B 4IM2A 3VUWA 1E9MA 3PGEA 4WURA 1KLGD 4C4VA 1WM3A 2L83A 2KT7A 2LJ5A 3ZDTA 1SE3A 2N1WA 1UH6A 2AL3A 1TS4A 1WI0A 3R7RA 1CZPA 2J4XA 3PHWB 1F1HA 1TS5A 1HZ6A 4DXAB 2LUEA 2GRIA 4ASWC 2PEAA 4W9EA 2UU7A 2M56B 2WXIA 2GOWA 4PS7A 1VZ8A 1QKZA 2KVZA 3H7SA 4HK2A 2DAFA 4PT5A 3ML8A 3TEWA 1WY8A 1WXQA 4M01A 2CR5A 4F8CB 2IZVB 4KV2A 3KQ4A 2PTLA 1N63A 3O65B 2QMTA 4YXDB 3SFEB 2I2YA 3N20C 2GBMA 3OWEB 3T3OA 3ZYYX 4OZBA 2XEWA 4JQWC 3WIMA 5D94A 3W1YA 5IP4D 2ZCBA 3L17A 3LDZE 2L05A 1JWAD 1RYJA 1UGJA 4FJVB 1D3ZA 1Q1OA 4W9DA 1E5WA 2D3AA 3AU4A 2L3ZA 2QILA 2IGGA 3NZUA 1WGDA 1FM0D 2PVOD 2SAKA 3U2SC 2EMSA 3ZRFA 1N62A 1WRDB 1D5MC 1NYRA 4EE2A 4JIOU 5EE1A 4OVUA 1SF0A 2C60A 4HJGE 3M62B 4RGOS 1KFYB 3LB8C 3NZ3A 4IUMB 4PS3A 4WWMA 4IW0A 2YEPB 4EZJA 3Q3OC 3V60A 4RGNA 2R2QA 3RZFA 1FNWA 2RMMA 1TY0A 2MBOA 3Q8AA 4GB9A 4TUUA 2KQ7A 4OHJA 1IP9A 3CSFA 4WJOA 4IDIA 1BT0A 3DBHB 1IBXA 1J7CA 1P3QU 1JRPA 1P7EA 1HQRD 2FE8A 4I6PA 1P0RA 2AX5A 3NJTA 3VR8B 3ONSA 2GBJA 5AZFA 1IUEA 4C4VB 2WXFA 2EMTA 2WX0A 1EM7A 1QILA 1NYQA 3AE1B 4JX1C 1WXSA 3ZNZB 3ALBA 2DHZA 2W3RA 3SHQA 1YOVB 1R4NB 3ZKJC 3I3TB 3P42A 1QOAA 2HTHA 1V81A 1XLNA 2BVCA 4K7UA 1M94A 3KLSX 2RPQA 1YJIA 1FRRA 4F7ZA 3GB1A 3QIJA 3MJWA 1TZOA 2R61A 1QLBB 2N4FA 1L4DB 2MQJA 4KIKA 2KWVB 3I57A 4ICUA 2RDHA 5G5HA 1J8CA 3AE2B 1V97A 3HRDD 2EKIA 2MP2A 4RNAA 4KKIA 4KGTA 2PMVA 4WJPA 2BYVE 5E6PA 1SJED 1N5XA 4NQLB 1EU3A 4YTPB 3IT4B 4ANXA 3DBLB 3BIID 2W55A 2YVCA 3MP9A 2JRIB 1K52A 1TGZB 2KLCA 2C5LC 1ET9A 1MHXA 2DX5B 3KW5B 1QOBA 3GE3C 2ZPYA 1E8ZA 2BT6A 2W3SA 1LM8B 2N7EA 2JSVX 2BS2B 3MTNB 1P1AA 5T8IA 2K39A 4IC7B 3OJ3A 1ZE3D 5KHQA 4RCOA 1ZUD2 2LHEA 3N9YC 3JW0X 3CWIA 3VTWA 3RN9C 3X0WA 4X57B 3A4SC 2MCNB 2WXMA 1TYGB 5AUIA 1OEYJ 3DHHC 1KJTA 1LFDA 1WM2A 1JMLA 3OLMD 2AL6A 3ZJUA 3B1LX 1TS3A 3BYYB 4RH6A 4WQMA 5AZHA 4K7SA 1P98A 1CQVA 2ZPNA 1V80A 4N6EB 2RD0A 3Q8CA 4K3CA 4DQOC 1IBXB 3MC9A 3L08A 2D10A 5TR5A 4ANWA 4OZAA 2DLBA 1WE6A 1UGMA 1UZXB 1C3TA 2W9NA 1JWUD 4NAMA 3NUHB 1YN3A 1DGJA 5BYRA 3A4RA 1VJKA 2J0JA 3X23A 2ICIA 3I63C 4BOZB 3QQ8B 3TEXA 1RRBA 3ZNHB 2IGDA 3SDLC 1PDXA 1D4BA 2KJRA 2AEHA 4NNJB 1GC7A 5EE3A 1WGHA 1FIQA 1UUPA 2WNMA 5HHDG 1GB1A 3NS8A 3PLVA 2BWES 4KIKB 4EEWA 1QT9A 4DK5A 2O6VA 3DHIC 3AE9B 2VH2A 3GZNB 4YWGG 1FXIA 4NJ7A 2MP2B 4LDTD 1V49A 5AUKA 1Q0WB 2K6QA 3ZJVA 3ZTDA 2BKFA 3QJZA 1GUAB 1ZW7A 4CO7A 2KHWB 3ZXRA 4LDTB 4ZRJA 3SR6A 4A8XC 4NQKE 2JYEA 3T9LA 3U30A 3PPAA 2MRPA 2FCMA 2M4NA 2BS3B 4WIPA 1JALA 5E6OA 4LNNA 4C7YA 3BZDB 3NVVA 3ZLZA 1FPYA 4WJQA 2KK8A 3BK2A 2KX3A 2PKOA 3V6EB 2RDBC 2WHIA 4WJNA 2Y5CA 4MGKE 4HKZE 4JWUC 3LYYA 1MVKA 1I4PA 1UBIA 3AECB 1SIFA 4AJWA 1E7UA 3AEEB 1HE8A 1K8RB 1KM7A 2AWTA 3N3KB 1QOGA 1WR1A 1XLQA 2K22A 4LLGM 2JPHA 1NI3A 2ZW0A 1N6ZA 4MGZE 2Z8LA 1YJJA 4HKQA 2KDMA 3GE8C 1J19A 2HDEA 2WXHA 3PZDA 3RNGC 2QDFA 3WAMA 2J0KA 2K8BA 4ZRQA 1JWBD 1TKYA 4BAXA 4W9KA 2L0TA 5AEKB 2GMIC 1VZ6A 5C3JB 1VRAB 1TTNA 1EF5A 1C9FA 4GDLA 1WE7A 2TSSA 5HKHA 2KDFB 2DYOA 2IGHA 2JQRB 3MC8A 4USAA 1RFKA 2XBBC 2AQ3B 3VRAB 3M3JA 4PYZA 3Q3JA 1NEKB 5BYQA 1C77A 2K6DB 1F52A 4MSQB 2JZZA 5JHAA 3AN1A 1PFDA 1L2NA 1K53A 2O6VD 1BXTA 3BK1A 2INNE 1K51A 2RDGA 4NY0A 4OVVA 3LXFA 2D3GA 1VLBA 3KWLA 2D07B 2O6VB 3BYTB 4NJCA 3ZNID 2MLBA 1VZ7A 3NVZA 2KOXA 4JL9A 2KMMA 2IY0B 2BF8B 4FN2A 3NS1A 2MJ3A 2BBCA 4DXGA 2K1FA 2RR9A 4KGRA 3H7PA 1XCQL 3JYUA 4PYUA 1OQYA 2KKCA 2BS4B 4JWSC 4GGQA 2PE9A 1S3SG 3JSVB 2L00B 1R4MB 2JF5A 3ECIA 2N9EB 2LGXA 2JRHA 3NOBA 4XYCA 1IYFA 2LMCA 3DVGY 2LRUA 5DPWA 3BWUD 1ZPSA 3T8MA 2KFJA 2OHFA 3C0RB 1T0RC 4HPLB 1I7HA 2WYQA 4TSSA 2KMCA 3CIRB 4WAAA 4LNFA 4LTUA 1WX8A 3SD5A 3V05A 3MFGA 3AM9A 1CJEA 2HD5B 2L0FA 5IOIA 1CMXB 4M8NA 1WGYA 4WQOB 3AEBB 3IAS1 4O1NA 5CX3A 4TV3A
chains in the Genus database with same CATH topology
3QA8A 2NPTA 4I6PA 1P0RA 4WWPA 5DPRA 5J18A 3ML9A 2YLMA 3ONSA 4GMVA 2J7QB 2GBJA 2LD9A 4BBNC 2KN5A 1SE9A 4MDKE 5AZFA 1WFYA 2WDTB 2LVPA 3RD2A 4FADA 1XD3B 2DAJA 2CHZA 2KFKA 2EMTA 2WX0A 3B0AA 4ZYNA 4E74A 3A9JA 4IWOA 1X1MA 1WXSA 2V1YA 4GDLB 3ZNZB 3ALBA 2DHZA 4I6NB 1ZKHA 2KQSA 2GBNA 3PTFC 2I1KA 1F9JA 3SHQA 4EZLA 3ZKJC 1I42A 3I3TB 4W9HA 4E71A 2HTHA 5J2RA 1OEYA 1V81A 2KZRA 2ZCCA 2ZNVB 2KLGA 2O2VB 4K7UA 4W9JA 1M94A 3VXWA 1C1YB 2RPQA 4HDOA 4F7ZA 5L95C 2K8HA 2KWUB 1T0YA 2GBKA 5JZEB 3DBHI 3QIJA 3MJWA 3QHTA 2N4FA 2REXA 1V86A 3R66C 3KH0A 1EO6A 2MQJA 2FCQA 3QWZB 4HPMB 4II3B 4KIKA 2KWVB 1E7VA 3HHMA 4HCPB 1WZ3A 3V62A 2A4ZA 3IG3A 2KDIA 4ICUA 2G45B 4XC2A 5D2MB 2MBEA 1J8CA 5J17A 1VD2A 3N32A 2MP2A 4K7WA 4MSMB 1GNUA 3QC8B 1WF9A 4WJPA 2BYVE 5E6PA 1Q5WB 2FUHB 2NCNA 4NQLB 3UQBA 4GU2A 4ANXA 5E6NA 3DVGX 4FBJB 3KUZA 1G6JA 1R4NI 2IO2B 2N7DA 2YVCA 2BPSA 3TIXA 3VUYA 1RAXA 2JRIB 4AJWA 1GC6A 1TGZB 2KLCA 5FR6A 2C5LC 4HXDA 2DX5B 1I35A 3KW5B 4FHKA 2DYBA 1NI2A 2C7MB 3AI5A 3KVFB 2LZ6A 3H7PB 2G4DB 3OAWA 3RULA 2BKRB 2A5UA 2ZPYA 2FAZA 2KWCA 1E8ZA 2DENB 1LM8B 2N7EA 3AULA 1TZ1A 4IWQA 3MTNB 2D11A 2N1VA 4N9F4 1P1AA 3AU5A 1J0GA 2K39A 4DWFA 4IC7B 3OJ3A 1WJ4A 5KHQA 1Y8RC 1NDDA 3TMPB 3PLUA 4HWIB 3UF8A 2FCNA 2LGDA 1WJ6A 3AXCA 1WX9A 3JW0X 2VRRB 3R3MA 4W9FA 3VTWA 3RT3B 2KTRB 1WX7A 4JGHB 3PVLA 5CHFA 3X0WA 3N30A 4X57B 4F1SA 4FULA 3KYDD 3WAPA 1WMHA 3A4SC 4K81A 2MCNB 4W9IA 1OEYJ 4HVBA 1KJTA 2DZJA 5DPSA 2BWFA 1FXTB 2NR2A 3H9DA 1LFDA 3EFUA 2M17A 4XZ4A 1WM2A 4G11A 2BYFA 2L7RA 2N9XA 2UYZB 1E8WA 2C7NB 1S1QB 3DVNV 2KMAA 2AL6A 3OLMD 3RYTA 1L7YA 3B1LX 5IA7A 1WJUA 4MJSB 3MHSD 3WAOA 4IM3A 4A20A 5C1ZA 4NJ6A 5AZHA 4K7SA 4EUTA 1P98A 1R4MI 2CHXA 2WWZA 3A33B 2ZPNA 3TBLD 2IYDB 1V80A 3U8ZA 2RD0A 3V6CB 3TL5A 4G50A 4MGYE 2G3QB 3R7QA 2DZMA 2M8SA 3VQIA 1UD7A 3HM6X 3K9PB 3L08A 2KC1A 2D10A 5TR5A 1AARA 1RFAA 3VUXA 5LXHA 5D7GA 4ANWA 2NS5A 2ZVNA 3DOWA 3A9KA 3BINA 2CU1A 2NPTB 2RSUA 3RCZA 1H4RA 3PRPB 5D6JB 1WE6A 4EOYA 5L83A 3ZNGC 4GN1A 1UGMA 4MELA 4WWNA 2MBBB 4I6LB 3A1QA 2C7HA 1U4AA 1UELA 1UZXB 2LGYA 1C3TA 2KFKB 2W9NA 3A9JB 2NBVB 2Y5BB 4BKTA 2JT4B 3OJ4B 1YIWA 3PRMB 3DBSA 5DPTA 2RGFA 2LRWA 3A4RA 2J0JA 3X23A 4DHZB 1E90A 3ENEA 2FIFA 4BOZB 4IG7B 2DYMA 3HIZA 4HLEA 3QQ8B 1YX5B 2N9PC 3L16A 1YX6B 3QCAA 1V5TA 2M1MA 1WJNA 1RRBA 3ZNHB 4MH0E 2KDEB 3SDLC 4BKGA 4GSWA 4ZRIA 4TQ0A 2KJRA 1WXAA 4WWOA 1YD8U 2AEHA 2G4SA 1Z2MA 3QX1A 4NNJB 1A5RA 1GC7A 4MGIE 2Z0EB 2KVRA 2LXCA 4AUQC 1WGHA 4W9CA 2CS4A 3CSTA 3PS6A 2JXXA 2IBIB 4AOFA 3VFKA 3NS8A 5DCNA 5C23A 3VTVA 3PLVA 2BWES 4II2B 4KIKB 4AP4C 3DDCB 4KVGB 4EEWA 2ASQA 2IY1B 4DK5A 2O6VA 4K1RB 2QHOA 3PT2B 3IBEA 4LJPB 4P7IA 2MBHA 1GG3A 1VCBA 5KHOA 3HM3A 3ZVVA 3ZW3A 4NJ7A 4ZDVA 2MP2B 1UBQA 2LVOA 3KUDB 5GMVA 2JWZA 1WH3A 3M63B 4LDTD 4KSKC 1V49A 1Q0WB 2K6QA 1E8YA 1WYWB 1EUVB 3ZTDA 3ZRCA 4BKSA 2BKFA 4G0NB 3QARA 3QJZA 1IPGA 3VAWA 1GUAB 3ZTCA 3UQAA 2DZKA 1ZW7A 3ZO5B 2MX2A 4CO7A 2KHWB 4HCNB 4NPNA 3TCAA 4LDTB 3WALA 4CHKA 4ZRJA 4NQKE 3S2AA 3T9LA 3LJ3A 3U30A 3PPAA 1LXDA 2NVUI 2MRPA 2FCMA 2M4NA 3DVNU 3GOEA 4BBNF 4FA6A 2MWSB 2FCSA 2IO1B 2KJHB 1P9DU 4J6IA 1V6EA 3IFWB 2LI5A 1WGRA 3DCGA 5IAAC 5E6OA 3H6NA 1QZEA 4URKA 2L76A 2JVCA 2LVQA 1H8CA 3APDA 1GJZA 2MW5A 2HE7A 3ZLZA 2OOBB 2NBWB 4FJYA 3RUIB 3DQVA 3GZNI 4MM3A 5JHBA 3DBLI 4WJQA 4NAWA 4HJKA 2D2QA 2KD0A 3Q3FA 4KSLC 3D32A 3VHTC 2KK8A 3PHXB 4KDIC 2V3SA 2KX3A 2XK5A 3V6EB 4E3CA 2LWPA 2KTFA 3JVZX 2AYOB 4GDKA 4MGKE 4WJNA 4TKNA 1MG8A 1WMHB 4XX5A 4GXBA 1V2YA 2PPHA 3VDZA 4YL8A 1UBIA 3KUCB 1SIFA 1SGHA 3SU8X 2IO3B 1WIAA 2KXJA 3EHVA 3L0WB 3VH3B 3WA0A 1E7UA 1ZGUB 3ZIMA 1YJ1A 1HE8A 2HJ8A 1K8RB 1KM7A 1EF1A 4DBGA 5AZGA 2MSED 2AWTA 2CKHB 1WR1A 2Z59B 1E8XA 3N3KB 4FJZA 3NY5A 4IWPA 2LXAA 3V61A 4B9KA 1JRUA 2JPHA 4JLCA 5BO4B 4ANVA 1LQBA 2BYEA 4TQ1A 3L13A 2JZ3B 4HDQA 2LASA 4MGZE 4B95A 3L54A 2JY6A 2KC2A 1ISNA 3L10B 3VVWB 2L8JA 3KYCD 1J19A 1XQQA 2KNBA 4DDID 2DZIA 1WR6E 3PZDA 3EECA 3RZWC 1Z5SB 4B6WA 4DDGD 4IM2A 3VUWA 3WAMA 2J0KA 3U7DA 2K8BA 3PV1A 3PGEA 4BOSC 4W9KA 2MBQA 4W9LA 2L0TA 1WM3A 2GMIC 5AEKB 3A9KB 1TTNA 1V5OA 2EKEC 2LJ5A 3ZDTA 2I1JA 2N1WA 1UH6A 1EF5A 4GDLA 1WE7A 2AL3A 3WANA 1WI0A 3R7RA 4M0WB 4CYEA 5HKHA 3IVFA 2KDFB 4M8MA 3PHWB 3A1QB 3APCA 2DYOA 3W1SA 2JUOA 1XT9B 2XBBC 3M3JA 3TJPA 4PYZA 4DXAB 1OTRB 1V9JA 2LUEA 4ZRKA 2C9WB 4RM8A 4ASWC 2PEAA 2ZJDA 3APFA 5LLIA 3UGBB 2O2VA 3DPDA 3Q3JA 4W9EA 3CF6E 2MA9B 2GOWA 2K6DB 3BY4B 4MSQB 2JZZA 4PS7A 5JHAA 2PJHA 1L2NA 1PQSA 4EZKA 4LJOB 3H1UA 2O6VD 3H7SA 5G55A 4DHJD 4HK2A 3UIOB 2DAFA 5CTRC 3ML8A 3VTUA 2ZVOA 4NY0A 4OVVA 1WY8A 3NZSA 2CR5A 3W1SC 3ZUNA 3VH4B 3PRZA 2D3GA 2ZZPB 4F8CB 2IZVB 4KV2A 2D07B 4IM0A 2WX1A 2O6VB 2ZNVC 3O65B 3ZNID 4KDLB 4DHJB 4RM9A 3PREA 4BKSD 2MLBA 4DHZE 1WGGA 2KDBA 5CHWA 2KOXA 4AWJA 4JL9A 5JH5C 3DBRI 2GBMA 2ZEQA 2IY0B 4KZCA 2BF8B 2XEWA 4FN2A 4JQWC 2IO0B 3WIMA 2UWQA 5D94A 3ZDMC 3W1YA 2K25A 2ZCBA 3L17A 2K1FA 2RR9A 4G3XB 3LDZE 2L05A 5EDSA 3QAQA 3H7PA 4FJVB 2PE6B 1D3ZA 1KOTA 3JYUA 1Q1OA 4W9DA 1E5WA 2B3AA 4PYUA 1KLVA 3JSVA 1OQYA 3AU4A 2L3ZA 4EKUA 1WXVA 2KKCA 3NZUA 2Z0DB 3NHEB 1WGDA 4GGQA 2K8CA 2KANA 2PE9A 4W9GA 1S3SG 2J0MA 3IHPC 3JSVB 2L00B 2JF5A 2GBRA 4BFRA 3ECIA 4AJYB 4A3OA 2EMSA 2N9EB 2LGXA 2V4LA 3ZRFA 2JRHA 3NOBA 2KTRA 1WRDB 4FLHA 2OJRA 1WZ0A 4JIOU 1IYFA 4NAWB 4OVUA 3DVGY 2LRUA 5DPWA 3M95A 4KZ0A 4MEMA 2C60A 2R2OA 2FIDA 4EFOA 3P2BA 2XK5B 3CMMB 3T8MA 2KFJA 3C0RB 4PS8A 3M62B 3K9OB 2M0XA 4GDKB 2BGFA 4IUMB 3QK0A 4HPLB 5CHVC 4A3PA 4PS3A 2WYQA 2KX0A 3PSEB 3UIPB 2KMCA 1WXMA 1TBEA 4IW0A 4WAAA 4RMAA 4EZJA 1WX8A 3V60A 2CHWA 3SD5A 2R2QA 2KJ6A 4MJSA 3RZFA 4FHJA 2MBOA 5G2NA 1YQBA 4GB9A 4ANUA 1NBFC 4TUUA 4BVUC 2KQ7A 3EC8A 2HD5B 2FNJB 1IP9A 3CSFA 4WJOA 2L0FA 1BT0A 4GOCA 4ICVA 1CMXB 1RLFA 2NBUA 4LCDE 4M8NA 5LXIB 1WGYA 4WQOB 3HK0A 3UINB 1P3QU 4GIVA 5CX3A 2KO3A 3B08A 1OGWA 4TV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QA8 A;  2NPT A;  4I6P A;  1P0R A;  4WWP A;  5DPR A;  5J18 A;  3ML9 A;  2YLM A;  3ONS A;  4GMV A;  2J7Q B;  2GBJ A;  2LD9 A;  4BBN C;  2KN5 A;  1SE9 A;  4MDK E;  5AZF A;  1WFY A;  2WDT B;  2LVP A;  3RD2 A;  4FAD A;  1XD3 B;  2DAJ A;  2CHZ A;  2KFK A;  2EMT A;  2WX0 A;  3B0A A;  4ZYN A;  4E74 A;  3A9J A;  4IWO A;  1X1M A;  1WXS A;  2V1Y A;  4GDL B;  3ZNZ B;  3ALB A;  2DHZ A;  4I6N B;  1ZKH A;  2KQS A;  2GBN A;  3PTF C;  2I1K A;  1F9J A;  3SHQ A;  4EZL A;  3ZKJ C;  1I42 A;  3I3T B;  4W9H A;  4E71 A;  2HTH A;  5J2R A;  1OEY A;  1V81 A;  2KZR A;  2ZCC A;  2ZNV B;  2KLG A;  2O2V B;  4K7U A;  4W9J A;  1M94 A;  3VXW A;  1C1Y B;  2RPQ A;  4HDO A;  4F7Z A;  5L95 C;  2K8H A;  2KWU B;  1T0Y A;  2GBK A;  5JZE B;  3DBH I;  3QIJ A;  3MJW A;  3QHT A;  2N4F A;  2REX A;  1V86 A;  3R66 C;  3KH0 A;  1EO6 A;  2MQJ A;  2FCQ A;  3QWZ B;  4HPM B;  4II3 B;  4KIK A;  2KWV B;  1E7V A;  3HHM A;  4HCP B;  1WZ3 A;  3V62 A;  2A4Z A;  3IG3 A;  2KDI A;  4ICU A;  2G45 B;  4XC2 A;  5D2M B;  2MBE A;  1J8C A;  5J17 A;  1VD2 A;  3N32 A;  2MP2 A;  4K7W A;  4MSM B;  1GNU A;  3QC8 B;  1WF9 A;  4WJP A;  2BYV E;  5E6P A;  1Q5W B;  2FUH B;  2NCN A;  4NQL B;  3UQB A;  4GU2 A;  4ANX A;  5E6N A;  3DVG X;  4FBJ B;  3KUZ A;  1G6J A;  1R4N I;  2IO2 B;  2N7D A;  2YVC A;  2BPS A;  3TIX A;  3VUY A;  1RAX A;  2JRI B;  4AJW A;  1GC6 A;  1TGZ B;  2KLC A;  5FR6 A;  2C5L C;  4HXD A;  2DX5 B;  1I35 A;  3KW5 B;  4FHK A;  2DYB A;  1NI2 A;  2C7M B;  3AI5 A;  3KVF B;  2LZ6 A;  3H7P B;  2G4D B;  3OAW A;  3RUL A;  2BKR B;  2A5U A;  2ZPY A;  2FAZ A;  2KWC A;  1E8Z A;  2DEN B;  1LM8 B;  2N7E A;  3AUL A;  1TZ1 A;  4IWQ A;  3MTN B;  2D11 A;  2N1V A;  4N9F 4;  1P1A A;  3AU5 A;  1J0G A;  2K39 A;  4DWF A;  4IC7 B;  3OJ3 A;  1WJ4 A;  5KHQ A;  1Y8R C;  1NDD A;  3TMP B;  3PLU A;  4HWI B;  3UF8 A;  2FCN A;  2LGD A;  1WJ6 A;  3AXC A;  1WX9 A;  3JW0 X;  2VRR B;  3R3M A;  4W9F A;  3VTW A;  3RT3 B;  2KTR B;  1WX7 A;  4JGH B;  3PVL A;  5CHF A;  3X0W A;  3N30 A;  4X57 B;  4F1S A;  4FUL A;  3KYD D;  3WAP A;  1WMH A;  3A4S C;  4K81 A;  2MCN B;  4W9I A;  1OEY J;  4HVB A;  1KJT A;  2DZJ A;  5DPS A;  2BWF A;  1FXT B;  2NR2 A;  3H9D A;  1LFD A;  3EFU A;  2M17 A;  4XZ4 A;  1WM2 A;  4G11 A;  2BYF A;  2L7R A;  2N9X A;  2UYZ B;  1E8W A;  2C7N B;  1S1Q B;  3DVN V;  2KMA A;  2AL6 A;  3OLM D;  3RYT A;  1L7Y A;  3B1L X;  5IA7 A;  1WJU A;  4MJS B;  3MHS D;  3WAO A;  4IM3 A;  4A20 A;  5C1Z A;  4NJ6 A;  5AZH A;  4K7S A;  4EUT A;  1P98 A;  1R4M I;  2CHX A;  2WWZ A;  3A33 B;  2ZPN A;  3TBL D;  2IYD B;  1V80 A;  3U8Z A;  2RD0 A;  3V6C B;  3TL5 A;  4G50 A;  4MGY E;  2G3Q B;  3R7Q A;  2DZM A;  2M8S A;  3VQI A;  1UD7 A;  3HM6 X;  3K9P B;  3L08 A;  2KC1 A;  2D10 A;  5TR5 A;  1AAR A;  1RFA A;  3VUX A;  5LXH A;  5D7G A;  4ANW A;  2NS5 A;  2ZVN A;  3DOW A;  3A9K A;  3BIN A;  2CU1 A;  2NPT B;  2RSU A;  3RCZ A;  1H4R A;  3PRP B;  5D6J B;  1WE6 A;  4EOY A;  5L83 A;  3ZNG C;  4GN1 A;  1UGM A;  4MEL A;  4WWN A;  2MBB B;  4I6L B;  3A1Q A;  2C7H A;  1U4A A;  1UEL A;  1UZX B;  2LGY A;  1C3T A;  2KFK B;  2W9N A;  3A9J B;  2NBV B;  2Y5B B;  4BKT A;  2JT4 B;  3OJ4 B;  1YIW A;  3PRM B;  3DBS A;  5DPT A;  2RGF A;  2LRW A;  3A4R A;  2J0J A;  3X23 A;  4DHZ B;  1E90 A;  3ENE A;  2FIF A;  4BOZ B;  4IG7 B;  2DYM A;  3HIZ A;  4HLE A;  3QQ8 B;  1YX5 B;  2N9P C;  3L16 A;  1YX6 B;  3QCA A;  1V5T A;  2M1M A;  1WJN A;  1RRB A;  3ZNH B;  4MH0 E;  2KDE B;  3SDL C;  4BKG A;  4GSW A;  4ZRI A;  4TQ0 A;  2KJR A;  1WXA A;  4WWO A;  1YD8 U;  2AEH A;  2G4S A;  1Z2M A;  3QX1 A;  4NNJ B;  1A5R A;  1GC7 A;  4MGI E;  2Z0E B;  2KVR A;  2LXC A;  4AUQ C;  1WGH A;  4W9C A;  2CS4 A;  3CST A;  3PS6 A;  2JXX A;  2IBI B;  4AOF A;  3VFK A;  3NS8 A;  5DCN A;  5C23 A;  3VTV A;  3PLV A;  2BWE S;  4II2 B;  4KIK B;  4AP4 C;  3DDC B;  4KVG B;  4EEW A;  2ASQ A;  2IY1 B;  4DK5 A;  2O6V A;  4K1R B;  2QHO A;  3PT2 B;  3IBE A;  4LJP B;  4P7I A;  2MBH A;  1GG3 A;  1VCB A;  5KHO A;  3HM3 A;  3ZVV A;  3ZW3 A;  4NJ7 A;  4ZDV A;  2MP2 B;  1UBQ A;  2LVO A;  3KUD B;  5GMV A;  2JWZ A;  1WH3 A;  3M63 B;  4LDT D;  4KSK C;  1V49 A;  1Q0W B;  2K6Q A;  1E8Y A;  1WYW B;  1EUV B;  3ZTD A;  3ZRC A;  4BKS A;  2BKF A;  4G0N B;  3QAR A;  3QJZ A;  1IPG A;  3VAW A;  1GUA B;  3ZTC A;  3UQA A;  2DZK A;  1ZW7 A;  3ZO5 B;  2MX2 A;  4CO7 A;  2KHW B;  4HCN B;  4NPN A;  3TCA A;  4LDT B;  3WAL A;  4CHK A;  4ZRJ A;  4NQK E;  3S2A A;  3T9L A;  3LJ3 A;  3U30 A;  3PPA A;  1LXD A;  2NVU I;  2MRP A;  2FCM A;  2M4N A;  3DVN U;  3GOE A;  4BBN F;  4FA6 A;  2MWS B;  2FCS A;  2IO1 B;  2KJH B;  1P9D U;  4J6I A;  1V6E A;  3IFW B;  2LI5 A;  1WGR A;  3DCG A;  5IAA C;  5E6O A;  3H6N A;  1QZE A;  4URK A;  2L76 A;  2JVC A;  2LVQ A;  1H8C A;  3APD A;  1GJZ A;  2MW5 A;  2HE7 A;  3ZLZ A;  2OOB B;  2NBW B;  4FJY A;  3RUI B;  3DQV A;  3GZN I;  4MM3 A;  5JHB A;  3DBL I;  4WJQ A;  4NAW A;  4HJK A;  2D2Q A;  2KD0 A;  3Q3F A;  4KSL C;  3D32 A;  3VHT C;  2KK8 A;  3PHX B;  4KDI C;  2V3S A;  2KX3 A;  2XK5 A;  3V6E B;  4E3C A;  2LWP A;  2KTF A;  3JVZ X;  2AYO B;  4GDK A;  4MGK E;  4WJN A;  4TKN A;  1MG8 A;  1WMH B;  4XX5 A;  4GXB A;  1V2Y A;  2PPH A;  3VDZ A;  4YL8 A;  1UBI A;  3KUC B;  1SIF A;  1SGH A;  3SU8 X;  2IO3 B;  1WIA A;  2KXJ A;  3EHV A;  3L0W B;  3VH3 B;  3WA0 A;  1E7U A;  1ZGU B;  3ZIM A;  1YJ1 A;  1HE8 A;  2HJ8 A;  1K8R B;  1KM7 A;  1EF1 A;  4DBG A;  5AZG A;  2MSE D;  2AWT A;  2CKH B;  1WR1 A;  2Z59 B;  1E8X A;  3N3K B;  4FJZ A;  3NY5 A;  4IWP A;  2LXA A;  3V61 A;  4B9K A;  1JRU A;  2JPH A;  4JLC A;  5BO4 B;  4ANV A;  1LQB A;  2BYE A;  4TQ1 A;  3L13 A;  2JZ3 B;  4HDQ A;  2LAS A;  4MGZ E;  4B95 A;  3L54 A;  2JY6 A;  2KC2 A;  1ISN A;  3L10 B;  3VVW B;  2L8J A;  3KYC D;  1J19 A;  1XQQ A;  2KNB A;  4DDI D;  2DZI A;  1WR6 E;  3PZD A;  3EEC A;  3RZW C;  1Z5S B;  4B6W A;  4DDG D;  4IM2 A;  3VUW A;  3WAM A;  2J0K A;  3U7D A;  2K8B A;  3PV1 A;  3PGE A;  4BOS C;  4W9K A;  2MBQ A;  4W9L A;  2L0T A;  1WM3 A;  2GMI C;  5AEK B;  3A9K B;  1TTN A;  1V5O A;  2EKE C;  2LJ5 A;  3ZDT A;  2I1J A;  2N1W A;  1UH6 A;  1EF5 A;  4GDL A;  1WE7 A;  2AL3 A;  3WAN A;  1WI0 A;  3R7R A;  4M0W B;  4CYE A;  5HKH A;  3IVF A;  2KDF B;  4M8M A;  3PHW B;  3A1Q B;  3APC A;  2DYO A;  3W1S A;  2JUO A;  1XT9 B;  2XBB C;  3M3J A;  3TJP A;  4PYZ A;  4DXA B;  1OTR B;  1V9J A;  2LUE A;  4ZRK A;  2C9W B;  4RM8 A;  4ASW C;  2PEA A;  2ZJD A;  3APF A;  5LLI A;  3UGB B;  2O2V A;  3DPD A;  3Q3J A;  4W9E A;  3CF6 E;  2MA9 B;  2GOW A;  2K6D B;  3BY4 B;  4MSQ B;  2JZZ A;  4PS7 A;  5JHA A;  2PJH A;  1L2N A;  1PQS A;  4EZK A;  4LJO B;  3H1U A;  2O6V D;  3H7S A;  5G55 A;  4DHJ D;  4HK2 A;  3UIO B;  2DAF A;  5CTR C;  3ML8 A;  3VTU A;  2ZVO A;  4NY0 A;  4OVV A;  1WY8 A;  3NZS A;  2CR5 A;  3W1S C;  3ZUN A;  3VH4 B;  3PRZ A;  2D3G A;  2ZZP B;  4F8C B;  2IZV B;  4KV2 A;  2D07 B;  4IM0 A;  2WX1 A;  2O6V B;  2ZNV C;  3O65 B;  3ZNI D;  4KDL B;  4DHJ B;  4RM9 A;  3PRE A;  4BKS D;  2MLB A;  4DHZ E;  1WGG A;  2KDB A;  5CHW A;  2KOX A;  4AWJ A;  4JL9 A;  5JH5 C;  3DBR I;  2GBM A;  2ZEQ A;  2IY0 B;  4KZC A;  2BF8 B;  2XEW A;  4FN2 A;  4JQW C;  2IO0 B;  3WIM A;  2UWQ A;  5D94 A;  3ZDM C;  3W1Y A;  2K25 A;  2ZCB A;  3L17 A;  2K1F A;  2RR9 A;  4G3X B;  3LDZ E;  2L05 A;  5EDS A;  3QAQ A;  3H7P A;  4FJV B;  2PE6 B;  1D3Z A;  1KOT A;  3JYU A;  1Q1O A;  4W9D A;  1E5W A;  2B3A A;  4PYU A;  1KLV A;  3JSV A;  1OQY A;  3AU4 A;  2L3Z A;  4EKU A;  1WXV A;  2KKC A;  3NZU A;  2Z0D B;  3NHE B;  1WGD A;  4GGQ A;  2K8C A;  2KAN A;  2PE9 A;  4W9G A;  1S3S G;  2J0M A;  3IHP C;  3JSV B;  2L00 B;  2JF5 A;  2GBR A;  4BFR A;  3ECI A;  4AJY B;  4A3O A;  2EMS A;  2N9E B;  2LGX A;  2V4L A;  3ZRF A;  2JRH A;  3NOB A;  2KTR A;  1WRD B;  4FLH A;  2OJR A;  1WZ0 A;  4JIO U;  1IYF A;  4NAW B;  4OVU A;  3DVG Y;  2LRU A;  5DPW A;  3M95 A;  4KZ0 A;  4MEM A;  2C60 A;  2R2O A;  2FID A;  4EFO A;  3P2B A;  2XK5 B;  3CMM B;  3T8M A;  2KFJ A;  3C0R B;  4PS8 A;  3M62 B;  3K9O B;  2M0X A;  4GDK B;  2BGF A;  4IUM B;  3QK0 A;  4HPL B;  5CHV C;  4A3P A;  4PS3 A;  2WYQ A;  2KX0 A;  3PSE B;  3UIP B;  2KMC A;  1WXM A;  1TBE A;  4IW0 A;  4WAA A;  4RMA A;  4EZJ A;  1WX8 A;  3V60 A;  2CHW A;  3SD5 A;  2R2Q A;  2KJ6 A;  4MJS A;  3RZF A;  4FHJ A;  2MBO A;  5G2N A;  1YQB A;  4GB9 A;  4ANU A;  1NBF C;  4TUU A;  4BVU C;  2KQ7 A;  3EC8 A;  2HD5 B;  2FNJ B;  1IP9 A;  3CSF A;  4WJO A;  2L0F A;  1BT0 A;  4GOC A;  4ICV A;  1CMX B;  1RLF A;  2NBU A;  4LCD E;  4M8N A;  5LXI B;  1WGY A;  4WQO B;  3HK0 A;  3UIN B;  1P3Q U;  4GIV A;  5CX3 A;  2KO3 A;  3B08 A;  1OGW A;  4TV3 A; 
#chains in the Genus database with same CATH topology
 3QA8 A;  3ML9 A;  2YLM A;  4GMV A;  2KN5 A;  1IGD A;  2LVP A;  1N61 A;  2DAJ A;  2CHZ A;  3B0A A;  5H92 C;  4IWO A;  1X1M A;  1LO5 D;  2V1Y A;  4GDL B;  4L2Y A;  5I4D A;  1T6B X;  4HPP A;  1ZKH A;  3PTF C;  1F9J A;  1E7P B;  1D5Z C;  1I42 A;  4E71 A;  2KZR A;  3VXW A;  3R2I A;  1I4H A;  2WXG A;  3DBH I;  3W2D A;  2REX A;  1SJH D;  1V86 A;  1EO6 A;  3QWZ B;  2FCQ A;  3PZ7 A;  3DWM A;  1WZ3 A;  3IG3 A;  1QOF A;  4XC2 A;  2WXJ A;  2D3C A;  3BVG A;  3OG5 A;  1WGK A;  4MSM B;  2LGS A;  1GNU A;  3QC8 B;  4B0M A;  1PYW D;  2M19 A;  2IDY A;  4FBJ B;  3KUZ A;  4S0R A;  2W82 A;  1R4N I;  2IO2 B;  5D3I B;  1RAX A;  1GC6 A;  1RWS A;  1I35 A;  2DYB A;  3H7P B;  2G4D B;  3OAW A;  3RNB C;  2X8X X;  2A5U A;  2FAZ A;  2KWC A;  3AE8 B;  1TZ1 A;  5BMI A;  3RMK C;  2N1V A;  4N9F 4;  1J0G A;  4ZOH C;  1NVI D;  3TMP B;  4BZA A;  4HWI B;  3UF8 A;  1T5X D;  2IPK D;  1WX9 A;  4N59 A;  1QQR A;  2PIA A;  5CHF A;  3N30 A;  1NEN B;  3WAP A;  1WMH A;  4K81 A;  1SXT A;  4W9I A;  4HVB A;  2V3N A;  5DPS A;  2WXO A;  4AS1 A;  2WDQ B;  3EFU A;  2LJI A;  4QAY A;  1E8W A;  2C7N B;  2KMA A;  3AEG B;  3RYT A;  1L7Y A;  3NRZ A;  3DWG C;  3MHS D;  3WAO A;  2ZW1 A;  4NJ6 A;  4UDU C;  4EUT A;  1V1P A;  1GPX A;  1T0S C;  3KWV A;  3R7Q A;  3HM6 X;  3VUX A;  4ZYS A;  3BVM A;  3A9K A;  3BIN A;  2QEJ C;  3RCZ A;  1PUT A;  1H4R A;  4XE0 A;  3PRP B;  2J42 A;  4EOY A;  5L83 A;  4GN1 A;  4WWN A;  2MBB B;  4I6L B;  4M0W A;  3A1Q A;  2LGY A;  4RFB A;  3SEB A;  2Y5B B;  4KGS A;  1YIW A;  5DPT A;  5G5G A;  1E90 A;  2LFI A;  3ENE A;  1T3Q A;  4HLE A;  2KWD A;  1YX6 B;  3ABV B;  2M1M A;  4MH0 E;  2KDE B;  2G4S A;  1Z2M A;  3QX1 A;  2WU5 B;  1F2R I;  3NG0 A;  4AOF A;  4II2 B;  4AP4 C;  1E0Z A;  3DDC B;  2ASQ A;  1ET6 A;  2IY1 B;  1FNV A;  3PT2 B;  4OW0 A;  3IBE A;  4MH8 A;  4JPS A;  2E6X A;  2QSD A;  1ZP0 B;  1C78 A;  3HM3 A;  3ZVV A;  3ZW3 A;  4ZDV A;  5GMV A;  2JWZ A;  1WH3 A;  1DYQ A;  4M02 A;  4OZC A;  1XCT L;  1FCL A;  3ZO5 B;  1XO3 A;  1TS2 A;  1UWM A;  2WS3 B;  4IOI E;  3R8B A;  3ZXV A;  4XGA B;  1MHH E;  2ONQ A;  3PO0 A;  4BBN F;  2CJO A;  2IO1 B;  4OVZ A;  2KJH B;  1WGR A;  5IAA C;  1QZE A;  2JVC A;  2LVQ A;  3APD A;  4KKJ A;  2NBW B;  4FJY A;  4A90 A;  3DQV A;  2Y3A A;  3GZN I;  5JHB A;  2MJE A;  1TIF A;  2D2Q A;  3Q3F A;  3EUB 2;  4KDI C;  2V0G A;  3N1Z C;  4E3C A;  2LWP A;  1GB4 A;  2KTF A;  3JVZ X;  4GDK A;  4MM3 B;  4A6Q A;  4TKN A;  1MG8 A;  2WXQ A;  5FR3 A;  1WMH B;  2PPH A;  3L0W B;  1ZGU B;  3ZQ4 A;  1EF1 A;  4DBG A;  1Q10 A;  2MSE D;  1E8X A;  4FJZ A;  5JXV A;  3RPF C;  4ANV A;  1LQB A;  1TY2 A;  2BYE A;  3N1X C;  1TJE A;  4ARC A;  4TQ1 A;  3L13 A;  3L54 A;  1WYG A;  3L10 B;  3TEY A;  3VVW B;  1V1P B;  2KNB A;  1FNU A;  4DDI D;  3RFZ B;  1C76 A;  4DDG D;  4WH4 A;  2QC8 A;  3A9K B;  3IAM 1;  1WSP A;  4YTM B;  1V5O A;  4ARI A;  2I1J A;  1DOY A;  2D3B A;  1FD6 A;  1OFF A;  3WAN A;  4M0W B;  2N9K A;  3IVF A;  4L1B A;  3A1Q B;  2K5P A;  3W1S A;  2JUO A;  2X38 A;  1XT9 B;  2GLS A;  1RM6 C;  3I5J C;  4ZRK A;  2C9W B;  4RM8 A;  3DPD A;  2LGI A;  1UNS A;  1PQS A;  4EZK A;  4LJO B;  3H1U A;  5G55 A;  3P4S B;  3UIO B;  2ZVO A;  1HZ5 A;  1XLO A;  1T0Q C;  3NZS A;  3W1S C;  3ZUN A;  3PRZ A;  1VR9 A;  2LHD A;  2WX1 A;  4M00 A;  2J52 A;  4RM9 A;  1XEE A;  3PRE A;  4DHZ E;  5JH5 C;  3DBR I;  2N7J A;  2ZEQ A;  2WLB A;  4HEA 1;  3AE5 B;  2JWU A;  1FO4 A;  2IO0 B;  2UWQ A;  2M0A A;  2K25 A;  3E9S A;  5EDS A;  3QAQ A;  2NMQ A;  2L32 A;  1JW9 D;  3JSV A;  2K3U A;  3P4P B;  3U52 E;  1CK1 A;  2CJN A;  3NHE B;  2NTS A;  5IN7 A;  2HJ1 A;  2K8C A;  3O13 A;  2J0M A;  1MPE A;  5FKA C;  4BFR A;  3AE7 B;  5IO9 A;  1L5P A;  3Q2A C;  4C00 A;  2V4L A;  3IT6 B;  2OJR A;  2QJL A;  3GP7 A;  1KH0 A;  1KF6 B;  1HTQ A;  3M95 A;  4KZ0 A;  2R2O A;  2FID A;  3P2B A;  3K9O B;  4GDK B;  1L4Z B;  3Q8F A;  2BGF A;  4A3P A;  2KX0 A;  2V9H A;  3UIP B;  4RMA A;  4DXF A;  2CHW A;  2CU3 A;  2WU2 B;  4MJS A;  4ZRP A;  1NBF C;  4BVU C;  2BTE A;  3EC8 A;  3C19 A;  2H89 B;  2IND C;  3Q3M C;  1YQ3 B;  3FAH A;  3EGR A;  4GOC A;  1TKG A;  4LCD E;  1QF6 A;  3R2T A;  3W5U B;  4GIV A;  1UF0 A;  4KX6 B;  3B08 A;  1OGW A;  3HUI A;  3AMZ A;  2NPT A;  5J18 A;  2WXN A;  2J7Q B;  2LD9 A;  3RD2 A;  3MC0 B;  2KFK A;  4ZYN A;  3A9J A;  2DNF A;  3HVZ A;  2GBN A;  2I1K A;  1JQ4 A;  4EZL A;  5HI1 A;  5J2R A;  1OEY A;  2KAJ A;  5MPO A;  1YMH E;  2KLG A;  2IJ0 A;  1C1Y B;  2G1E A;  5L95 C;  2K8H A;  2KWU B;  2KAC A;  2JXT A;  3R66 C;  4XWT A;  1E7V A;  3HHM A;  4HCP B;  3V62 A;  2KDI A;  2G45 B;  5D2M B;  1SB3 C;  2MBE A;  1D6E C;  1VD2 A;  3N32 A;  4ITK A;  1WF9 A;  5GXG B;  1JWS D;  2FUH B;  2NCN A;  4GU2 A;  5E6N A;  1I4X A;  1ESF A;  1R7S A;  2JU6 X;  3C8Y A;  2BPS A;  1N5W A;  3TIX A;  3RNA C;  3RNF C;  4FHK A;  3AI5 A;  3KVF B;  2YEP F;  3P63 A;  2MJD A;  1N60 A;  2D11 A;  3AEA B;  1Y8R C;  1FCC C;  3RNC C;  3PLU A;  3AXC A;  4W9F A;  3RT3 B;  1EWC A;  1WX7 A;  4JGH B;  3TSS A;  3PVL A;  4F1S A;  2DZJ A;  2BWF A;  3H9D A;  3AB5 A;  4G11 A;  1MG4 A;  3Q14 C;  2UYZ B;  3N1Y C;  2LUM A;  5IA7 A;  4MJS B;  3U7Z A;  1AWD A;  2D5G A;  4IM3 A;  2WXR A;  4A20 A;  5C1Z A;  2CHX A;  3A33 B;  1C79 A;  3TBL D;  5E6J A;  3VQI A;  3TL5 A;  4MGY E;  1KLU D;  3K9P B;  1ZDV A;  1SE4 A;  1AAR A;  1RFA A;  5LXH A;  5D7G A;  2NPT B;  2RSU A;  4YT0 B;  5D6J B;  1SEB D;  4MEL A;  3ETR A;  2C7H A;  1U4A A;  4FXC A;  1UEL A;  2KFK B;  3A9J B;  2NBV B;  4BKT A;  2JT4 B;  1I4R A;  3OJ4 B;  2INC C;  1Y56 A;  3DBS A;  4GLS C;  1FRD A;  2RGF A;  2LRW A;  2FIF A;  1TT5 B;  2WXK A;  3AV8 A;  4IG7 B;  1F0Z A;  3L16 A;  3QCA A;  1V5T A;  1WJN A;  3URY A;  5BMH A;  2B76 B;  1YD8 U;  2WDV B;  1XLP A;  2V4I B;  4IKG A;  4RF1 A;  2CS4 A;  2BB6 A;  2BB5 A;  3CST A;  2JXX A;  1M4V A;  5DCN A;  5C23 A;  3VTV A;  2PLP A;  2SEB D;  4KVG B;  1DOX A;  1MJD A;  1KTK A;  4LJP B;  1B1Z A;  2MBH A;  4P7I A;  2FUG 1;  2N9L A;  5KHO A;  2LVO A;  1YN4 A;  2XNA C;  4P1B C;  1AN8 A;  4YSY B;  2INP E;  2KN4 A;  4LNO A;  5HG2 A;  4BKS A;  4G0N B;  1A70 A;  3QAR A;  4A55 A;  1IGC A;  3B2G A;  3UQA A;  2DZK A;  3AE6 B;  2MX2 A;  2Y5P A;  4HCN B;  4J3O D;  3WAL A;  3LJ3 A;  2VH1 A;  4AQ7 A;  1LXD A;  2NVU I;  3DVN U;  3MHZ A;  1WRI A;  2MWS B;  2FCS A;  4J6I A;  1P9D U;  1V6E A;  2LI5 A;  2Q5W D;  3DCG A;  2AQ1 B;  3H6N A;  4URK A;  1H8C A;  1GJZ A;  1E10 A;  3RUI B;  4MM3 A;  4LNI A;  3DBL I;  1I4G A;  4NAW A;  1STE A;  4HJK A;  2KD0 A;  3VHT C;  3PHX B;  1ZXH A;  3TUO A;  2XK5 A;  3E56 A;  3AEF B;  2BQQ A;  3B9J A;  4XX5 A;  4GXB A;  4C56 C;  3VDZ A;  4YL8 A;  4RF0 A;  1SGH A;  3SU8 X;  2IO3 B;  1WIA A;  2KXJ A;  3VH3 B;  3ZIM A;  4PK1 A;  2HJ8 A;  5AZG A;  4IWP A;  2CKH B;  2Z59 B;  1HTO A;  4B9K A;  3NY5 A;  2LXA A;  5HFY A;  1C4A A;  1JRU A;  5D3D A;  2WGS A;  4WAF A;  2WP9 B;  5TSS A;  2LAS A;  2KC2 A;  1ISN A;  2VZK D;  1XQQ A;  3WCQ A;  1WR6 E;  1KRH A;  3RZW C;  3U7D A;  3PV1 A;  4BOS C;  4A9A A;  2MBQ A;  1JRO A;  4W9L A;  1XXG A;  4D2K A;  1GOZ A;  2RPV A;  2EKE C;  2VZK B;  2G9H D;  3PZ8 A;  4CYE A;  1K50 A;  4M8M A;  3T3N A;  3APC A;  1B9R A;  2JYT A;  3TJP A;  1BML C;  1OTR B;  1V9J A;  4TMA B;  2ZJD A;  3APF A;  3RI7 C;  1F2R C;  5LLI A;  2O2V A;  3UGB B;  3CF6 E;  2MA9 B;  1J7B A;  4H2A A;  3BY4 B;  1AW7 A;  2PJH A;  4REZ A;  1P7F A;  4DHJ D;  2MEK A;  5CTR C;  3VTU A;  1VDV A;  1V1O A;  2WDR B;  3VH4 B;  2ZZP B;  5BMG A;  4IM0 A;  2ZNV C;  1L6V A;  4P16 A;  4KDL B;  4DHJ B;  2WXP A;  4BKS D;  1JWM D;  1WGG A;  2KDB A;  5CHW A;  4AWJ A;  1FEH A;  3DHG C;  4KZC A;  1J7A A;  2NTT A;  3ZDM C;  4G3X B;  2PE6 B;  1KOT A;  4N58 A;  2K9X A;  2B3A A;  1KLV A;  5BYS A;  4EKU A;  1WXV A;  4RGM A;  1D5X C;  3Q3N C;  2Z0D B;  4NZL B;  2KAN A;  4W9G A;  4ZHP A;  3IHP C;  4C80 A;  2GBR A;  1JCK B;  2I38 A;  4AJY B;  4A3O A;  4S17 A;  2KTR A;  4FLH A;  1WZ0 A;  1C4P A;  2H88 B;  4NAW B;  2EEL A;  2PVG C;  2W54 A;  4MEM A;  1FFV A;  4EFO A;  2XK5 B;  3CMM B;  3Q8B A;  4PS8 A;  4CQN A;  2PW9 A;  2M0X A;  4P1C C;  3VR9 B;  3I9V 1;  5CHV C;  3QK0 A;  3PSE B;  4LNK A;  1ZXI A;  1WXM A;  1TBE A;  3ZJT A;  4ACF A;  3BVZ A;  2OED A;  2KJ6 A;  4FHJ A;  5G2N A;  1BUI C;  3V3X A;  1YQB A;  4ANU A;  4XDD A;  2FNJ B;  2HTM E;  4ICV A;  1HEZ E;  1RLF A;  2NBU A;  4L23 A;  3AE3 B;  5LXI B;  3UIN B;  3HK0 A;  1F77 A;  2KO3 A;  4WWP A;  5DPR A;  3B2F A;  1L6U A;  4BBN C;  1SE9 A;  4MDK E;  1WFY A;  2WDT B;  3TEZ A;  3SFD B;  4FAD A;  4P6V F;  1XD3 B;  3FIL A;  4E74 A;  2N0S B;  4I6N B;  1EWY C;  2KQS A;  3P4R B;  4W9H A;  2K0P A;  2ZCC A;  1YN5 A;  2ZNV B;  2WQY B;  2O2V B;  4W9J A;  4B0E A;  4HDO A;  3UI3 A;  3MJ5 A;  2L52 A;  4HRS A;  1T0Y A;  2GBK A;  5JZE B;  3QHT A;  4Q2J A;  5LNK 1;  4HRO A;  3KH0 A;  4HPM B;  4II3 B;  1AYF A;  2A4Z A;  2XN9 C;  1LGR A;  1HA5 A;  5J17 A;  4K7W A;  1Q5W B;  1HXY D;  3UQB A;  3DVG X;  1G6J A;  2QCZ A;  2OJW A;  3NVY A;  3ZGZ A;  2N7D A;  3VUY A;  4YSX B;  3VRB B;  4YTN B;  5FR6 A;  4HXD A;  5EE0 A;  3P1M A;  1NI2 A;  2C7M B;  2LZ6 A;  1ZDX A;  1ACC A;  3RUL A;  2V3P A;  2BW2 A;  2BKR B;  1E6E B;  2DEN B;  2L1A A;  3AUL A;  4IWQ A;  3AU5 A;  4DWF A;  1WJ4 A;  1NDD A;  3H8H A;  2FCN A;  2LGD A;  1WJ6 A;  4MAC A;  5H8Y E;  2VRR B;  1SSN A;  3R3M A;  2KTR B;  4FUL A;  3KYD D;  1FXT B;  2NR2 A;  3GS2 A;  2M17 A;  4XZ4 A;  2BYF A;  1ENF A;  2L7R A;  2N9X A;  3DVN V;  1S1Q B;  3Q8E A;  2KYW A;  1C4C A;  1L0V B;  1WJU A;  1PGA A;  2E3T A;  2MH7 A;  1EU4 A;  5FK9 C;  1R4M I;  1WWT A;  2WWZ A;  3NVW A;  2IYD B;  3U8Z A;  3V6C B;  4G50 A;  2G3Q B;  2DZM A;  2M8S A;  1UD7 A;  3J9C A;  2KC1 A;  1MI0 A;  2LEK A;  2NS5 A;  4MT5 A;  2ZVN A;  3DOW A;  2QIE B;  3Q6B A;  3Q69 A;  1ROE A;  2CU1 A;  2AQ2 B;  3L4P A;  2MHJ A;  3ZNG C;  2BYT A;  4LK0 M;  1YQ4 B;  3AED B;  3FIL B;  4XDC A;  4RGT A;  1TKE A;  3PRM B;  1SE2 A;  1I4Q A;  3DBR B;  4DHZ B;  1GAQ B;  2DYM A;  3HIZ A;  4JE3 B;  1YX5 B;  2N9P C;  3HVD A;  2DWQ A;  1SBB B;  1FXA A;  2GI9 A;  3FKY A;  4BKG A;  1FMA D;  4GSW A;  4ZRI A;  4TQ0 A;  1WXA A;  2JX5 A;  4WWO A;  3IXS A;  2GB1 A;  1UWX A;  1PGB A;  1A5R A;  4MGI E;  1ZOY B;  2Z0E B;  2KVR A;  2LXC A;  4AUQ C;  1DOI A;  4W9C A;  3PS6 A;  4C7Z A;  2IBI B;  1SIJ A;  3VFK A;  1MFW A;  2WXL A;  3AH7 A;  4K1R B;  2ACZ B;  2QHO A;  1GG3 A;  1VCB A;  1UBQ A;  3KUD B;  3M63 B;  4US8 A;  4KSK C;  4US9 A;  4YSZ B;  1E8Y A;  2ON8 A;  4K3B A;  1WYW B;  1EUV B;  3EA6 A;  3P4Q B;  4R3D A;  3ZRC A;  1IPG A;  3VAW A;  3ZTC A;  4NPN A;  3TCA A;  4CHK A;  2FBW B;  3S2A A;  4ZHO A;  4XWW A;  3GOE A;  4FA6 A;  3IFW B;  1FFU A;  2L76 A;  1YNT E;  1OQR A;  2MW5 A;  2HE7 A;  2OOB B;  3U4E G;  5C2T B;  1L0Y B;  4KSL C;  3D32 A;  5EE9 A;  2V3S A;  1PGX A;  2JZP A;  3EFC A;  2AYO B;  2J53 A;  1L0X B;  2KQ4 X;  1XF5 L;  1OQQ A;  1V2Y A;  2DBY A;  3KUC B;  5IKC M;  3EHV A;  3WA0 A;  3W9C B;  1YJ1 A;  3RNE C;  3V61 A;  4JLC A;  5BO4 B;  2JZ3 B;  4HDQ A;  4B95 A;  2JY6 A;  3W5V B;  2L8J A;  3KYC D;  3FC4 A;  2DZI A;  1V8C A;  3EEC A;  1Z5S B;  4B6W A;  3AE4 B;  4IM2 A;  3VUW A;  1E9M A;  3PGE A;  4WUR A;  1KLG D;  4C4V A;  1WM3 A;  2L83 A;  2KT7 A;  2LJ5 A;  3ZDT A;  1SE3 A;  2N1W A;  1UH6 A;  2AL3 A;  1TS4 A;  1WI0 A;  3R7R A;  1CZP A;  2J4X A;  3PHW B;  1F1H A;  1TS5 A;  1HZ6 A;  4DXA B;  2LUE A;  2GRI A;  4ASW C;  2PEA A;  4W9E A;  2UU7 A;  2M56 B;  2WXI A;  2GOW A;  4PS7 A;  1VZ8 A;  1QKZ A;  2KVZ A;  3H7S A;  4HK2 A;  2DAF A;  4PT5 A;  3ML8 A;  3TEW A;  1WY8 A;  1WXQ A;  4M01 A;  2CR5 A;  4F8C B;  2IZV B;  4KV2 A;  3KQ4 A;  2PTL A;  1N63 A;  3O65 B;  2QMT A;  4YXD B;  3SFE B;  2I2Y A;  3N20 C;  2GBM A;  3OWE B;  3T3O A;  3ZYY X;  4OZB A;  2XEW A;  4JQW C;  3WIM A;  5D94 A;  3W1Y A;  5IP4 D;  2ZCB A;  3L17 A;  3LDZ E;  2L05 A;  1JWA D;  1RYJ A;  1UGJ A;  4FJV B;  1D3Z A;  1Q1O A;  4W9D A;  1E5W A;  2D3A A;  3AU4 A;  2L3Z A;  2QIL A;  2IGG A;  3NZU A;  1WGD A;  1FM0 D;  2PVO D;  2SAK A;  3U2S C;  2EMS A;  3ZRF A;  1N62 A;  1WRD B;  1D5M C;  1NYR A;  4EE2 A;  4JIO U;  5EE1 A;  4OVU A;  1SF0 A;  2C60 A;  4HJG E;  3M62 B;  4RGO S;  1KFY B;  3LB8 C;  3NZ3 A;  4IUM B;  4PS3 A;  4WWM A;  4IW0 A;  2YEP B;  4EZJ A;  3Q3O C;  3V60 A;  4RGN A;  2R2Q A;  3RZF A;  1FNW A;  2RMM A;  1TY0 A;  2MBO A;  3Q8A A;  4GB9 A;  4TUU A;  2KQ7 A;  4OHJ A;  1IP9 A;  3CSF A;  4WJO A;  4IDI A;  1BT0 A;  3DBH B;  1IBX A;  1J7C A;  1P3Q U;  1JRP A;  1P7E A;  1HQR D;  2FE8 A;  4I6P A;  1P0R A;  2AX5 A;  3NJT A;  3VR8 B;  3ONS A;  2GBJ A;  5AZF A;  1IUE A;  4C4V B;  2WXF A;  2EMT A;  2WX0 A;  1EM7 A;  1QIL A;  1NYQ A;  3AE1 B;  4JX1 C;  1WXS A;  3ZNZ B;  3ALB A;  2DHZ A;  2W3R A;  3SHQ A;  1YOV B;  1R4N B;  3ZKJ C;  3I3T B;  3P42 A;  1QOA A;  2HTH A;  1V81 A;  1XLN A;  2BVC A;  4K7U A;  1M94 A;  3KLS X;  2RPQ A;  1YJI A;  1FRR A;  4F7Z A;  3GB1 A;  3QIJ A;  3MJW A;  1TZO A;  2R61 A;  1QLB B;  2N4F A;  1L4D B;  2MQJ A;  4KIK A;  2KWV B;  3I57 A;  4ICU A;  2RDH A;  5G5H A;  1J8C A;  3AE2 B;  1V97 A;  3HRD D;  2EKI A;  2MP2 A;  4RNA A;  4KKI A;  4KGT A;  2PMV A;  4WJP A;  2BYV E;  5E6P A;  1SJE D;  1N5X A;  4NQL B;  1EU3 A;  4YTP B;  3IT4 B;  4ANX A;  3DBL B;  3BII D;  2W55 A;  2YVC A;  3MP9 A;  2JRI B;  1K52 A;  1TGZ B;  2KLC A;  2C5L C;  1ET9 A;  1MHX A;  2DX5 B;  3KW5 B;  1QOB A;  3GE3 C;  2ZPY A;  1E8Z A;  2BT6 A;  2W3S A;  1LM8 B;  2N7E A;  2JSV X;  2BS2 B;  3MTN B;  1P1A A;  5T8I A;  2K39 A;  4IC7 B;  3OJ3 A;  1ZE3 D;  5KHQ A;  4RCO A;  1ZUD 2;  2LHE A;  3N9Y C;  3JW0 X;  3CWI A;  3VTW A;  3RN9 C;  3X0W A;  4X57 B;  3A4S C;  2MCN B;  2WXM A;  1TYG B;  5AUI A;  1OEY J;  3DHH C;  1KJT A;  1LFD A;  1WM2 A;  1JML A;  3OLM D;  2AL6 A;  3ZJU A;  3B1L X;  1TS3 A;  3BYY B;  4RH6 A;  4WQM A;  5AZH A;  4K7S A;  1P98 A;  1CQV A;  2ZPN A;  1V80 A;  4N6E B;  2RD0 A;  3Q8C A;  4K3C A;  4DQO C;  1IBX B;  3MC9 A;  3L08 A;  2D10 A;  5TR5 A;  4ANW A;  4OZA A;  2DLB A;  1WE6 A;  1UGM A;  1UZX B;  1C3T A;  2W9N A;  1JWU D;  4NAM A;  3NUH B;  1YN3 A;  1DGJ A;  5BYR A;  3A4R A;  1VJK A;  2J0J A;  3X23 A;  2ICI A;  3I63 C;  4BOZ B;  3QQ8 B;  3TEX A;  1RRB A;  3ZNH B;  2IGD A;  3SDL C;  1PDX A;  1D4B A;  2KJR A;  2AEH A;  4NNJ B;  1GC7 A;  5EE3 A;  1WGH A;  1FIQ A;  1UUP A;  2WNM A;  5HHD G;  1GB1 A;  3NS8 A;  3PLV A;  2BWE S;  4KIK B;  4EEW A;  1QT9 A;  4DK5 A;  2O6V A;  3DHI C;  3AE9 B;  2VH2 A;  3GZN B;  4YWG G;  1FXI A;  4NJ7 A;  2MP2 B;  4LDT D;  1V49 A;  5AUK A;  1Q0W B;  2K6Q A;  3ZJV A;  3ZTD A;  2BKF A;  3QJZ A;  1GUA B;  1ZW7 A;  4CO7 A;  2KHW B;  3ZXR A;  4LDT B;  4ZRJ A;  3SR6 A;  4A8X C;  4NQK E;  2JYE A;  3T9L A;  3U30 A;  3PPA A;  2MRP A;  2FCM A;  2M4N A;  2BS3 B;  4WIP A;  1JAL A;  5E6O A;  4LNN A;  4C7Y A;  3BZD B;  3NVV A;  3ZLZ A;  1FPY A;  4WJQ A;  2KK8 A;  3BK2 A;  2KX3 A;  2PKO A;  3V6E B;  2RDB C;  2WHI A;  4WJN A;  2Y5C A;  4MGK E;  4HKZ E;  4JWU C;  3LYY A;  1MVK A;  1I4P A;  1UBI A;  3AEC B;  1SIF A;  4AJW A;  1E7U A;  3AEE B;  1HE8 A;  1K8R B;  1KM7 A;  2AWT A;  3N3K B;  1QOG A;  1WR1 A;  1XLQ A;  2K22 A;  4LLG M;  2JPH A;  1NI3 A;  2ZW0 A;  1N6Z A;  4MGZ E;  2Z8L A;  1YJJ A;  4HKQ A;  2KDM A;  3GE8 C;  1J19 A;  2HDE A;  2WXH A;  3PZD A;  3RNG C;  2QDF A;  3WAM A;  2J0K A;  2K8B A;  4ZRQ A;  1JWB D;  1TKY A;  4BAX A;  4W9K A;  2L0T A;  5AEK B;  2GMI C;  1VZ6 A;  5C3J B;  1VRA B;  1TTN A;  1EF5 A;  1C9F A;  4GDL A;  1WE7 A;  2TSS A;  5HKH A;  2KDF B;  2DYO A;  2IGH A;  2JQR B;  3MC8 A;  4USA A;  1RFK A;  2XBB C;  2AQ3 B;  3VRA B;  3M3J A;  4PYZ A;  3Q3J A;  1NEK B;  5BYQ A;  1C77 A;  2K6D B;  1F52 A;  4MSQ B;  2JZZ A;  5JHA A;  3AN1 A;  1PFD A;  1L2N A;  1K53 A;  2O6V D;  1BXT A;  3BK1 A;  2INN E;  1K51 A;  2RDG A;  4NY0 A;  4OVV A;  3LXF A;  2D3G A;  1VLB A;  3KWL A;  2D07 B;  2O6V B;  3BYT B;  4NJC A;  3ZNI D;  2MLB A;  1VZ7 A;  3NVZ A;  2KOX A;  4JL9 A;  2KMM A;  2IY0 B;  2BF8 B;  4FN2 A;  3NS1 A;  2MJ3 A;  2BBC A;  4DXG A;  2K1F A;  2RR9 A;  4KGR A;  3H7P A;  1XCQ L;  3JYU A;  4PYU A;  1OQY A;  2KKC A;  2BS4 B;  4JWS C;  4GGQ A;  2PE9 A;  1S3S G;  3JSV B;  2L00 B;  1R4M B;  2JF5 A;  3ECI A;  2N9E B;  2LGX A;  2JRH A;  3NOB A;  4XYC A;  1IYF A;  2LMC A;  3DVG Y;  2LRU A;  5DPW A;  3BWU D;  1ZPS A;  3T8M A;  2KFJ A;  2OHF A;  3C0R B;  1T0R C;  4HPL B;  1I7H A;  2WYQ A;  4TSS A;  2KMC A;  3CIR B;  4WAA A;  4LNF A;  4LTU A;  1WX8 A;  3SD5 A;  3V05 A;  3MFG A;  3AM9 A;  1CJE A;  2HD5 B;  2L0F A;  5IOI A;  1CMX B;  4M8N A;  1WGY A;  4WQO B;  3AEB B;  3IAS 1;  4O1N A;  5CX3 A;  4TV3 A; 
#chains in the Genus database with same CATH homology
 3QA8 A;  2NPT A;  4I6P A;  1P0R A;  4WWP A;  5DPR A;  5J18 A;  3ML9 A;  2YLM A;  3ONS A;  4GMV A;  2J7Q B;  2GBJ A;  2LD9 A;  4BBN C;  2KN5 A;  1SE9 A;  4MDK E;  5AZF A;  1WFY A;  2WDT B;  2LVP A;  3RD2 A;  4FAD A;  1XD3 B;  2DAJ A;  2CHZ A;  2KFK A;  2EMT A;  2WX0 A;  3B0A A;  4ZYN A;  4E74 A;  3A9J A;  4IWO A;  1X1M A;  1WXS A;  2V1Y A;  4GDL B;  3ZNZ B;  3ALB A;  2DHZ A;  4I6N B;  1ZKH A;  2KQS A;  2GBN A;  3PTF C;  2I1K A;  1F9J A;  3SHQ A;  4EZL A;  3ZKJ C;  1I42 A;  3I3T B;  4W9H A;  4E71 A;  2HTH A;  5J2R A;  1OEY A;  1V81 A;  2KZR A;  2ZCC A;  2ZNV B;  2KLG A;  2O2V B;  4K7U A;  4W9J A;  1M94 A;  3VXW A;  1C1Y B;  2RPQ A;  4HDO A;  4F7Z A;  5L95 C;  2K8H A;  2KWU B;  1T0Y A;  2GBK A;  5JZE B;  3DBH I;  3QIJ A;  3MJW A;  3QHT A;  2N4F A;  2REX A;  1V86 A;  3R66 C;  3KH0 A;  1EO6 A;  2MQJ A;  2FCQ A;  3QWZ B;  4HPM B;  4II3 B;  4KIK A;  2KWV B;  1E7V A;  3HHM A;  4HCP B;  1WZ3 A;  3V62 A;  2A4Z A;  3IG3 A;  2KDI A;  4ICU A;  2G45 B;  4XC2 A;  5D2M B;  2MBE A;  1J8C A;  5J17 A;  1VD2 A;  3N32 A;  2MP2 A;  4K7W A;  4MSM B;  1GNU A;  3QC8 B;  1WF9 A;  4WJP A;  2BYV E;  5E6P A;  1Q5W B;  2FUH B;  2NCN A;  4NQL B;  3UQB A;  4GU2 A;  4ANX A;  5E6N A;  3DVG X;  4FBJ B;  3KUZ A;  1G6J A;  1R4N I;  2IO2 B;  2N7D A;  2YVC A;  2BPS A;  3TIX A;  3VUY A;  1RAX A;  2JRI B;  4AJW A;  1GC6 A;  1TGZ B;  2KLC A;  5FR6 A;  2C5L C;  4HXD A;  2DX5 B;  1I35 A;  3KW5 B;  4FHK A;  2DYB A;  1NI2 A;  2C7M B;  3AI5 A;  3KVF B;  2LZ6 A;  3H7P B;  2G4D B;  3OAW A;  3RUL A;  2BKR B;  2A5U A;  2ZPY A;  2FAZ A;  2KWC A;  1E8Z A;  2DEN B;  1LM8 B;  2N7E A;  3AUL A;  1TZ1 A;  4IWQ A;  3MTN B;  2D11 A;  2N1V A;  4N9F 4;  1P1A A;  3AU5 A;  1J0G A;  2K39 A;  4DWF A;  4IC7 B;  3OJ3 A;  1WJ4 A;  5KHQ A;  1Y8R C;  1NDD A;  3TMP B;  3PLU A;  4HWI B;  3UF8 A;  2FCN A;  2LGD A;  1WJ6 A;  3AXC A;  1WX9 A;  3JW0 X;  2VRR B;  3R3M A;  4W9F A;  3VTW A;  3RT3 B;  2KTR B;  1WX7 A;  4JGH B;  3PVL A;  5CHF A;  3X0W A;  3N30 A;  4X57 B;  4F1S A;  4FUL A;  3KYD D;  3WAP A;  1WMH A;  3A4S C;  4K81 A;  2MCN B;  4W9I A;  1OEY J;  4HVB A;  1KJT A;  2DZJ A;  5DPS A;  2BWF A;  1FXT B;  2NR2 A;  3H9D A;  1LFD A;  3EFU A;  2M17 A;  4XZ4 A;  1WM2 A;  4G11 A;  2BYF A;  2L7R A;  2N9X A;  2UYZ B;  1E8W A;  2C7N B;  1S1Q B;  3DVN V;  2KMA A;  2AL6 A;  3OLM D;  3RYT A;  1L7Y A;  3B1L X;  5IA7 A;  1WJU A;  4MJS B;  3MHS D;  3WAO A;  4IM3 A;  4A20 A;  5C1Z A;  4NJ6 A;  5AZH A;  4K7S A;  4EUT A;  1P98 A;  1R4M I;  2CHX A;  2WWZ A;  3A33 B;  2ZPN A;  3TBL D;  2IYD B;  1V80 A;  3U8Z A;  2RD0 A;  3V6C B;  3TL5 A;  4G50 A;  4MGY E;  2G3Q B;  3R7Q A;  2DZM A;  2M8S A;  3VQI A;  1UD7 A;  3HM6 X;  3K9P B;  3L08 A;  2KC1 A;  2D10 A;  5TR5 A;  1AAR A;  1RFA A;  3VUX A;  5LXH A;  5D7G A;  4ANW A;  2NS5 A;  2ZVN A;  3DOW A;  3A9K A;  3BIN A;  2CU1 A;  2NPT B;  2RSU A;  3RCZ A;  1H4R A;  3PRP B;  5D6J B;  1WE6 A;  4EOY A;  5L83 A;  3ZNG C;  4GN1 A;  1UGM A;  4MEL A;  4WWN A;  2MBB B;  4I6L B;  3A1Q A;  2C7H A;  1U4A A;  1UEL A;  1UZX B;  2LGY A;  1C3T A;  2KFK B;  2W9N A;  3A9J B;  2NBV B;  2Y5B B;  4BKT A;  2JT4 B;  3OJ4 B;  1YIW A;  3PRM B;  3DBS A;  5DPT A;  2RGF A;  2LRW A;  3A4R A;  2J0J A;  3X23 A;  4DHZ B;  1E90 A;  3ENE A;  2FIF A;  4BOZ B;  4IG7 B;  2DYM A;  3HIZ A;  4HLE A;  3QQ8 B;  1YX5 B;  2N9P C;  3L16 A;  1YX6 B;  3QCA A;  1V5T A;  2M1M A;  1WJN A;  1RRB A;  3ZNH B;  4MH0 E;  2KDE B;  3SDL C;  4BKG A;  4GSW A;  4ZRI A;  4TQ0 A;  2KJR A;  1WXA A;  4WWO A;  1YD8 U;  2AEH A;  2G4S A;  1Z2M A;  3QX1 A;  4NNJ B;  1A5R A;  1GC7 A;  4MGI E;  2Z0E B;  2KVR A;  2LXC A;  4AUQ C;  1WGH A;  4W9C A;  2CS4 A;  3CST A;  3PS6 A;  2JXX A;  2IBI B;  4AOF A;  3VFK A;  3NS8 A;  5DCN A;  5C23 A;  3VTV A;  3PLV A;  2BWE S;  4II2 B;  4KIK B;  4AP4 C;  3DDC B;  4KVG B;  4EEW A;  2ASQ A;  2IY1 B;  4DK5 A;  2O6V A;  4K1R B;  2QHO A;  3PT2 B;  3IBE A;  4LJP B;  4P7I A;  2MBH A;  1GG3 A;  1VCB A;  5KHO A;  3HM3 A;  3ZVV A;  3ZW3 A;  4NJ7 A;  4ZDV A;  2MP2 B;  1UBQ A;  2LVO A;  3KUD B;  5GMV A;  2JWZ A;  1WH3 A;  3M63 B;  4LDT D;  4KSK C;  1V49 A;  1Q0W B;  2K6Q A;  1E8Y A;  1WYW B;  1EUV B;  3ZTD A;  3ZRC A;  4BKS A;  2BKF A;  4G0N B;  3QAR A;  3QJZ A;  1IPG A;  3VAW A;  1GUA B;  3ZTC A;  3UQA A;  2DZK A;  1ZW7 A;  3ZO5 B;  2MX2 A;  4CO7 A;  2KHW B;  4HCN B;  4NPN A;  3TCA A;  4LDT B;  3WAL A;  4CHK A;  4ZRJ A;  4NQK E;  3S2A A;  3T9L A;  3LJ3 A;  3U30 A;  3PPA A;  1LXD A;  2NVU I;  2MRP A;  2FCM A;  2M4N A;  3DVN U;  3GOE A;  4BBN F;  4FA6 A;  2MWS B;  2FCS A;  2IO1 B;  2KJH B;  1P9D U;  4J6I A;  1V6E A;  3IFW B;  2LI5 A;  1WGR A;  3DCG A;  5IAA C;  5E6O A;  3H6N A;  1QZE A;  4URK A;  2L76 A;  2JVC A;  2LVQ A;  1H8C A;  3APD A;  1GJZ A;  2MW5 A;  2HE7 A;  3ZLZ A;  2OOB B;  2NBW B;  4FJY A;  3RUI B;  3DQV A;  3GZN I;  4MM3 A;  5JHB A;  3DBL I;  4WJQ A;  4NAW A;  4HJK A;  2D2Q A;  2KD0 A;  3Q3F A;  4KSL C;  3D32 A;  3VHT C;  2KK8 A;  3PHX B;  4KDI C;  2V3S A;  2KX3 A;  2XK5 A;  3V6E B;  4E3C A;  2LWP A;  2KTF A;  3JVZ X;  2AYO B;  4GDK A;  4MGK E;  4WJN A;  4TKN A;  1MG8 A;  1WMH B;  4XX5 A;  4GXB A;  1V2Y A;  2PPH A;  3VDZ A;  4YL8 A;  1UBI A;  3KUC B;  1SIF A;  1SGH A;  3SU8 X;  2IO3 B;  1WIA A;  2KXJ A;  3EHV A;  3L0W B;  3VH3 B;  3WA0 A;  1E7U A;  1ZGU B;  3ZIM A;  1YJ1 A;  1HE8 A;  2HJ8 A;  1K8R B;  1KM7 A;  1EF1 A;  4DBG A;  5AZG A;  2MSE D;  2AWT A;  2CKH B;  1WR1 A;  2Z59 B;  1E8X A;  3N3K B;  4FJZ A;  3NY5 A;  4IWP A;  2LXA A;  3V61 A;  4B9K A;  1JRU A;  2JPH A;  4JLC A;  5BO4 B;  4ANV A;  1LQB A;  2BYE A;  4TQ1 A;  3L13 A;  2JZ3 B;  4HDQ A;  2LAS A;  4MGZ E;  4B95 A;  3L54 A;  2JY6 A;  2KC2 A;  1ISN A;  3L10 B;  3VVW B;  2L8J A;  3KYC D;  1J19 A;  1XQQ A;  2KNB A;  4DDI D;  2DZI A;  1WR6 E;  3PZD A;  3EEC A;  3RZW C;  1Z5S B;  4B6W A;  4DDG D;  4IM2 A;  3VUW A;  3WAM A;  2J0K A;  3U7D A;  2K8B A;  3PV1 A;  3PGE A;  4BOS C;  4W9K A;  2MBQ A;  4W9L A;  2L0T A;  1WM3 A;  2GMI C;  5AEK B;  3A9K B;  1TTN A;  1V5O A;  2EKE C;  2LJ5 A;  3ZDT A;  2I1J A;  2N1W A;  1UH6 A;  1EF5 A;  4GDL A;  1WE7 A;  2AL3 A;  3WAN A;  1WI0 A;  3R7R A;  4M0W B;  4CYE A;  5HKH A;  3IVF A;  2KDF B;  4M8M A;  3PHW B;  3A1Q B;  3APC A;  2DYO A;  3W1S A;  2JUO A;  1XT9 B;  2XBB C;  3M3J A;  3TJP A;  4PYZ A;  4DXA B;  1OTR B;  1V9J A;  2LUE A;  4ZRK A;  2C9W B;  4RM8 A;  4ASW C;  2PEA A;  2ZJD A;  3APF A;  5LLI A;  3UGB B;  2O2V A;  3DPD A;  3Q3J A;  4W9E A;  3CF6 E;  2MA9 B;  2GOW A;  2K6D B;  3BY4 B;  4MSQ B;  2JZZ A;  4PS7 A;  5JHA A;  2PJH A;  1L2N A;  1PQS A;  4EZK A;  4LJO B;  3H1U A;  2O6V D;  3H7S A;  5G55 A;  4DHJ D;  4HK2 A;  3UIO B;  2DAF A;  5CTR C;  3ML8 A;  3VTU A;  2ZVO A;  4NY0 A;  4OVV A;  1WY8 A;  3NZS A;  2CR5 A;  3W1S C;  3ZUN A;  3VH4 B;  3PRZ A;  2D3G A;  2ZZP B;  4F8C B;  2IZV B;  4KV2 A;  2D07 B;  4IM0 A;  2WX1 A;  2O6V B;  2ZNV C;  3O65 B;  3ZNI D;  4KDL B;  4DHJ B;  4RM9 A;  3PRE A;  4BKS D;  2MLB A;  4DHZ E;  1WGG A;  2KDB A;  5CHW A;  2KOX A;  4AWJ A;  4JL9 A;  5JH5 C;  3DBR I;  2GBM A;  2ZEQ A;  2IY0 B;  4KZC A;  2BF8 B;  2XEW A;  4FN2 A;  4JQW C;  2IO0 B;  3WIM A;  2UWQ A;  5D94 A;  3ZDM C;  3W1Y A;  2K25 A;  2ZCB A;  3L17 A;  2K1F A;  2RR9 A;  4G3X B;  3LDZ E;  2L05 A;  5EDS A;  3QAQ A;  3H7P A;  4FJV B;  2PE6 B;  1D3Z A;  1KOT A;  3JYU A;  1Q1O A;  4W9D A;  1E5W A;  2B3A A;  4PYU A;  1KLV A;  3JSV A;  1OQY A;  3AU4 A;  2L3Z A;  4EKU A;  1WXV A;  2KKC A;  3NZU A;  2Z0D B;  3NHE B;  1WGD A;  4GGQ A;  2K8C A;  2KAN A;  2PE9 A;  4W9G A;  1S3S G;  2J0M A;  3IHP C;  3JSV B;  2L00 B;  2JF5 A;  2GBR A;  4BFR A;  3ECI A;  4AJY B;  4A3O A;  2EMS A;  2N9E B;  2LGX A;  2V4L A;  3ZRF A;  2JRH A;  3NOB A;  2KTR A;  1WRD B;  4FLH A;  2OJR A;  1WZ0 A;  4JIO U;  1IYF A;  4NAW B;  4OVU A;  3DVG Y;  2LRU A;  5DPW A;  3M95 A;  4KZ0 A;  4MEM A;  2C60 A;  2R2O A;  2FID A;  4EFO A;  3P2B A;  2XK5 B;  3CMM B;  3T8M A;  2KFJ A;  3C0R B;  4PS8 A;  3M62 B;  3K9O B;  2M0X A;  4GDK B;  2BGF A;  4IUM B;  3QK0 A;  4HPL B;  5CHV C;  4A3P A;  4PS3 A;  2WYQ A;  2KX0 A;  3PSE B;  3UIP B;  2KMC A;  1WXM A;  1TBE A;  4IW0 A;  4WAA A;  4RMA A;  4EZJ A;  1WX8 A;  3V60 A;  2CHW A;  3SD5 A;  2R2Q A;  2KJ6 A;  4MJS A;  3RZF A;  4FHJ A;  2MBO A;  5G2N A;  1YQB A;  4GB9 A;  4ANU A;  1NBF C;  4TUU A;  4BVU C;  2KQ7 A;  3EC8 A;  2HD5 B;  2FNJ B;  1IP9 A;  3CSF A;  4WJO A;  2L0F A;  1BT0 A;  4GOC A;  4ICV A;  1CMX B;  1RLF A;  2NBU A;  4LCD E;  4M8N A;  5LXI B;  1WGY A;  4WQO B;  3HK0 A;  3UIN B;  1P3Q U;  4GIV A;  5CX3 A;  2KO3 A;  3B08 A;  1OGW A;  4TV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...