2LGEA

Nmr structure of the calcium-bound form of the protein yp_001302112.1 from parabacteroides distasonis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
129
structure length
129
Chain Sequence
b'GDDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVYKNGKEIEKKSLVFRDGKEISTDDLNLYYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the calcium-bound form of the protein YP_001302112.1 from Parabacteroides distasonis
rcsb
source organism Parabacteroides distasonis
molecule tags Metal binding protein
total genus 14
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.50 Mainly Beta Sandwich Lipoxygenase-1 Lipoxygenase-1 2lgeA00
2LGEA 2LG7A
chains in the Genus database with same CATH superfamily
1LPBB 3V92A 2P0MA 2WY6A 3VF1A 1LNHA 2XHHA 3IBZA 1ETHA 1NO3A 3FG4A 1N8QA 1RRHA 1Y4KA 1LPAB 1QM6A 2PPLA 1BU8A 1RP1A 1GPLA 1OLPA 1FGTA 4WFOA 2KXTA 1CA1A 1HPLA 1LOXA 2LG7A 2XHJA 2WXUA 1IK3A 4WHAA 3PZWA 1FGMA 2IUKA 2IUJA 2LRGA 2LGEA 1FGOA 2PVSA 3BNBA 4QWTA 3V98A 1W52X 2XFDA 1F8NA 1FGQA 1FGRA 2WXTA 1GYGA 2FNQA 3FG3A 2KXVA 3U6GA 2OXEA 3V99A 3BNCA 1QMDA 4NREA 3CWZB 1RRLA 2SBLA 4QEYA 3FG1A 2QNGA 1YGEA 1JNQA 1KHOA 1N8SA 1ROVA 5EEOA 1HU9A 3BNEA 2XFEA 2QZ7A 3BNDA 3O8YA
chains in the Genus database with same CATH topology
2LRGA 2XFDA 2LG7A 4QEYA 2LGEA 3U6GA 2XHJA 2XFEA 2XHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGE A;  2LG7 A; 
#chains in the Genus database with same CATH topology
 1LPB B;  3V92 A;  2P0M A;  2WY6 A;  3VF1 A;  1LNH A;  2XHH A;  3IBZ A;  1ETH A;  1NO3 A;  3FG4 A;  1N8Q A;  1RRH A;  1Y4K A;  1LPA B;  1QM6 A;  2PPL A;  1BU8 A;  1RP1 A;  1GPL A;  1OLP A;  1FGT A;  4WFO A;  2KXT A;  1CA1 A;  1HPL A;  1LOX A;  2LG7 A;  2XHJ A;  2WXU A;  1IK3 A;  4WHA A;  3PZW A;  1FGM A;  2IUK A;  2IUJ A;  2LRG A;  2LGE A;  1FGO A;  2PVS A;  3BNB A;  4QWT A;  3V98 A;  1W52 X;  2XFD A;  1F8N A;  1FGQ A;  1FGR A;  2WXT A;  1GYG A;  2FNQ A;  3FG3 A;  2KXV A;  3U6G A;  2OXE A;  3V99 A;  3BNC A;  1QMD A;  4NRE A;  3CWZ B;  1RRL A;  2SBL A;  4QEY A;  3FG1 A;  2QNG A;  1YGE A;  1JNQ A;  1KHO A;  1N8S A;  1ROV A;  5EEO A;  1HU9 A;  3BNE A;  2XFE A;  2QZ7 A;  3BND A;  3O8Y A; 
#chains in the Genus database with same CATH homology
 2LRG A;  2XFD A;  2LG7 A;  4QEY A;  2LGE A;  3U6G A;  2XHJ A;  2XFE A;  2XHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...