2LGNA

Lactococcin 972
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and properties of lactococcin 972 from Lactococcus lactis
rcsb
molecule tags Antimicrobial protein
molecule keywords Lactococcin 972
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09683 Lactococcin_972 Bacteriocin (Lactococcin_972)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lgnA00
2LGNA
chains in the Genus database with same CATH superfamily
3IBOA 2E7LA 3HE6C 4NB7A 2OMYB 2B8OT 2QPDB 3IE4A 5E2VH 4N1EA 3QFJB 1BZ7B 1U8IB 5JW3L 1WO2A 1ZPLA 5JA8B 4WEEA 4NYLA 1S7TB 1E40A 1MI5B 2WIIA 4PB0H 3DJSA 5HJ3B 3UYPA 3P73A 5GSRA 4DEPB 4MAYB 2FJHA 1IKFH 2ZXQA 3P0GB 2VCOA 1NUDA 2CRZA 5GIRB 2BNUB 3MJWA 5E4IA 1CURA 1G9HA 1COBA 4O4YL 4L3ED 5D2NA 4U0QB 2V7HA 4BELD 4BK8A 2Y2YA 1RK0A 5EBMB 1BYPA 1Y7VA 4JNXA 1CQYA 2D31A 4FABH 3ECWA 1XXDC 2PYEB 3QUHA 3GMNB 3L95A 5C7ZA 2JKRM 1FZMA 2LT9A 3TV3L 2YAPA 2Z9TA 4ZDHB 4JKPL 5AD0A 2DJUA 2GITB 4XPTL 5JNYB 5E00A 4O2FA 3L1FA 4LLYB 4XCFL 1BLNB 1FH2A 5FX3A 2PO6D 3D39B 2F08A 1WYJA 2JJUA 4F8PA 1VGKA 4APXA 1KOAA 2BNQE 2FEJA 2B4CC 1JRHH 4QXWA 1K8DA 2H3XC 5F88B 3HI5H 1FYTE 3X17A 1WD9A 4S1DC 1HH9A 1G94A 1LK2A 3KLAB 2YSSB 5CNHA 4FL4C 4OVVA 5IJBC 4DZ8A 1HS6A 3BSGA 1F4WH 3P9MA 3QCVL 2B3RA 4L4VD 2DQHL 3L4CA 3SJVD 2HRLA 1KT2A 5CEZD 1YEGH 3FHEA 4MQSB 1MCSA 1NIDA 3OHXB 2L7EA 4NPYB 2HKAA 1KV7A 1INQA 1CICA 1MIEH 3VXMA 1RH8A 3QI9A 4S1RL 2BOCB 4MD4A 2DWDB 4OLXH 3V52L 5IFAL 5IW3A 4NQSB 1JERA 4URTB 3EAKA 3E8UH 2YXVA 4WDIB 4HSAC 4QR7A 2DH3A 3U1SH 1FZOB 4FQPA 1H3PH 3DHMA 3N50A 5JXEA 2P4AB 3I6KB 4JHUA 1JZIA 5TE7L 1R24B 4U2ZA 2O4EA 2WQXA 4NI3A 2WXPA 2YLKA 5ALBH 3V52H 5IFAH 1K6QH 5LDUA 3H42H 1MCOL 1TEYA 4FYRA 3FRPG 5DC9B 3LHPL 2X9ZA 4ZW6A 1T66D 3HBZA 2A99A 1K3IA 3WIAA 1MFUA 1NCWL 1KBGH 1RHFA 2P5PA 3B2VL 1A2YA 3UG5A 2X3AA 3HI6H 4MMZC 1BFSA 5J6HB 2YKKA 1RAMA 3IT8D 1PLAA 2ADIA 5LCVA 3SE4A 4XGZB 4Z7VB 3ZE2B 4OFIA 4N9GA 4ZS6D 1RUPL 3RGVD 1QMUA 3LNIA 4ZUVA 1U3HD 2IGTA 1K6QL 1IO4C 3HG1D 3U4BL 4PR5A 1UCBL 3KGUA 4U0RC 5DK2B 1HSBA 3EG9A 2P7TA 4XTRC 4AE0A 2V5MA 3PQYE 4K4KA 5GS3A 2VOTA 1TLKA 3ARGB 3QYCA 4OZFH 4EDWH 1E8WA 1KCSL 2X10A 1V3KA 2Q2LA 3RKPA 1OAYH 5IUSA 3VRIA 3PJSA 43CAA 2F7QA 3HS8A 3C60B 4KI5D 4P2QB 5ELIA 4DW2L 1F2XK 5FCUL 5MERB 2H6PA 1KYUA 2GJZA 4O5LH 1LLAA 4B96A 4UOJA 2VT0A 5D2NE 3FQ4A 2EUZA 4HC1H 3U9WA 4KRMB 3MR9B 1JNNL 4H8WL 4FAAB 4MQ7A 1J87A 4AYSA 5CIPH 1A7PH 1ZLUH 3SDXE 1AKJA 1NEPA 1ZLDA 5IEHA 4PJXA 2J6EL 2ZCLL 4HGWA 5H37G 4BQ6A 2LTQC 5I75C 3DETD 3BWSA 1X5FA 3FQ2A 3QQ4B 3APNA 5D7IF 4KDTA 2OYMA 3GWJA 1ASQA 3LIZH 4FQQA 2EKJA 2ZWLT 4G6AC 4GB9A 4LSSL 3DGGB 5HXMA 1JGVL 3L6FA 1A7OL 1UEYA 2XQBL 2BOLA 2XBZA 1YYCA 2YUXA 3BPCA 3AAZB 2UVFA 4NX0A 1G1YA 2N56A 3MRFA 5A1AA 3DPDA 2YUVA 2XWJA 3OKNB 4L29A 4EUPA 3PNWA 3M17A 5AB2A 2A9CA 4QTHB 1T22B 2Y36L 4GXFA 3AXLA 3V0VA 5E08L 1A5FH 1HHIB 4E41B 2OFQA 1WEJL 2DQCH 2D73A 1JMZA 4GRLA 1G7LB 2X87A 2YWZA 1FNGA 2AC0A 2FX8H 6FABH 1WFJA 3ETBJ 3QEQD 3O3AB 3AREC 3ULAB 3VMNA 3ULUC 3VD9A 1IAOA 2GI7A 2VAJA 4DUVA 5BMFL 4XNUL 3J27A 3FRPB 5FB8A 4M48H 1A7OH 2F74B 1VERA 2IH3A 1EFXD 2VKWA 5C3TA 2KPWA 4N2BA 5EUOB 3MV01 4LSRL 3NJVA 4HUNB 4X4YA 4X0NA 1F11A 2DN7A 5E8DH 4ZQKB 2YGOA 3DIVA 1KJVB 1AXTH 1ZE3C 1ACYL 3H7BB 2YEZB 2P8MA 3L7FA 3UTQA 1BIIB 2EDKA 3K7UA 3KLQA 3JWOC 4A6YH 1TFPA 1U4EA 5E8DL 3VYNA 3MGTA 4HGWB 2NSXA 1EBAA 4LOEA 1U92A 2WQVA 4K7PH 2Y1YA 4JDZA 4ZAKB 1VENA 4G43A 2P5WE 5TDPB 1MCPL 4K3JH 2YBRA 1ND0B 2BCKB 2VN4A 1JUFA 1IC5L 1FN4A 4F57H 4PJAA 4ZX3A 4PJ9D 3T3ME 5TD4A 2VRKA 1XGQB 2UY6B 3U1PA 3VFOA 3ULSA 4JO4L 2E9GA 3K5SA 1AY1L 1AR1B 1MVUA 1Z66A 4CMMB 5CZVL 1J0ZA 2DIEA 3GF8A 4M1CD 4KMLB 1P6FA 5CHNB 1EANA 5KS9B 3NCWA 3MBWB 4J6IA 3QUYB 4XOCA 2QGCA 3VTTA 2FLRT 2Z3FA 5AVSB 4B7LA 2DB8A 2VRAA 4DGUA 4OJDH 1JWUB 3MCYA 1RU9L 2NZ9C 3ULUD 3NIFB 2BHYA 4HPYH 4F7CB 2X4OB 3CFBB 1PX8A 2X6MA 1JZ7A 4IJ3C 2DEXX 4Q74A 5EDXA 5J11B 1DL7L 4KHTH 2D7OA 5T3ZH 3GLEA 3CD4A 2EQDA 1TQVA 3QNZB 3ARDC 1BOGB 3HS0A 5HHMB 5AW7B 1VEMA 4CA4A 3T8VA 1NOAA 4B9CA 1QBMH 3GMOA 3W57A 1GJWA 3LNEA 5K69A 1PSKL 2IEPA 1Q8MA 1EAQA 4X50A 3ZTCC 2JI1A 3K6FA 4JFZH 3ESNA 1SFDA 1VRSA 2VZOA 1MWAB 3L5IA 4MFHA 1KYDA 4NWTH 1NEZB 1WFTA 2NT0A 4YDKL 3STLB 1RUKL 4WY7L 3V0DA 5FYJU 3VXOA 1TU2A 2A4EA 4N8UA 3WL9B 2WLJA 4YDJA 1HNGA 1I9RL 5CZRA 3LN5A 1SBSH 4GRWF 3WGVB 1SBBA 3NQKA 2GJRA 5LGJB 4UV4H 5E9DD 2D7MA 1JMXA 2F1BA 1PZCA 1J05B 3FUNA 1HJBC 5I1AA 4Q89A 4HLZH 4MA3A 3KNBA 3P69A 3O3UN 3CFIC 3FUIA 1RKRA 3QQDB 1J1PH 3F04A 1VIWA 4PYGA 2Y7OA 5FK9A 2UY7B 4MD4B 2VR3A 1NGWA 4YBLB 4JZJA 2PPCA 4QCIA 2I60H 4MXWL 5FUOL 3R06A 4G8GE 3U6XA 3EZ8A 1ZS2A 5FM4A 4PVBA 3FTGB 1YPZF 4KRLB 1RCYA 1KB5H 5CEZE 4PP2A 2V2TB 2XN9B 3D25B 2CHXA 4Z7UB 2OXGB 1WZ1L 1OAZL 4LU5H 4PREB 3L3DA 1WAAF 2ICWB 5FXCH 4Z9KB 4JW3A 3U25A 5CCKH 2B9AA 4PI2A 4L3FA 4YE4L 5B38B 2AQTA 3ARDD 2FTAA 1I9IL 2HWZH 1RJCA 3RZCA 1MCQA 1NFIB 2BXYA 3RL2B 3VXME 5EFIA 3WS3A 3FUFA 3FSOA 2GBVA 2XVGA 4YE0A 5ABDE 2LFGA 3NP3A 4FP8H 1OSZB 5B3NA 4WHTA 1MNUH 3LH2H 3TVMD 1S9XB 1BG1A 5ABAA 3HG5A 4O2FB 1FFPB 2GITA 5JNYA 4QNPF 4FX5A 2DIBA 2NY0D 1MAKA 3HPLA 2QFPA 5D4IA 5TDOA 5GRJL 1OAKH 3QT2A 4HJ1A 2NDFA 5FYLD 2H32B 4HDIA 5SX4I 2VXTH 1G7PA 4LFHD 2YD4A 3MRHB 5IQOA 1SY6A 1ND0A 3UPCA 4GBXD 3RWEB 4O00A 5I71B 3GKZA 2ARWA 5IUCA 4JN1H 4QRUB 2X4UB 5AOIA 2OMVB 3TYFB 4HH8A 1MHHA 4XRCB 3KYNA 2G3ZA 1T1WA 3ZVVA 2O1AA 2VR7A 2WIIB 3UYPB 3EBIA 3ZHKA 2JXMB 3VGDA 5ICZB 1LILA 4WJG3 5GGSY 5CLWA 4JFHE 1T2QL 2R0ZL 3HG1E 4R4ND 2ROXA 5H2BB 1ZWIB 2BP8B 4DHLA 1YC8A 2G5UA 5HHOD 1WJ3A 2E27H 4YUEH 4EPSA 1T0MB 1IKOP 1CTOA 5JQ6H 2YPLE 1F11B 5E9NA 1RPQA 2OI9B 3GSQB 4Q4IA 3HG3A 4GP5B 2XETA 2DWEA 5EZJA 5L2KB 1J5OL 3APFA 3Q8AA 1TENA 4X5QA 3MV8E 2CXKA 1WZ1H 5BZZA 4X6CE 5IBUB 2Y72A 4PJHA 3HR5B 4D0CB 4FFYH 1KMGA 5C0FA 2C4XA 1JNJA 1FVEA 3BW9A 4I0PB 1G1CA 3U7YL 3UPAA 5KAQF 2DEWX 1NCDH 1G5GA 5IEKB 1AS8A 1BQHA 3QCTH 2X1PA 2J71A 2ZUQB 4GSRA 3DOSA 2I9LB 3KXFE 4IMLA 4M3JA 2Y7MA 3HC4L 3OAYH 2XXCB 5JXED 2VLJB 1EZSA 5FO2A 3RB7A 2OYKA 3ES6A 3Q6GL 3MOAH 2IQAB 2TAAA 1XFPA 3FFDA 3MRKA 3GHBH 4HOMA 2IWFA 2XVKA 4G6FD 3ES6B 2CO2A 4CSSA 1BZ8A 4KZEL 1W72H 3V8OA 2ZWNA 1B4TA 4OT1L 1FC2D 5M94B 4FFYL 2XPYA 3D51A 1MH5A 2QV4A 3QFJE 1FZKB 5FYKE 3FCUB 2F53D 1SY6L 2XNAB 3IXTA 5D6CA 1R19A 1UM6H 4NN5B 4EKJA 2AZAA 4U6HB 2AEQH 3MTXA 4Z0BL 3D0LA 3VJ6A 1N8OE 1MFAH 4O58H 3HR5A 4IGBD 4FQXA 4PHZA 4B9KC 3HC4H 4XC1H 4PJIE 5IIEA 3GDCA 1NM4A 1OTUC 3JWNH 4ZNEE 4NWUH 5CEXB 3MA9H 3TEXA 4U1HB 4PB0L 2H1XA 2IAMC 4G1EA 4S2SB 5KBNC 4Y5YA 5KVGE 4QJ5B 1KTCA 3FF7A 5ISZE 3KEHA 3C8KA 4Y5XC 3BKCL 2OMWA 1YCSA 1W8NA 2CM5A 2X0UA 3K4DA 1H6EA 4N4YB 2IO5A 2ADJB 3EOTL 5HVWA 4F7MB 3RRQA 1TQBB 2FB4L 4X9BA 3V6ZA 2Y1VA 3ILQD 4AX3A 2F61A 4FZEH 3QXAA 5K93A 1BBDH 2QR0A 2WXJA 2QL1A 3QRLA 4YHPA 4Z5RB 5FKAB 4DGYH 5IWLC 4JRXA 1IFHH 4WJ5A 4Y4KD 1E2ZA 3QPXL 1A7QH 3N06B 1EZLA 1DVSA 2K78A 1M42A 1T6BX 5E5LA 5C3IA 4L8SA 5HBBA 5CJQL 3IU4L 3HB3C 4PJ8B 3WNPA 1HNFA 1ITCA 2AKRA 3HG0A 3QCUL 4I2XB 4UOQA 2R8SL 4RGOH 5J3HD 3WENA 2YGVA 2DQTH 4HJGB 1TQCB 4BKLB 3G5ZB 4YHYB 5EUOF 4ZXBA 4PJFE 2W0LA 3HMXH 1DSWA 1GL4B 1WHPA 3GZPA 1P69B 5HGAB 2HRPL 5I30L 3ATBA 4QT5A 4FZ8H 1YEJH 1EWHA 4HCIA 4NBYB 3EUDA 2WB7A 1Q0XL 3SD5A 3CIQA 1OV8A 4MD0B 5D72L 3W2DL 2EECA 3BWUC 3EDDA 4WI2A 4KAQL 3F58H 3K6SA 3FU3A 1AQMA 4YL9A 3ULVD 3RZCB 1C5CH 3UBHA 3EHBC 1CUOA 1N5YH 5SWSE 1HIML 5K9OB 2XV2A 1IUZA 3U2IA 4EZJA 1OTUD 4JL2A 3GRGA 1GRWA 1IZKA 3SOBL 4TLSA 5FGBA 1BJ1J 1AACA 2IAMD 4JQXA 4OZHB 2Q87A 4HS6A 3P3YA 4TXVB 5ESAA 3MA9L 1IBFA 4TSBL 1HI6A 2Q8AL 3VFNB 2WQSA 3REVA 2WTRB 3U0PB 1KNOB 2HRHA 2ZCHL 4HWBH 1NCUA 4WI0B 5EZLB 2EH7L 5ESVA 3DJ9A 3ILQC 2ZJSL 3MRHA 3CBJB 3UMNA 1I9EA 2K6YA 4JFQA 3BFWA 3FB5A 1ZJAA 1QVOA 2WWKT 4IK6A 3UTOA 4NZTL 1EZUA 4P0DA 4NCDA 3FOLA 3BO8B 3NA4A 5FLVA 4F3FA 3LKPA 1A9BB 3OR7A 1F4AA 4JHAL 1EO8L 2W07B 4BV1A 1Z6JT 4NQCA 1V7ML 3MPCA 3MRJA 4JGMA 1U93A 4ONFL 3IN2A 5CSGA 3CZUB 3H9HB 1SXNA 1XCQA 1ZAGA 4IU2A 4L4TB 3OZ9H 4X80L 4E9XA 4NSKB 1YDPB 5EIVA 4EN3B 3V5DA 3SKMB 3QZLA 3B7SA 3ZRFC 5BJTB 4DP5X 3B3IB 3OG4B 1KN2H 3N1FC 1T1YA 1X7QA 3GNMH 2X3BA 3HS0B 2OZNA 3IJHA 3NRFA 5DA0B 1FE8L 2NMSA 2JJSA 5BO0D 3DV4A 3EJUA 4HZ1A 4GMTL 4XCFH 2YZ1A 1DJSA 1JVOA 5MEND 2N7AA 4LSDA 5D7IA 1AI1H 1S2EA 3IJEB 5T1MA 4BH7A 4C83B 5B8CB 2OR9H 4M7JL 1KXHA 4UDTA 1XEDA 4GSDH 1P1ZB 4M61A 1CBVH 3EADA 1D2OA 1PQZA 1S7XA 2EE9A 4H0LC 4M7KL 1E28A 1E4WL 5EPMB 4E9LA 3ARWA 4PJBA 3O6LL 7CGTA 1E7UA 3CTTA 3NAAH 4F7EA 2ADFH 2YPVA 4MZRA 2UY6A 1RUPH 1JPTH 4K0OA 1AGBA 4HJTA 1Q1JL 1YEIH 2XIIA 4K7PX 1JE6A 2ED8A 2MHAB 4OF0A 1I4FB 1E4KC 1U8PA 4BIKA 5F1IA 1B88A 1NAMH 4BH8A 3OB8A 4CVZB 4N0YL 5AW8B 1L6PA 5SWQB 2ED9A 4JM2B 3UG3A 2NY3B 1F6AB 3LSOA 4CJ0A 3IDXH 1MG2C 4NUPA 4OF5A 3NACL 5AW5B 2B08A 5JA9A 5AYQA 4ZZFA 4JG9A 3S5LA 4C59B 2WNGA 2IH1A 1XZ0B 1NCJA 2NTFB 1X7SA 4JCWA 2DIJA 5M95B 3WE6A 1CLYH 3GHEL 5F96L 5EU7C 3QEGL 3WY1A 3TT1H 1SM3L 1RZ8B 4BDVB 4JRYD 4CSTA 2MNUA 4NHUA 5HHOE 2X4OA 3CFBA 5F7KC 3QH3A 4PJDF 2J3SA 2C3VA 2E7MA 4OD2A 1G87A 1PY4A 3UTTE 2K0RA 4JHZA 4MJHA 4PUBH 4QIRA 4JFOA 4Z7WB 2CPCA 2H1LM 1FAIL 4L1BA 4OAWB 3OKDB 4RQQA 1N3NA 2PF6A 1M7DA 3FDWA 4J3OH 2JSFA 2HVBA 5CP3A 1ZV2A 4PRHE 2HVJA 1OB0A 4LARL 2ENJA 4M6OL 1M3JA 2EDNA 2Q86B 3RG1C 1UQSB 4PJDB 4PJAB 4Y9GA 3JWDH 2CBTA 1HCFX 2DQGL 2MPAH 3LV3A 1FFNB 4FI7A 5I1CL 3GSVA 1KFGA 5CIPB 1WICA 4APQC 4WUKL 5GZOD 2X89D 5CO1A 2EABA 3O11B 4LB8A 2H32H 2HFEB 3AQXA 3B5GA 1QEWB 4KFMA 4G2AA 5FA3B 2DW5A 3AAZA 3S4SG 4NZRL 4QPEA 1OD7A 5JYMA 3NG5A 5I17A 3MUY1 1A9EB 2BM3A 3DI3B 3UROR 1FFOB 2JIXB 4WNQB 1EO5A 2QMJA 4X0KB 2JJTA 2XJKA 3VSQA 5BMFH 4KVNH 1T04A 7TAAA 4DEWA 3SBQA 3S88L 1HKFA 3CSYB 2ZXCA 3QVAA 3D8MA 3IFPA 3PWPE 1SN0A 4XPFL 4Y2OB 5IB2B 2B1HL 1QLEB 3EGXA 4JFFD 3ZYJA 1PLGH 1E90A 2G75A 1ZVHA 4F8NA 4H8WC 2P5EA 1RFDH 4ZXBC 3GK8L 3AW5A 4F20A 6CGTA 4BWWA 5EF2A 3CMOH 3L81A 3TVMB 3SPGA 4LCWE 3LQAH 2VDNH 4QRPB 3OSVA 5IVXE 2BP3A 4J7RA 3C60A 2NY2D 3CUPA 1TQUA 3DRTB 4IIQA 4JDVA 4XCEB 3VW3H 1C1EH 2XQ0A 1DQJB 3ILDA 1HAUA 1XGTB 5I0DA 2V2XA 1NEUA 3P9WB 3QJHB 1M7DB 2AITA 5F9OL 2A77L 3UDWC 3ZTJH 2P1YA 3M8OL 4ZS7H 1NMCC 1OW0C 1W16A 4JFOB 4HIXL 4QAMB 4Z7WA 5TQ2H 1E43A 2VDNL 2JNZA 1PBYA 3QNYB 1H6UA 1LO3H 4PJHF 2QVFB 3WUWB 3A21A 3F7QA 4KKCC 3WFDH 5I5RA 5HDBE 4J3VA 3ZGIA 1WFMA 3JWDC 5F1IB 5H94B 4G80A 3RUGE 5E08H 3QO0A 2AJYL 2EO9A 1MRFL 4MAUH 5IROA 2GAZB 3FN3A 2PW2A 2X2HA 3NZ8B 4TLUA 3TONA 1HEZA 5GS0L 3IU3B 3IFOB 4MDJB 3K1DA 1AGFA 1FNLA 3Q8BA 1ZGLB 4O02H 4PB9H 5AZUA 4GSUA 3T3MB 5FYKH 4BFOA 4DVBA 2VDQH 4ANXA 1MQ8A 1Q0YL 4YIQA 4KITB 3QJVB 4CC4A 1L7TH 5JHLH 1N18A 1QRNA 5ILTL 2CKBL 2OMXA 1A22B 4FXGA 4NJAL 3THML 5A2KH 2XPGB 4NFDA 1URIA 1HEHC 4P2QA 4L1TA 1A4JB 3FO0L 3VRIB 3SKOA 2X6VA 4AYID 4N90D 3B2PA 4ZOBA 2OP4H 3CK0H 4P23B 5T1DL 3LN4B 1VCBC 3QHFH 5AKSA 3PP4H 4H25B 1JCKA 3J8F7 3PWUB 4MJ6A 2H9GA 2YA2A 3ZJAA 4ZMLA 1N4XH 4GKSB 3RY4A 1IIIA 5BV7L 2BOCA 4JREC 4XO4A 2PCPB 1AC6A 4AQ1A 3QI9B 1G7JB 3HMWH 5F6IB 4BZ2L 4XOBA 2CCVA 4YHZL 2QGDA 2W88A 5D71L 3WY4A 3IFLL 3Q6FA 4GSXA 1O7DE 4XZUA 4QOKD 1BF2A 2EYTB 1FLRH 1CR9L 4V1DD 1KV3A 1YQ2A 3EOYG 4MVBD 4CVXB 3QDMA 2YMXL 3V4UH 3N1MC 3QRGH 5TDNB 5JHLA 1SDDA 1YEEH 4YR6A 1AY1H 1QFPA 4H5SA 4IBZA 4BWUA 4LSVH 2G5BB 3H3PH 3ATFA 5HJDA 5HYSG 2CK2A 3EYOB 5AQ0A 3D18A 4BE5A 1LK2B 3KLAA 2BIMA 4Z3HA 2XZAL 3V0WL 3OZKA 4G8IA 4WUUD 3L4ZA 2YJLA 2J6WA 3LDBB 3MOQA 2YS4A 4LKXA 4RDQF 1LE9A 1XSOA 3F6IA 2QADB 3H3BC 3T4YA 5DJ6B 1ZVSA 2AK1L 1KFAH 4TSCH 3KVQA 4O2EA 2AQ2A 2PN5A 2DQUH 1L9OA 4P2CG 2X2JA 2OSLA 5FV2A 2WLIA 1N6QL 1NL0H 2O61A 3ZKNC 3QDJB 4XMTA 2O26U 5G55A 2WUCL 3MRPB 4XPGL 2QQKH 2OL3L 2GIXA 1QTYT 5E94B 1EUUA 4PJIF 1XB8A 3QHZL 1V10A 3VWKC 4G3YL 5DZAA 2GSIB 2F1AA 4PRAA 3WFCL 3FBKA 1UKQA 5KUMA 3VFNA 4ATTA 4ZT1A 3GBDA 3IGAB 2A83A 2HB0A 2VWEC 3L1OH 4AYGA 5F0PB 3CU1A 1KIUA 2ZSVB 3BP4B 4WO4C 4HP5A 5MENA 4Z7UF 4K9EC 3MUGA 3PG2A 4K9EH 3BEWA 1RZ7L 2QEJA 5KSUB 1AD0A 3MX0B 4PRIE 4K71C 4O9HL 1AYOA 4WW2F 4XVUC 4OLWH 2LAGB 3GSRB 1JTPA 4ES8A 5AZEH 2C1PB 4PS4L 4IEFA 4C47A 5CGYD 4X7TA 3BN9C 5I5IA 5DSCA 1D5BB 4S11A 4XI5D 1WBXA 3TN0B 3U30C 5ID0A 2I60L 2IFFH 5C9JA 5FA4B 2JJSC 4IMKC 1GIGH 2VXQA 1S9VB 3LY6A 1FNFA 3EYQD 2VLKD 1BJ1H 5DD1L 4N85A 1FL3B 3X3GL 1FORH 4GMSH 2VQ1B 5I1HL 4PBWD 4JFEB 5DVMA 4WSKA 1USZA 5LBGA 3V0EA 5HYJA 4XP9H 3DPBB 4UQCA 5JHDE 5J56B 2JFCA 3R4RA 3MRGA 1CFSB 5DVLA 2FZ3A 4YSAA 5KBDA 5C07B 1M6OA 4HHAA 3DYOA 2E75C 2V5TA 4HX1B 1MAML 4S2SA 1ZLSH 7PAZA 1CDUA 5J6GB 5CEZH 2YO3A 3U9UB 4QRPA 1QSEA 4E5XG 4L4VB 4F37K 5LGYA 2QR0B 1N12A 1OM9A 1QUPA 4OZFB 1G6RH 4EZLA 1BZ7A 1U8IA 4IQHA 2ZOKA 1UWEL 2ZQKA 3TBYA 5HYSB 3BGAA 3QJXA 3TNMA 3O4LE 1GOHA 3ILEA 4RZCB 5FO8A 1GKEA 3KBEA 3PLYA 1FJ1B 4TNFA 3F84A 1KEGH 1L3NA 4NZFA 5FO8B 4AV5A 2H1PH 2N0KA 1ZRUA 2ENPA 2EE3A 3P02A 4OZGF 3TBYB 5HYSA 3INUH 4KJWD 5DYFA 5I17B 1E9OB 4MAYD 3UTZB 2VDKB 5JOFB 4FQIL 4I4WB 2GB2A 4MNGE 4LEBA 1U33A 2TSAA 4JQXC 3FFCA 2P48B 1J8SA 2E0PA 5FFLA 4Y8DC 3TP4A 1RJLA 3VRJB 4ODTL 4RGMB 5AZEL 5HHNB 1U9KA 3WDHA 1ZY9A 3FYIB 1CFVL 1KDIA 1MFDH 2CJ3A 4RA0C 5EOCJ 1RIHH 5DQ9B 5A2IH 3ZRSA 1I7TB 1WCBB 1PZAA 4N6RA 5J12C 1BJMA 1CE6B 5AVWB 5EC2B 1FL3A 4DGWC 4A7SA 3VD2A 1D9KC 1UEMA 5I9QC 5EBGA 3MNVA 5ACMA 3K6DA 15C8L 4H1LA 1I85C 2YPLD 2JMRA 5G4OA 1CFVH 3IMSA 3QG6A 2HUEA 3RTQA 3NCEB 2IADB 3MLVH 4FL4B 1HWGB 3SDCB 2N1TE 4R4FH 4AIEA 1MLBA 1OD9A 1NLBH 3T8XA 3TF4A 2E7DA 4U1JA 3UJJH 1CGTA 1GY2A 3EGSB 3US0A 1HIMH 2WK2A 3DV6A 4YL4A 2X6UA 3VXSD 1CXFA 1WP6A 2OZ4H 1MFDL 3WTTA 1IRAY 3OAZK 3MUGB 2PO6C 5E2WL 2YAOA 4HJUA 1A7QL 1JHTA 3CFMA 2XFXB 3UIYA 3V9EA 1L7IH 3ELQA 2IDSA 2WPGA 4S1DD 4XNZC 4XXWC 2X2IA 4ESKA 4FHBD 2WVUA 4HUCA 1XCTB 3UEQA 1IEHA 3MU3A 4D9LH 1CG9B 2Z7UA 2HTKC 1AQDA 1OGAB 2XACC 1JFQL 1ID5I 2MHAA 1TF4A 5IOPA 4NN7B 2AJSL 3RUGF 4I85A 1ULVA 1UVQB 3D0VA 4FZ8L 5FECA 3DDFA 5C9KA 2A38A 1UXSA 3KGSA 3BAKA 1EHKB 5ICZA 4O2EB 4OZIE 4FXKC 3BCDA 4M3KB 1HN1A 3CAFA 4ETQB 2G5RA 1PZBA 4GKNA 4LLMB 4FI8A 4YAQA 3O0RH 5AB9A 2YD2A 5GGVY 4EE2A 4GRLD 1GAFL 3ERXA 4NKIH 5IT2H 5HYEA 4D9LL 2NX5E 4QMEA 2A6KB 1OP9A 2Z91A 3N43F 4LLUA 1J9TA 5EZIH 1HILA 1T7XA 1UHVA 1MFBL 1XF4B 2FL5A 4YX2H 3WO4C 2BSDA 2D8KA 3AFLA 2BP0A 5JPNA 1MZYA 2PETA 5IP4A 3GUTA 5GRZA 4QYOB 3WOVA 5LB1A 3VX1A 2KLRA 3FTGA 4YFLI 3HI5L 3KXFA 1R5WB 2IGFL 3B37A 4GAYB 2WBJB 1D5IL 3MV8A 1DZ0A 3ZTNH 1NFIA 4K5OA 1I7ZB 3RL2A 3FQWA 2WV3A 3LRKA 4X4XB 5F8QC 5B38A 4NDMA 3KXFD 4PIBA 3N9GH 1BEYL 3V6BR 1X5YA 5I6KA 1R5WA 3TV3H 1U8CA 4PW4A 4GQ9H 3ZIMA 3ZKSD 5ITFA 3HMXL 5L88L 5FGSA 3FOMB 3DHUA 4OIIL 4EN2A 1B6UA 4X4ZA 3RGVC 4LESA 5IHWA 2FCBA 4LF3B 4B41A 4TL5A 3DSFL 5IBLD 3VXUA 1U3NA 5DK0B 3J2PA 3MJ7B 1GZHA 3NGBB 4ZUWB 1BZOA 2DQIH 3F7LA 4LGRB 2RGSA 4U6XB 4AY0A 1U8HA 1E4XH 2OS7A 4QY8B 3O0LA 2HVKA 1I7RA 4O51B 5HHQA 5FK9B 2BWQA 5DK0A 2LV4A 1HCVA 4EIUA 4AW7A 3MLUH 1XGRA 2WP3T 4BA0A 4NC1C 3DUSA 1CL7H 4H8HA 3DX9A 2OR7A 5C0GB 4X8GA 1L6ZA 4MB3A 4NNYB 1WE5A 3OXSB 3QNZA 1RZJL 2MQ0A 1TG8A 3ZRCC 2X05A 2AXGB 5C92A 4BZ1A 4CBZA 3WY2A 1H3XA 3O0RL 2WYZA 1TZOA 3L4YA 3P4NB 4Y4HC 1R3IL 4L9LA 1AXSB 5ITBL 2W9DH 5DQDL 5I66B 2MNJB 1JN6B 3FB6B 3AS1A 3NZHL 5F3BA 1JXFA 3GM8A 4TTDD 5EA0L 3PAVA 4B97A 1KTLA 3DJZA 3IDJA 3MBEA 5AAMA 1ZCRA 3GIZL 3GIVA 4YC2C 5HTSA 3HBPA 5EEXA 1WBYA 1G4RA 2IXQB 4PJFA 2V5YA 4KMQA 5T1KB 3PGDA 4OD3L 1KTRL 4OZ4B 3I50L 2FJGB 3MA7A 4J3OD 1KB5B 2NX5B 2ADYA 4YSRA 2CDGB 1RUMH 2XN9E 5DFVD 1WCQA 3SBWA 5JHBA 5FHBH 5C0BE 1ACZA 2YFOA 4NM4H 3LTVA 5HGDB 4EDXB 3EF7A 3W11D 4B3EA 3FFOA 3VI3F 1DBBL 3BWAA 4TQIA 4H1LB 1XF5B 1FV1A 4MKTA 1IVLA 3OSKA 4WLCA 4MNHA 1YRKA 1JPSH 4JZNA 4QXGH 4WGWB 2JIXA 1BDYA 1BXUA 4WNQA 5ES4B 2VM4A 1M7XA 1YY8B 4M5YH 1CPUA 4C4KT 5JIHA 5KBLA 4OF6A 1SJHB 4OD3H 2J2ZB 1QSVA 5BQDA 4ZMOA 1FAIH 3A5VA 2X88A 3DVGA 3I9PA 2CALA 4X5XB 1DVYA 1A3RH 3FQRA 3CFKB 1W0VA 2DMBA 4N2GA 3VYOA 4HGKC 3WFEH 4HHWA 2C4FU 3FRPA 5D1ZB 3KPLA 4K5MA 1CXKA 1WEJH 3MJGX 5EBWB 2DYPA 1M7UA 3WI9A 1NICA 1E30A 1HCZA 5JW4Q 2YEZA 5CD5D 4POZC 3TX4A 3T2QA 2XX0A 5JZ7C 4BSWB 4RQQB 4W4OC 3BEVA 2V5RA 4UBDC 4RZCA 4KVCH 1K4DB 2DDQH 2Z92A 4PJ9C 1AFVL 4UQ2A 3RGBA 2PR9A 4YGAB 1KPRA 4PJBF 1P9MC 2PW1A 1A3LL 2EVHA 1DVTA 2ZAGA 3DYPA 3S5YA 4F2EA 2IQAA 4M1CC 4ORZC 2X09A 4JJHA 1I82A 3HS0C 3GBNH 2B4CL 4TLTA 4DKFH 1ZJBA 4PCTA 3B2DC 1I7TA 2EDLA 3VFSB 4NAQA 3WU1A 2SODB 4GRLB 1R0AH 4PGCB 3B9DA 4LKCB 2CUIA 4L9LC 4R6UA 3OMAB 1JZHA 1T2JA 5FGBC 2WZ5A 1BXAA 2VLLB 5DUML 3VQ2C 3SJVA 3U4BH 4MAZA 4WU7A 4OKVB 3VDBA 5C0JB 1GYCA 1CF8H 4WWPA 4ZW3A 2R29H 1AGDA 2WP3O 5AG9A 1VZIA 4NWTL 1TVDA 5CU9A 4N2HA 3T6XA 1FL5B 4XNMB 1EJ8A 1YLBB 5G2NA 1BHGA 3UJTH 3S3CB 3ML8A 2XWXA 5AVTB 3L3KB 5GZOC 1R0AL 2FQEA 3UBXI 3UO1L 4JR9L 4YWGL 1FL6B 3TNMB 1ZSHA 3V4VH 1N4XL 1NPUA 2F5BL 2KDGA 2ZOKB 4OFKA 3P40A 5MENB 1MFMA 3P2BA 3RGHA 3OKKB 5CD5C 3DO4A 4F93B 1A1NB 3DVNA 2B16A 5KVDE 3Q1EA 4ZSOE 1EK3A 2ADIB 1TZIB 1IM3B 1RZKH 5L4JA 4RFEA 3RHWF 2XX1A 3TEYA 2M8XA 4AH2A 3QEUB 3BLKA 1YEFL 5AW6B 4C4BA 2YFNA 4LSVL 1N6UA 4PWGA 1FVCA 2WXNA 3MGOB 5EWIH 2WLIB 4Z7NB 4Y2LA 4N0RA 4DT2A 3BJ91 3K4AA 4D8PB 3M45A 1CFBA 4O02L 2CDEB 3LEXB 3NPZB 4PB9L 5GISH 4F58H 1LE5B 2VDPL 4GRMB 1XF5A 1ZXKA 3CFJB 5I1IL 1YN6B 2WO4A 5CCKL 3JT0A 3OD3A 3PS6A 4R97B 3RWHB 4YGVA 4O2CB 3VA2C 1WGVA 3OR7B 2EH8H 1GYUA 3IJYB 3KPSE 4PS8A 3TTSA 4NI6A 4R83A 3F6LA 3I3BA 2WO3B 1Q0EA 5E8OB 2CZNA 4AITA 4GKLA 2WZ6A 1KYFA 5GHWH 4AMXA 5DGRA 2WSDA 5BOZG 1IEBA 5JPMA 2CO6A 3GPSA 3BUDA 3SDXF 2EACA 4KX7A 4PREA 4AIOA 5CCJA 1AAJA 4YSDA 3BUYB 3CDYA 4JPVL 4UI2A 4FXKA 3D87B 2OX5B 3L3JB 3LXCA 3NCXA 4Q4EA 1CZ8H 4L5FE 2JF1A 2XIBA 1GW0A 4UT9A 3I6KA 1HTYA 1HI6B 1A9VA 3AB0C 2DI7A 3H3PL 5DVNA 1UURA 1HESA 3PGCA 4K94L 4JR9H 1V8HA 4JKKA 1I8LC 3MSPA 3AC0A 2VIRA 4ZPTA 4YWGH 3ZUNC 2ETWA 3EJQA 2LAAA 1R3LB 1TTBA 4R2GC 1B90A 4NFCA 2ZWKA 12E8L 1AR2A 2OCFD 3JVGA 4XN4A 1J9RA 3T4AA 1X5AA 4MHHI 3L2LA 3KNBB 5EO9A 3FUMA 1QNZH 1N6VA 1DBML 4WGVB 3T3PF 2X5PA 3IJ9A 4K94C 2HT3C 4ABQA 3ZKMC 1F0LA 5ILTH 2ICEC 5C0RL 4LPVA 3T4YB 1DVXA 1JK8A 2P8LA 1A4CA 2FX7L 4UILL 3TH2T 4LKXB 5MHSE 3ASWA 1DVFA 3F7RA 1ZA3B 1BFTA 2VGLM 4WSGA 4FYQA 4HMDA 1JI1A 1U0QA 5F7DB 2Z8WC 3LZLA 4D8PA 1YEKL 1OQOA 2E6QA 2E9IA 2CQVA 4A2DA 4P04A 4UTAH 1RVFH 2EZ0D 4NO3A 2EDOA 1LO5A 1RJYA 2FHBA 2Z31A 1GGCL 1RK0B 3QS3A 5C09B 1CGXA 1JXGA 4UB0L 1WS7A 3LQZA 3BUTA 4L8CA 1NBQA 4DK6A 1MRCL 4ZZKA 1J1PL 1OAUL 3DK2A 3E7JA 5I82A 2J56A 3TC9A 1J1OH 2BNQA 4LEXL 3VXPA 3VD7A 1HDMA 4DQOL 5D2LE 1TVHB 25C8L 4KQ3H 1MG3C 1YUKB 2DJMA 4FQHB 4KO7A 3CZJA 4ZDHA 2Q7YB 4OCYH 1FZMB 1ML0A 1JD7A 3FQXB 2PCPA 4GKZA 5FDYA 4AQ1B 2M2DA 1XF3A 2NY2B 4P5SA 4OJAA 4LVOB 4HU8A 4ZFOL 4KDWA 2OMTB 1J18A 3S5LG 1MXDA 4JVWA 3ECUA 3T65A 5CM1A 2CHWA 2HTLD 2EYSA 5CGTA 2CBPA 1TZIA 3CFNA 2C26A 2HN7A 3V6OE 4IIQB 2BSCA 5FKPB 1R3KA 1YPZA 3MQIA 1I1RA 1TTRA 3FC8A 4XR8C 1O9WA 5KSVB 1NA8A 2QSTA 3QIUA 4JJ5B 4NYLB 2OXHA 3MXVL 4GW4A 2YBRB 4HUWA 3L45A 1QRNB 1MCKA 2VXTL 5D7HA 5I74C 4YAQB 2HT3D 4OCYL 4FDWA 4IKIA 4NOBA 3BP6A 3VU1A 1MQKH 4FI6A 4Q52A 3LZFH 4Y2OA 5J7CC 35C8H 1N7MH 2DLTA 4UT6L 1CL7I 5K1VA 1FZKA 4AQAB 3EJPA 2H26A 1FL5A 2PW2B 4HSQA 4WNSA 4M93C 4E36A 3WJLC 2X6CA 2JK5A 1JL8A 4I0KA 3FCSB 2YOCA 1E4XI 1LK3L 4WO4D 2VLJD 3P11H 4JPIA 4M7LT 1QR1A 4FYSA 1I8UA 4OKVA 3HAEG 3D50A 4HFWB 3W1ZA 2J8UF 4XAWL 1FRGL 1Y18B 3GTVA 4L4VE 2COQA 4C8XA 4EIZC 1CD8A 3MLVL 1Z0NA 3D6GA 4PJCF 1DVQA 1PY9A 2AS5M 3GMRB 4AL8L 5GS0D 4R5VA 3SHSA 2D4FA 3ZZQA 3QEQA 3QULA 2HFFB 6PAZA 3FYEB 1I9IH 4Y4KC 2FD6L 3T71A 2APBA 3RJQB 2V5SA 4LVHB 4XAWH 3PPEA 4Z0BH 3TT3H 1HJCA 3HE6B 5AFAA 4ANVA 4GW5B 1DQVA 5DFTA 2PPFA 1HK6A 3LN9A 3N42F 5D2LA 5J1AB 1F1AA 1NCGA 2HTLC 4LEEA 4MNQB 2VDLB 4Q9CA 2CXGA 3UMTA 1UGKA 4I48A 2DLFL 1WBZA 1SN2A 3NJMA 4G5ZH 3E9UA 2YA1A 2DQJH 2E56A 4MMXB 2XZCH 4ODUA 3D09A 3T77A 1BP3B 4KKNA 3L9RB 3WE6B 1F3JA 3MJ6A 2TSBA 4DVRH 1P7HL 2B9BA 2CRYA 3FU7B 1NMAH 3BD4A 4AIZA 2VUYA 3S5LB 1I8IB 3APMA 5HHNA 4WO4B 2NOYA 5EOTB 4TUOB 5I1LB 4N5ED 4XXDB 5DHVB 5CJQH 2EEFA 3QDGA 3VRLF 3NDZE 2CUAA 3OJMB 15C8H 4GXUN 1M1XA 3TO4C 1SJHA 5TFSH 5IT2L 2BVEA 2NY3D 3ARBD 4HIPA 3FCSA 2DRUA 3DX2A 5AYTA 2H6PB 4L0PB 2ZONA 5DHVH 5IHHA 2X3CA 1Q9KA 3E2HC 5HYQB 3P11L 1OOWA 4U1IB 4WU5A 4F80A 3KE0A 1CDJA 3MODH 3SE3A 4G8FA 1A4AA 2DKUA 3TYGH 4RMRA 5F7BA 2VQ4A 4EN3C 3W9EB 1KBWA 1JFQH 1G7QB 3PWPB 2ZCKH 1KB5A 2NX5A 4A38A 3M88A 4HT1H 3FCGA 5IBTL 4HULB 1TJIH 3O8XA 2CGRH 2L7UA 1O0VA 2FUQA 5T1KA 1S7WB 4HMCA 4NUMA 1D9KD 4Q0XL 1UZ6F 2P24B 4KK5C 2P5WB 3EFOB 2FX9L 4JPWH 3N0PB 4X80H 1KTJA 4MZ3A 3S96A 4BD4A 1DBAL 1DFBL 1XZ0A 2HPTA 3DUSB 5IW1B 2X4PA 1F6FB 4KDVA 5E2TH 3RAJH 5HYJB 5HI4D 4R8WH 3BUQA 5SWZE 1DEEB 1YDPA 3DX7A 5K59E 1L9TA 4XN9A 3T9WA 4S1QH 5CSBA 4P2OA 4XNDA 2EH7H 2W95A 1U93B 2LE9A 2QPSA 2YHGA 4XMPL 2HX8A 3TBTA 2RAMA 4WV1C 3BP7A 4BZ1H 4GI9A 3IU4H 3AQZA 3TZVC 1FUNA 5F7MC 3V5HA 1T7ZA 4W9DC 3QGVA 5I76A 2YSTA 5EOCH 1L0PA 4S1RH 2R0LH 4R4BB 5D2LF 1DQIA 1K8IB 2XSKA 2P28B 3CFUA 3LZNA 1DVZA 3OGCB 3IK2A 4O4YH 2NY3C 4LASL 2QTVA 2Y3NA 1HOEA 1QZ1A 2D3JA 1MJJB 2K3HA 4KKAC 4YQXH 3F5WA 5FYKD 4FCHA 4E41D 1MW0A 1D5XA 1OF2A 4NDMB 4GP4B 4ZNEA 4NKDB 32C2B 3EYSL 3RZWA 3X1GA 1U58B 3NA9H 5D7IB 3KWXA 2NY6C 1K9TA 1NEZA 3TBCA 1DBJL 1UB6B 1XBDA 3C8HA 2IDQA 1RSYA 4QGYA 5EU6D 3JV0A 4I88A 3HE6D 3IWUA 2WLLB 5IMKA 4AL8C 1KENH 2WNWA 4OCWL 3S5ZA 3Q05A 5D4HA 1MCWM 2AP2A 1MHCA 3B2VH 3C5SB 5I19L 3ESOA 4OFPA 4EN3A 4CGTA 3HHMA 2DEYX 3O8XB 2A6KA 4OZFG 4KK5D 1RPKA 4RSYA 5K39B 4P4RB 3KDMB 3QAZC 2OQJA 3NIGB 1Z9LA 2FT7A 2KI6A 2OR9L 3MRMB 4M7JH 1EAPA 4LP4A 5KYXB 1NFDE 2GFBB 3TCLA 2V9QA 5I5JA 4ZOCA 2W07A 3O6FD 1C12A 1WPCA 4R7DB 4LRNH 4P4KA 1XXFC 1LE9B 1J5CA 3LKPB 3PDDA 2NUPA 4D7BA 5B3JF 3CFJA 3K8KA 5I75B 5C97A 4G8IB 1M2OA 1FFTB 5BRPA 1H3PL 4XH2A 4EMZA 3EGDA 4JMNA 1HSAA 1U8KA 1ZIAA 3EO1A 5ICXB 4AQEA 1PZSA 2CNYA 5DJ2A 5ENWA 2ALWA 2JKJA 3HEIB 4GQRA 5F9DC 5FFGA 4E9TA 1YG9A 1N0XL 1LO4H 2EDJA 3HI1B 5GRVL 2DBLH 1M1XB 4PJCE 4FRWA 2WN3A 3CMGA 3OM3B 4X5WA 1X3DA 1WT5C 4P2QD 2GUOA 3U0TB 4LLQB 2VDNB 3P0YH 1WZLA 3QQ9C 5D5MB 3GTNA 3EO9H 4JFFA 3A6CL 3UAFA 4B53A 3Q01A 3FCTB 1IM3D 1PCSA 4LASH 5TGBA 3L4VA 2YJQA 1BIIA 3D2UB 3LHPH 1QQDA 4IKKA 2EUWA 5DHXB 4ZUSB 2NQCA 3HG1B 2GTQA 4F7MA 1RUML 3V6FA 5EZPA 3BLBA 4QI3A 1KJVA 1OGAA 1U6AL 2B0SH 1MEXL 1RZFL 1IM3A 2X40A 3C8KB 4JRYB 5EU4A 1ICTA 1C7SA 1UZ8B 1KCVL 2GPZA 3ZE2E 3HPJB 4AKQA 5KYWB 4JGJA 5F1NB 1X5XA 4XCYB 4GINA 4ODSL 1K85A 1YAIA 4L3CB 2CKBB 2P9RA 1XH3B 4IHOA 4FFVC 5FB8B 3VM5A 1GGBL 5F0JB 4AEHH 2WC7A 2YAMA 1MFNA 4WU7B 3AGWA 5HGAA 3FU8A 3MC0A 5BZXA 2EO7A 4LP8A 5C09D 4DKFL 3G5VA 4LARH 3B7RL 4UMSA 1DQLL 2HFTA 2ZP9A 3H85A 3LPOA 1ET8A 4M5SA 4ZXBD 5I6LA 4TRPL 1PX3A 1V7MH 1UCTA 4U1KB 1MIMH 4MDJA 1RJLB 1CYGA 4J3XA 5I1CH 2DWXA 1EERB 3QJUB 4B95C 3ESPA 2WKGA 4HF5H 3KWVA 4EQ3A 3AS2A 3RNKB 4DCQA 5FKAA 3VFTB 4HH9A 3ZN6A 5DZJA 4ELME 1RV6X 2VLJA 4ADJA 2VLLA 5D5MF 2FE0A 5L2KE 3S3PA 3LRHA 4J3OC 3LRLA 3ZMEA 4Z7WF 4KROD 3QNXB 3GUFA 2JKNA 3EH3B 3KWWB 4JZJC 5DF0A 5FUZH 2VKXA 5JXAH 4GT0A 3UJTL 3U46A 2EE2A 1CIUA 1DVFC 1ADQA 1PU0A 1KY7A 3N1PC 4PJXB 4U2YA 2JCCE 1GZQA 3GMMB 4ZMNA 5I1JL 1AKJB 2L8AA 4G6ML 1JPFA 2IC2A 4WKZB 4A6YL 1P7QD 1RLBA 3GLZA 4JE4B 5EBWA 3TCTA 5A6IA 3ZDZB 5D96B 5F97E 3W37A 1YEDB 3RWCA 2Y4SA 2CHZA 4I9XA 1S3RA 1JZJA 1K4CA 3IBEA 4H1LG 2ZUWA 4NNPH 1L0YA 5DWUH 5JW4N 1DHKA 4D9QD 4NLAA 4WEUD 5J11C 3BVTA 3EUUA 5JDJA 1JPFB 4WKZA 3BDXA 4RGNE 2Q20A 5CJOL 5EU4B 2XG5B 1RK1A 4L4JA 2EADA 4AXWA 2NSMA 2DD8L 2AI0L 2QFRA 4X6BB 4ZD3H 2FWSA 5FF6A 4H8UA 2GTZB 1T04B 3QI9D 4LZKA 4XZ4A 5DS2A 2LU7A 3BIBX 4LL1A 1OP5H 5I6XB 2WGNB 3QIWB 2XT1B 1YNTF 1WT5A 2FX8L 2WIMA 1IX2A 3MBXL 2RFXA 4TULL 1X4ZA 3CN1A 3VI4B 6FABL 1FV1B 4KKQA 2HJLA 1VCAA 5E99H 1MRDL 2VITB 2O5YL 5IF0A 1D6VL 4UNVA 4U6YA 2CWRA 4MRBA 4RRPM 3TYFA 3B9AA 4BXSV 4IDJL 5C07A 4M4RB 4PJ7A 1CLYL 4X99B 2JQZA 2ZYIA 3DVFA 3HI1A 4DZBA 1ZHBA 2E59A 3QJOA 3BPNC 3TASA 1BZ9B 1FVEB 3BW9B 3SGEI 3LDBC 4YXKL 3CNKA 5CLXA 5C0FB 3HPLB 3L9YA 2J8UA 4FCAA 4QD2E 3S2CA 3TBVA 1NSNH 3VWJA 4TUKH 4KROC 4OZHF 4C56E 2VUKA 4PJEF 5INDA 1G7HB 2WKOF 4PJCA 3GIVB 4UQIM 2IANA 3MOBH 1DVFD 1OSZA 2APXA 2P45B 2CLRB 2WXRA 2FO8A 3IMRA 4XCNB 3WS3B 4ZS7L 2UV3A 2I85A 3WE1A 2QBWA 1MF2H 3KDMA 4PWHA 1JGUH 3SBRA 4LFHG 3GB7B 4Q58C 4PLNC 1E2VA 2VDOL 3MA7B 1CFNA 4CC1A 4RAVA 2Z31D 1T7YA 2BSEA 3VXRD 3LRMA 5EU5B 3ZK0A 3MVSA 1ZT4A 4X9HA 1BX2B 4FJZA 4AUJA 5L7XH 5HVFB 1L9SA 4Z7UA 1UZ6E 4AYFA 3MBED 4P99A 4NNPL 4M48L 3KYAA 4ALAL 4JFYB 1U8NA 2C3XA 1XSIA 2HYMA 2HLFC 3E3QC 4I0CC 5CZVH 3U7WH 1H8NA 5I6MA 2NY1C 2FQGA 2R7EA 4ECNA 2X41A 3L3IB 3U2SA 3MOBL 5E7BA 1T4WA 4KDTC 3ZKND 4JQIA 2D03L 3OTTA 2Y07L 1NGWB 1OF2B 7PCYA 1G9NC 4JO1L 2VISA 3GSUB 1LP9F 1ZV5A 3AU0A 1DO6A 3WN5B 1HSAB 4WCYL 2AANA 3ARVA 4JRXE 1XQ4A 3VFGL 5ITFB 2N01B 2FJUB 3IGFA 1X9UA 1KLUA 3D39A 3QC6X 2XWTA 1DE4B 4JPVH 2O6FA 4DN4H 1HWWA 5IBUG 5AD0B 4X4XA 5KBPA 2CGYA 3GSWA 4LAQH 5TH2B 5I1GL 4NQCD 5H8DA 3VCLB 3ZW3A 3JTBA 2Y5EA 5CGYC 2WVVB 2YMOA 4XI5C 5D1QD 1Z9SB 3QXUA 5KBKA 5DJDB 1Q72H 3JYBA 3FOMA 5C0RH 2WLLA 5TDNA 5IKCB 5HP5A 4IJ3B 3AXIA 2EVIA 1D7CA 1UT9A 1BD2B 2VAAA 5GZND 1XT5A 1XR8B 1YY9C 2CHNA 1U8CB 1OE1A 2P24A 3OMNB 1IJNA 4UMGA 4BK5A 3NSYA 1XSKA 5I1IH 2I9TA 1SN5A 3CLEH 2WJ7A 2G4EA 2P46B 2WMPA 1S7TA 5FW7A 1G0YR 2BHZA 3QUXA 1KB5L 5LN8A 4EIGB 3MBEC 4N2FA 3MNZA 2W80C 3QFJA 3ZE1B 5T1JA 3VGHA 1A6VL 1K5NB 3E6HA 4NQCB 1UOLA 5TF1H 2UY7A 3ROOB 4LCUA 4JBSA 2FWUA 2HLFD 4UTBL 1NFDF 2YD7A 1QNIA 1ZMYA 3BH9B 5C70A 3E6FB 4E0RA 2NPLX 3LKOB 4KUCF 2H47C 4NUGH 4P23A 3MGAA 5C0EB 4NNXB 2HFGH 3EIFA 2BP0B 5SX5K 3NABL 3UJIL 5JPNB 1VFMA 1D6EB 2GIYA 1IGFH 4U33A 3ULSB 4EUPH 3RE0A 3L3OC 1RVFL 2UX6A 1KJ3H 5AOKA 4HLJA 3WN5A 2Z7ZA 2Y22A 1HHGB 3UBFA 1C5BL 4ATWA 1MRCH 4L1HA 1QSFB 4OQ1A 4Y16A 4X9GA 1IU1A 1YYMH 5CJBA 3BMWA 3S3DB 4R2GD 1HZHL 2ZX7A 2WTRA 3AUVA 3EFFA 5I1LA 4OGQC 3K6OA 4LPCA 2KMWA 4OB5H 5HVHB 2J4WH 4N3UA 3OAYK 3STZA 2P5WD 4N0FA 3CHXA 1NKOA 3AG3B 1VGEL 3IFOA 3MRIB 3T09A 2XJLA 4AKPA 4MAYC 3WMPA 4DUWA 5GPRA 1N26A 3NZ8A 4QDGA 5BQ7A 4TQHA 1PKQB 5KVEL 1XF1A 3PV6A 5HYJD 2R56L 3L4UA 1EZVY 4KPHL 1B2WH 5J5EA 4G80B 1A65A 1WZMA 2E4TA 3ILPB 4AKOA 2J25A 3WTSA 5ADOH 3CVIL 5HHOB 3ZTDC 3CDZB 2Y25A 3G5WA 3O3DA 4DFHA 5L6YH 4CAGA 3L16A 3ETBF 1AZZC 4B5EA 2IANE 1FO0L 4BFIA 2IH3B 5KS9A 4X5LA 3GYRA 4Y19B 4RFOL 5B21A 2FGWH 2LTQB 2LR4A 3IFPB 3R0MA 4DESA 2KUTA 3MTRA 1QATA 3UAAA 4G7VH 3C6LB 5PAZA 4BFJA 4F2MA 3QQXA 4X0KA 1ET5A 3T1WA 1TQBC 4QRSB 2R0ZH 4EZKA 1N7ML 3DC0A 4L3EA 4U1JB 4HJGA 2EDRA 4BKLA 2OW7A 1AIZA 2CJTA 4ODXA 1IGJA 2Z4TA 2X0VA 4HWNA 3OAWA 3U1QA 2CRMA 3V5KB 1PIGA 5F3HB 5ACZB 1MJUL 4M4RA 4PJ7B 4NN7C 1E2WA 3HFFA 4NJ9H 4XPHH 4NP4H 1PD6A 4HFWA 2H1PL 4FNLL 1ET7A 4G59C 2X89A 1TDQA 3QEHA 2R4SL 2Y06H 4P4KD 3VI4A 2JK5B 2FGWL 3DMMA 2G0KA 4GBXC 4U6TA 1KXVC 3P3UA 3TA4D 1O7VA 3L7FB 1W8EA 4GG6F 1BCIA 1RHHB 3H7BA 5D5ME 1KACB 3EFDL 3UZVB 1MW1A 1KGIA 1N3NB 3MCG1 2Y7LA 1A02N 3WTVA 3FUEA 4AQZA 3L1OL 2XG5A 1ZLSL 4OLVH 2CNZA 1T1XA 3LH8A 2V37A 2XZZA 3PHQB 5IFJA 2FGZA 2DQJL 3TEWA 1KB9K 5DRXB 5C3LD 4KQ4L 4OCSL 2RCSH 4L3EB 3D52A 1YYLH 3PGDB 3QSKB 3QDMD 5JORA 1CLOL 4HZLB 1ETZB 5E2WH 1BZDA 3MXWL 4LDOB 3WFHA 3IXTB 3P4LA 1X9RA 3P0VL 4BKTC 1A25A 5CJXA 1HZKA 1D5MA 1MH5B 1A3ZA 1H15B 3P9LA 4GI6A 4BFIB 3B6SA 3LYRA 4Y9BA 5DK2A 3HUJE 4LSQH 4LMQE 3D85B 5DC2A 1LP9A 2GT9A 5GS0C 2FBJL 3G6AA 5HDRA 2EC9T 4BH8B 4LVNC 4JPIB 1FGVL 2C4FT 4XC1L 4BDVA 3TTYA 2GBUA 4QJ3B 4HIQA 4HX1A 5GGRB 3MCLL 1XR9B 1UUNA 2AJSH 3KS0H 1J86A 1K5WA 5IVZA 2XKUA 5FFOA 1JHKH 5KJRH 1II4E 3FH8A 5CEZL 1BGXL 3IDIA 4OGYH 1EEZA 3D3VA 3ZE1F 4AYDC 5IJDC 4GQ9L 1BVZA 2JKIS 4P4KC 5E2UL 4PU2A 2QHRL 4G9FA 3NOIA 4CJ1A 4E9VA 3MR9A 3LNHA 4L1SA 1MI5E 5CD3B 2AEPH 3WNJA 1CWVA 2X1XR 5EO0A 2YXWA 3NH7H 3BISA 3NCCB 3EJZD 4Q0XH 1BVOA 4XE0A 3CVCA 5CKGA 5I16A 5B39G 1R3KB 1YPZB 3RYMA 3KLHD 1UZ8A 2GJJA 3NT0A 3NSFA 5IBLC 3C5XA 1YQVL 2GK0B 4G6KH 4FMVA 1I1AB 2IBGA 1LM8V 1JFHA 2AEPL 1MIEL 2XCMC 3MRQB 5E5MB 3GMLB 4H0IA 2ZPKL 1H3GA 4RESB 5D1XA 5KVEE 5F7HA 1ZWIA 2BP8A 5IJVA 3GJEA 4Z3GA 3ZE2F 4PR5B 2EKSB 4IOSD 1B4JH 2BY0A 3MV7B 3KM2A 3PGCB 4DJMA 1UADC 4F8LA 1PD1A 3ARBC 2E7CA 3D69B 4V33A 3NEXA 4QXVA 2Z35B 1A8ZA 3MUHL 4N9GB 1SHWA 3CCHA 2BNQB 4GAGL 2E74C 3KXFB 2WXOA 5DC4B 2CCLA 4LLQA 5LDSA 2MFNA 1JZDC 1F3DJ 5E94A 4ONOA 2B59A 2QQNH 4EO5A 4QRPE 4U3SA 1CDHA 4NO3B 4YXLH 2DAVA 5T1LA 1XF4A 2IG2H 2WM0A 5DJ2B 1P5VA 3WG7B 5CBAA 4FZEL 4WI7A 2EIDA 4PJ5D 4NZ8A 1GGIL 3DXAD 1WF5A 4MJIE 5KVGH 1NJ9B 4J27A 4IBSA 2YRPA 5E03A 1HXYB 1HQ4B 2BSBA 4HBCL 2J55A 3TXAA 1YEGL 2DQEH 3GRWH 1TQCC 1QABA 5L88H 3ZKXB 2JIXD 1ODAA 3CZSA 4G6FB 1TJHH 3O6ML 3T1FB 1KLUB 1OSYA 1FIGH 1KPVA 1WHOA 3BIAX 3C75A 4MRCA 4YVUA 3T2PA 1DEDA 1ERNA 1EIBA 4XZUB 4WWKB 2CR6A 4L0YA 4GAAA 2X4SA 5B1CA 1LL1A 2ZT9C 1NJ9A 4W9IC 3JWOH 1SEBB 2ARJQ 1D5IH 3MLYH 5DS1A 4IKJA 1YN7A 1DBBH 2V0AA 2G5BA 4JHAH 4M1GL 5IOPB 3QE5A 4QAWA 4TVUA 3V7AE 3PFUA 2BVUA 3KLHC 2AAVA 2C9SA 3MRQA 5E8PA 3RA7H 4S1QL 4PRDB 4NZTH 2VXQL 1DCEA 4XPTH 3V4VA 1UXMA 3H42L 2BVPB 2XWZA 1G7MA 5EA0H 4MAYA 4Q9QL 3AY4C 1GGUA 2G2NA 4ABWA 3TWCH 1KT2B 5C0AD 1MXGA 5IVNA 1OO2A 3R19A 4HK3N 3LXUX 4D0BA 1BWMA 1KY6A 2WN2A 2EKSA 5FO9B 1BM7A 1F6LL 1VADB 3FQUA 3H54A 3SDDB 3GSNA 2X1OA 4M8VA 4EOWH 2YSSA 5TPWL 2OTUA 2QVKA 5BS0A 2K6ZA 4AVHA 1YMHB 4C4KO 4LCCC 2H6OA 4Q97A 4UT7H 2HSIA 1JZGA 1AI1L 1MLBB 2NY6D 3QEGH 3UAJA 3SO3B 3P0YL 3L48A 2EE0A 4XNMA 1ORQB 4NRZA 1SOXA 3BPOC 5KSAA 3S48A 3S2AA 4MS6A 3VXQB 4JFDD 5GGRA 1E6JL 2VL5B 4GS7B 4HWZB 4IBWA 1FE8H 1B4RA 4HFUL 4V11A 4LL9A 1Z9NA 4FERA 2Q3XA 2OMXB 1NUFA 3N55A 1XHHA 3EYUL 3VXOB 1F1GA 4N5UA 1UG9A 3IAQA 1QI3A 3STLA 3QO1A 5LQBL 4UBDD 4YVNA 3ZDXE 4Y16D 5KVGL 1U3ZA 1N64L 1RIVH 3SBWC 3ZDZE 5JDSA 4G6JH 1AGFB 1MCOH 2VJ8A 2BHFA 5EOQL 3QJHA 1BAWA 3O6FC 1OAJA 2P5WA 3MZGB 3NAAL 4KO6A 1GGBH 2CO4A 4I89A 2H0PA 2VMEA 4J12A 4XP1L 1OTTC 1E9OA 2FHFA 2YAEA 4J4PC 4Y1TA 2WXGA 3QIWA 2C5DC 3D48R 2OMYA 3PJNA 4FQ2L 5ESQA 1D5MB 1SM3H 4Z6AT 3H3KA 3JWNG 2ZKWA 3KL5A 1ED3A 3DO7A 2FH8A 2DBLL 1A6ZB 3IPFA 1XGQA 3VFOB 2CD0A 2DYPB 2IPUK 1PF3A 2MRYA 3D4ZA 5JORB 2OJEA 5IHBA 4N22A 2LGNA 2OW6A 3RKDD 3TF7C 1R17A 4BA8A 4XVSL 1DBKH 4U1GB 5J6GA 3LIUA 4EKXA 2VSDA 4TPRL 1T2XA 4YHOH 5MP6L 2DL9A 2EIBA 5DHVA 2BS71 3QJZA 4WV1A 4UT7L 4CL7A 1A1MA 4LLVA 3WTYA 1AFVH 4ODXB 4FYTA 3ARFC 2AV7B 3QNXA 3X14A 3WLWD 1UKSA 1B3IA 2VLRD 4JG1H 2YEVB 3OKOA 1SOQA 4P2RA 2VLKE 2W9EL 4R7NA 3U0WH 4HH9B 4ODUB 1KCVH 4Y16C 1SMOA 4PGBB 4NT6A 4NZUL 4L8DA 5FCUH 3QG7H 1NC2B 1E42A 1AHWA 3MMEB 3O4LA 4ERSL 2X6BA 2OA9A 4UQ2B 3RIAF 4IMLB 1T83C 4MNQA 3HLAA 2HJFB 5DJXB 2DZEA 5D7EA 5DEGB 3WFEL 4HGMA 2VDPB 3U0WL 2PABA 1OTTD 4Y5XB 5C0DB 4N1HB 1MOEA 2IQ9H 2PP8A 1GHFH 3BVDB 4ELKB 3BEWB 3P4OA 4HISA 3VNZA 4OIBA 4Z78B 4N8CL 4HQQL 3S8GB 2CLZB 3UYOD 3OX8A 2IH1B 1DQTA 2ZYSA 1NC2D 4OZGB 3KYNB 3R4DA 3DBXB 1KXTB 2R2BA 1G9ML 5JHLL 4ODHH 4PRAB 3MO1B 2XBTA 3MLPA 4GG6B 4IRJC 2VDML 2X4UA 4DFIA 5L8LB 3C12A 4UYPA 1AJ7L 3N40P 5E0QA 1JN6A 4JM2A 4MTMA 4DH2A 5GRUH 2WWNA 1URLA 1SEQL 1KCWA 1AXSA 2X53A 4RH4A 3DIDA 3PF2A 2FWOB 1Y0LA 2ICEB 3DX1A 4M6OH 4FQQB 3D05A 5TDOB 3BRDA 5T3ZE 1S5HA 2IJ0C 3GEWB 3W39B 2YLHA 5DC0A 1BVNT 4MCYA 1DZBA 1E28B 3LVTA 4RBPH 1PVHA 1HYSC 2CRIA 5DUMH 2PP7A 1EXHA 3WLWC 4AVJA 4C58B 3BAIA 2OJZH 3NIDE 1IBGL 3N3EA 1W91A 2Q0ZX 3QWQB 2Y5TB 4P2AA 1AJ7H 2WMPB 4KXCA 3WD5L 2QSCL 2QADD 1ZHNB 4PWKA 5LO7A 4LSPH 4M5ZL 3WKML 2AI0H 4LSSH 1BG9A 1OWWA 3V6OA 3F62A 3FQTA 5B39B 4K7PL 3FS9A 4QGTA 3MLSL 2Y7QB 1FFPA 1MFCH 4PP2B 3ZBMA 4XPBH 1NWOA 1VPOL 2H2SC 5G4NA 1R5IB 1HSBB 1TMCB 5CCGE 3GINA 3ROOA 1I1YA 4C56D 1FDLL 3FNKA 3N91A 2EUXA 2RIKA 2NY2C 4V1DA 1U41A 3CC5A 2BZCA 3VTAA 4JZJB 4KI5E 4GUCA 4P3DB 3NMEA 3RWDB 4MQXD 4V1DB 4BFNA 5CN2A 3HR6A 1AH1A 4JX0A 5HDOA 1H19A 2LU5A 5DJYA 1P84K 4IIQC 4DP9X 3BZFB 5I2IB 2I25N 4NIKB 4M3HA 1CGSL 3ROLA 4IRJD 2J1KA 3D25A 2B77A 3LN4A 1MELA 4YJZL 2VZUA 3B3IA 4A63A 1QSEE 5BJTA 1XWVA 4PAZA 1XGRB 3IPBA 1TO4A 2JB5H 1RUQL 3QNFA 3O2DH 4HD5A 1H9VA 5E1AA 1HILB 1DL7H 3TN0C 1E0OB 1Y07A 4K3GA 3GMQB 4DKDC 4KJYB 3TIDB 3F64A 2VISB 3GSUA 3WJMA 5TH2A 5DUBA 5LHDA 5JW5B 3D9AH 3TBSA 2Z31C 2Q6WA 3NSXA 4G8GB 4HW6A 1ZGLP 4WI0A 2XWTB 1AC0A 1MJJA 3MJ7A 4PGEB 3UC0H 3FT3B 5IZ7A 5F8RC 1NCNA 3FHAA 4CBPA 4I5BB 1FYTB 4UAOC 1TOXA 3NCYP 3GMOB 5I1AB 5IVOA 1S7UB 5BUGA 2R0WL 5HHXL 3CHPA 2LFEA 4NBZB 3BKYL 4PWFA 4G7RB 4Q14A 1XTMA 4Y9EA 1RP9A 4FQJH 4ZPTB 1CFNB 4H40A 5I8KL 4GO9A 2YAHA 3AU1B 3X2QB 5LUMA 1V7NL 4AWJC 1G9NL 4XMUA 4IGBA 2H2SD 4UQ3A 1IILE 4HIEB 4JO1H 1JDAA 1YEFH 1XGPB 3LPWA 4Q2ZA 1NPJA 3FJTA 4JFYA 4IU3B 1EHNA 5LLIC 1SNRA 3I84A 3SYOA 2IOIA 1QW9A 1B0GB 4WCYH 3CUPB 4KY2A 1G9NH 4E68A 1T21A 4W9CC 4QLRA 1NCBL 1YA5A 2Z91B 4LLUB 4MMZA 1SLVA 3Q48A 4MVBC 5AVQB 2Y24A 3RY6C 4WI4A 4FQJL 3F3HA 4MS8C 3F7VB 1BVNP 4ZFFB 2VSKB 1OCCB 2Z1PA 5KTEL 2G75B 5JUEH 2IPUG 4XMKH 1BPLB 3VWJB 4Z5RA 5EZOL 4R7NB 1RERA 1NFDB 1E4JA 3RL1B 2L0DA 3H0TB 3CXHK 1IL1A 2WYHA 3VGAC 4K07A 2ATPA 4DUXA 3IETB 1G84A 3VU2A 2P8MB 3K5RA 3SODB 43C9A 2OMUB 5DZVA 1ZHBB 2HKFL 4LCCA 1KUMA 4HIHB 3APCA 3WN6A 2WQUA 2R51A 3CN3A 4OLWL 3INUL 3W81A 1GKOA 3WN5C 3Q2LA 2H0FA 1JDDA 4XNBA 3GSVB 2NNCA 4WO4A 5KSAC 5GGTA 2F74A 5ADOL 3LQAC 2EDTA 2WBXA 5JHDA 5F93C 5HI3C 3LJ3A 2ZX9A 1JV2B 1KJ2H 2EEBA 3ULUF 4EUPG 4N5EC 2VR5A 3V9FA 3IAPA 3EGSA 5KS9F 4WEBL 1VJSA 3IDNB 5CR8A 5E9AA 5C08D 3KR3L 3BVVA 2DLHA 3IN0A 1NOFA 3RIKA 1PJWA 2VM3A 3WIIL 4JHWL 5L9DL 1RUAL 4U1HA 1A4BA 3A3YB 2AXHA 5IIEB 2CUHA 4GW5A 3MNVB 4XVUD 5ACLA 4B9IA 1I8MB 4NT6B 4Q7DA 4JM0A 1KEGL 2XXGA 1S7VA 4MS8D 4Z7OB 3SJVB 4NJ9L 2OMZB 4XPHL 3GXTA 3NFPB 3BN9D 4KJQD 4U1SA 1NCBH 1KGJA 1AO7A 1Z3GL 3WIIH 3CFCH 5GJTL 4AZUA 1Z2KA 5I6OA 1F3RB 5BVPH 5K1NA 3OLDA 3VD5A 1JHKL 5IEKA 1TPXB 2R9HC 3KWWA 5AYUH 1MFAL 2YQ2A 2R59A 4LNRA 4WV1B 5KANI 1S7RA 4U1SB 1MNUL 3BXNA 3LH2L 2J8HA 5LXGL 3AABA 4JJOA 4MB5A 5KWYC 1QAWA 1ZTXH 1W0YT 4R8WL 2M26A 3FFDB 5IY5B 4PCYA 1QTPA 5G4MA 4U1NB 2BNRD 2I5YL 2OCCB 5LBSH 4F9LC 3RI5K 3KW7A 2MSPA 2DMGA 1AGEB 5HDQL 3P4MA 3MOAL 1ZLVH 4GRWB 4OF7A 4P9HL 2IMMA 2DV6A 3L5WB 3GGWA 2P7TB 4CKQA 5ESQB 3TH4T 3EW3B 5EUKB 1ODUA 4P3WA 1J8KA 4Z95L 2E86A 2C34A 4HWBA 3DIFB 5D1QA 4NP4L 2VDKL 4PG2A 4AEIL 4BKSC 2PR4H 4LL4A 2F5AL 5KSVA 35C8L 2ITFA 1GS7A 2ZTBA 3C2AL 1TJIL 1KIQA 4IDLA 1CXHA 2ZXAA 5FW8A 3DV4B 4HHAB 2OZ4L 4NQDB 2A9NL 3K71B 2VO5A 1CFQB 5KYUA 3MFGB 4ZSOB 1GMEA 2ZCZA 3KR3H 1T0MA 4XB3A 5E51A 5DMYA 5EG6C 1P7BA 4Z18A 2EDBA 3ARUA 4FMKA 4H44C 5DHEA 1DQKA 2QPFA 5I30H 1YHPA 3KD4A 2ODIA 2K7QA 1IL1B 2BH0A 3FQXA 4GKZB 3FUJA 1J1XH 4KJQC 3FCTA 4RGMC 3DURA 2QDVA 4LRIA 5D55A 3QHTC 3I6LD 1S9XA 4GXVL 1FSKC 3IDMB 3QA3B 2O6EA 4WHTB 3SZ6A 1MHHB 3QYNA 3DMMD 3NCMA 1OAQH 1JNHB 3JZYA 2FD6H 4X5WB 2JKLA 4YFDB 4Y4FA 4CKVX 3ENEA 4OM1L 2OQJB 1GYAA 1YO4A 4N8PA 1NGQL 3ISYA 2BNRE 3KYOA 1BQ5A 1RD6A 4A04A 1D3CA 2NXZB 1IFHL 2IBZX 1H3WM 3VXSE 1VF5C 4NO5A 1WTGT 5GGQL 3MRCA 5HY9B 1VADA 1CGYA 2GJPA 1MY5A 2IXQA 2FB4H 4YR6B 3JUYA 4XH2B 2CGRL 1I85A 1IGCL 2BVTA 4FQCL 3T3MF 1KN2L 1NAMB 1XH0A 3C6SB 1SOSA 1NBCA 2P8LB 3LKRB 5EIIA 1F97A 3ZZSA 3L9EA 3ULVE 3UEZA 5GGUA 2M1KA 4I9WD 4PH8A 2X2YA 1E8ZA 3B8SA 3B7UX 3P4NA 1BM3L 1XGYL 1OLLA 3CSBA 3MRPA 3QQNA 5C6PB 3L3DB 1H8OA 4F27A 2OSLB 2GSGB 5ISZB 3OXSA 2OXGA 3QQ9D 5GGUB 4R4BA 2X9YA 4K55A 3K6IA 1P1VA 4YXLL 3NN8A 4HJJH 4PLJC 3BAEL 1NKRA 4PGEA 4DTGH 4JFTA 2OX5A 3L3JA 4LLYA 3TURA 4FXKB 3LN5B 3LKSB 3CX5K 4NUQA 5D7LB 1HQ4A 1HXYA 1TU2B 2FJFB 3KS0J 2GI0A 1XO8A 3HN3A 4JM4L 4AEEA 4ZXBB 2J73A 1KYOK 2X4TB 3DMMC 4ZMZA 5HJBA 5DJ8B 2CBOA 1HL4A 4FTDA 5F88A 1B4JL 1HE7A 1SDDB 2J43A 2MQCA 3AGVA 4Y4FB 3ZQ9A 3IU3A 1A66A 1T4KB 5HPMB 2GW5A 4JDTL 2A73A 4JY4A 4NQXA 2JI3A 3FXIC 1A6PA 1BLNA 4P2OD 2GEQA 3I02B 1E5ZA 1L6XA 4JRXB 5HJ3A 4F7CA 2J1WA 4XN1A 3U82B 2ZXWB 5B3JE 5DRWB 5EN2A 2FJSA 2H2PD 1WAEA 1E3XA 2VERA 3NCJL 3B9KA 4LXFA 4QOKB 2W60A 3ABZA 2JCCA 3HHSA 2V7HB 5IQ7L 5D96C 4KWUA 1CFQA 5ISZD 2C7UB 5A2BA 3K71A 4OLXL 1CIDA 3KJ4C 1CDCA 4U7KA 4YO0A 4DN3L 4F9PC 1UATA 3KYMB 1L4IA 4U6VH 1O9ZA 3ABGA 3QR0A 4HPOH 4ES9A 2F8OA 1HL9A 3L5JA 1WA2X 3QORC 5CEXA 1MI5A 5ANME 1LD9B 3CVHA 3CFDA 1JXKA 1JWUA 4JPSA 4HPHA 1FL6A 4G9FB 1I1AD 2QVIA 1DP0A 3MLYL 2VLKB 1GZPA 2G4GA 4YQXL 3UBXG 3ARBB 2OL3B 2ZG3A 3OJDB 3L54A 1JZ8A 2ZWYA 4FHKA 3NA9L 2DTMH 5BV7C 3O9WA 2BY3A 3T0EC 2GAZA 1P4BH 1I3VA 5K9KB 2BCKA 4ZFGH 1E4WH 1MFEH 1NMBL 4Y4HA 4AW4A 1CG9A 5J1SC 2NY5C 5HD8D 3DARA 1V27A 1NFKA 3LCYA 3QNYA 4AG4L 3ARDB 1SVCP 1SUHA 3QI9C 1AKPA 1RULH 3HZMB 4G9FD 4ODBD 2GY5A 2P52A 5HHVH 4Y5VB 3GK8H 1DLHA 2PKDA 4QXTA 4YBQD 4AIZB 2CDFB 4Y4HD 2KT6A 1GGYA 2CLZA 2R1WB 5FOBB 2AABL 5J1TC 5I1KH 4HUXB 2CMRL 4D0DA 3JQOB 4MDIB 3ULVH 3SE4C 3TA3D 4QKTA 4IS6B 1S7VB 3WTUA 4K8RL 3RQ3A 1X5IA 2H2PC 4ADGA 1PZ5A 2XV6B 2F19L 3FUKA 3QEQB 3QULB 1ES0B 2XN0A 4PJAF 4QJ4B 5FUCE 3SKJH 4JUTA 2F54A 3ISRA 3SBPA 1SJXA 4ETYA 4X4YB 4KC3B 4TVSa 5E8EB 3SDCA 4ELMF 1R5VB 5F96H 3BZ4B 4ZODA 4KOCA 4X2UA 4JQIH 3IDNA 4KRPD 4E2OA 3QORD 5D7JA 1DBKL 4P46B 5T3XD 4JO2H 2V7NA 3PRZA 1IGML 1LO4L 5DFVC 1MY7A 5GSVB 1ROWA 4YSEA 4P2RB 3A4AA 3OL2A 5EO1A 1INEH 5JLZB 2DDQL 1IV8A 3L5XL 3KCPB 4HS3B 5CBEA 2ITDB 4TNWF 2AV7A 4TRPH 2Z93B 4OFDA 5E4EB 3VFUA 4IBLT 4JKNA 5FHBL 4MA7H 2NLJB 4JQIL 5FYLE 4AEFA 2NNAB 4L5FH 3VB8A 4IMKA 3CIAA 4QOKE 4CDGC 3HZVB 5DDHB 3O11A 3OKMB 1OP3H 1Q0YH 2XWJB 1UZGA 3FFCB 5CIPA 1IGIH 2PYED 5AAWC 3RWEA 3T0ED 3QG7L 1FFNA 4HIHA 4M43L 3O6LH 4LCWB 3UAJC 4LCCB 2OXHB 4F7TB 3QIUB 2OMUA 3OBAA 3WY3A 4MXVF 4HAKA 5EDSA 3PREA 4FLRA 2BVYA 5C8JB 2K9FB 3NFNA 3BPOB 3NIGF 2RACA 4MD5A 4UYQA 4WUKH 4MNHB 2BSTB 2HT2D 4ZRGA 3VGGA 1WFOA 1IGIL 2DQCL 4U31A 4PY7A 5IOKA 3VQMA 1JTOA 2LU3A 2R29L 1AS6A 2VWEE 4DOHB 4GO8A 1JV5B 3FN0L 1M71B 5CJOH 3OV6A 2OTWA 4BINA 4NKMA 1PKQE 4R84A 4MJJA 5HYFA 1L0XA 4JG0L 4JCMA 3KPRD 4KXAA 4HQQH 4GEIA 4OD2B 3VACA 3M8OH 1J5HA 4ZUVB 2ODHA 3RBSA 2XN1A 1BD2E 1QSEB 1T21B 3EBGA 5JIDA 3U9PH 4PJ9B 3X12B 3VVVA 3VH8A 4G70B 1F4YH 4XT1C 4LHUD 4E9RA 5DZPA 4HKXA 4L8CB 2NTFA 4X8XA 1X5LA 4OI9A 4N0FB 3BFQG 1FFQA 3MBEB 1YEEL 4WTXA 1Q9WB 1UC6A 3FMGH 4RISH 1IBBA 3ABMB 4F37F 5LAXA 4XNQA 3VCLA 1QLRA 3P77A 3D4CA 3MKGA 5I6NA 1FI8C 1I8KB 2X44D 1XIWA 5D1QC 4MBOA 3CH8A 4ONGH 5FO7A 4L9LB 1NANH 4XMWA 4FD0A 1HHGA 3EBAA 5I0ZA 2J8OA 1K2DA 2YD0A 2VL5A 2Z6FA 4MBRA 3AS3A 3TGXA 5GZNC 4IBTA 2NXYC 5K33A 2XN2A 4M9OA 3V0HA 4QHKJ 1U8MA 3WO4B 4NM8L 4K94H 4UT6A 3OKLA 1UA3A 3WFDL 1VB9A 2ZP0T 4FXGC 4LCWA 1F4YL 4X83A 5EPMA 2D03H 2OI9C 3R7QA 4FE9A 1HX0A 4JFQB 2FIKA 5KSUA 1FO0A 1R3LA 2WQRA 3BKYH 2R83A 1EEUA 3E6HB 9CGTA 2UYLB 3IEAA 5BXFA 2APTA 2VDMH 2V2WB 1X44A 1BFOA 1I9JH 2ESVE 1INQB 1CICB 1CJYA 1LO2H 2J72A 1KPUA 4F5CE 1NIAA 5E1AB 1U3YA 1VKXA 1QSED 1RURL 3V4VB 3ULUE 2I9TB 4OTXH 3VA6A 4G8AC 2NUTB 3BYYA 4RA3A 2W81C 2YD1A 3NFSH 3P3RA 3ZTEA 3GZOA 2I7OA 4ZMXA 6TAAA 4HS6B 1WWCA 3QDAA 1O5DT 1N10A 3QDJA 3LZQA 5CJ8A 1RZ7H 3K0YA 3IVKA 3RWDA 3BRFA 1N59A 4XAKD 1ZS8B 2UZIH 2XWDA 3FQWB 4QHLA 4Y9FA 2A6DB 1CDYA 4K3JL 4HUMB 1DE4A 1KGWA 2MOGA 4R7LA 2W91A 4HCRL 4B0MM 2A5UA 2PCFA 1T7WA 2ALAA 1G1KA 4ZTEA 3D4YA 1ZVNA 3Q13A 3ARGC 2HLEB 1I9RH 3H9SE 5DYOB 1E8XA 5F9JA 3IFLH 4R97C 4XPGH 2NZ1A 3FB5B 4BQBA 3TOPA 1SOKA 1OAKL 1E5BA 2KHAA 3ALWA 3BUBA 2OV0A 3LS4L 1HH9B 2OMNA 4AH2B 3CHRA 4S0SD 2VXVH 4MQXC 3P2TA 1K8DB 2CBQA 4TMPA 5IB5A 1T5XB 3CXDL 2UZXB 1TLMA 4JDZB 2YAQA 5T3XH 3UTTB 1ZDSA 3L3IA 3MAWA 1T89C 3DTDA 3ZR5A 4ETQA 3UTSB 3SE3C 4KQ0A 4L4TE 2CDEA 4RNRA 3RWJA 3KPSD 2C3WA 3V10A 5AW3B 1M7IB 4ZMWA 1OGAD 3BUIA 1P6AB 3ELAT 1DUYB 4XMZA 3T6VA 2P80A 1DFXA 1PLCA 2H9GB 4PS4H 3L3KA 1V05A 1MCRA 1E5CA 1UXLA 1CO1A 4YUEL 4AXWB 1KN4L 4KQ3L 3FT2A 4G9DA 3ZLQC 4OV5A 2PWHA 4H20L 3K6SB 1SBSL 3MV7D 4G1EB 4NQVA 3KYMA 3INOA 1OAUH 4XHQA 3UP1A 5GSRB 4BCYA 3CLFL 4PFEA 1WGOA 5JW4R 4TF4A 4X6CB 1XEUA 2C7UA 4PJCB 3OX8B 2QQKL 1YEDA 3OKEA 3WV0A 4K3DL 3HNTL 5C0BD 3TBVB 4PJEA 5TJWK 3V95A 5ID1B 2J8UB 3GD1C 4B3VA 2QT6A 3ZKMD 1U2CA 3K91A 3PQYB 4OGAD 1B2YA 1H3VA 3CPLB 3VXRB 3BDYL 2DY2A 4EXKA 3X11A 3D30A 2WXIA 2OL3H 3NJIA 5FLUA 4AVKA 5DJXA 2N1KA 1D7BA 3CZFA 2O5ZL 3PL6B 5AOJA 4D8OA 4R7XA 5BRZE 3ZY7A 1O9VA 5I1EL 5KSBA 3RUGA 3ZHDA 5I28A 3OWEA 5IMLA 4X6DA 3MMEA 5H35B 5D7SL 5HDBF 3EHBB 3BPLB 2PW1B 4PGBA 3RB5A 5C0JA 5JIIA 1QRNE 3LEYH 1QA9B 2GT9B 1S7RB 3QQ3B 1ZLVK 1ZHKA 3OQ3B 2AJVH 1YNTA 3B6SB 5DQ9A 5PCYA 4BE6A 4DGVL 2BPBA 4FEMA 1BV8A 3AROA 3NK3A 1LMKA 5CN3A 3CFEA 2I7SA 3L1EA 4PI0A 4PJ7F 5IK3B 2IALA 5INCA 4PJIB 1FP5A 4PS7A 4IOFC 1ILUA 4JMXA 4PJ5E 4RVBA 4F1ZA 3MCKB 4U3CA 3TNNB 5JQ6L 3UG4A 3HC3H 4OLZL 5E6YA 4B27A 1GIGL 4LIQE 3FQRB 4FQXB 1YNKL 3JVGC 4MZIA 1USQA 1DANU 3PWNB 1NZRA 1ZT7A 2G2RB 4FLHA 4QRRB 1H5BB 3DVGB 3PJSB 5JR1H 4D94A 1CI5A 1P7KA 4Z0XA 3QJFB 1RZKC 2HKHL 5KG9A 1HHJB 3SPVB 3QWOA 3W38A 1M9SA 4HCFA 4YHIA 1NC4A 2Y6SD 4Y1SA 4HAGA 2ZICA 5EF0A 4LCVA 3EJZC 5J8OA 4DP1X 1HINH 3CLFH 1YYLL 4OU3A 3AZUA 3NQIA 3L3HA 4R0LC 1NCDL 5AEAA 4NZJA 5JR1L 1HYRC 3KPMB 3SKNB 4XVTL 5IROD 4K2UH 5HI3D 3MJ9H 3RIAK 1ITBB 3MRKB 4GNKB 3A6OA 2XTJB 4DO4A 1JRHI 2JJTC 4KV5E 3WJJA 1AP2B 5FA3A 2F1EA 4Z7VA 3FU0A 3QUMB 3MRCB 2FRGP 4QRUA 1A7RH 1IAIM 3QUZC 3TO4A 1NMAL 3H9SA 2XVBA 4PJGE 2PXYB 3ME0B 1IAII 4LPTA 1PD0A 3ALXA 3SPCA 4IBYA 2H32A 4HDIB 5LGHL 2VE6B 4AQEB 1OL0A 5LN4A 2QQLH 3F7KA 4PJFB 1ZEAH 2FO4B 2PR4L 2VSCA 4AZ8A 2NCMA 3CJJA 3MUJA 3W5NA 1MFVA 3ZU8A 1FRGH 2NX5D 4FLQA 5I1HH 1C12B 5I8CA