2LGNA

Lactococcin 972
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and properties of lactococcin 972 from Lactococcus lactis
rcsb
molecule tags Antimicrobial protein
molecule keywords Lactococcin 972
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09683 Lactococcin_972 Bacteriocin (Lactococcin_972)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lgnA00
2LGNA
chains in the Genus database with same CATH superfamily
5IGXL 4HUCA 3OKEB 1UTDA 3CX5K 5LUMA 2VM4A 2ZP8A 4H26B 3S98A 5LLIC 2ID5A 2H2PC 2R0LL 1HCYA 4HEPG 5F3HB 5HGAA 3WD5H 4BSVA 4QKTA 5CGYD 1C12A 3KGRA 5IWLA 1RIVL 4HPYH 1TJIH 4L1SA 3FT3A 4L23A 1FFRA 1NMBH 1G4RA 4WUUA 1NCCL 1LK2B 1WF5A 1ITBB 2OX5A 2JCCE 3LRSA 1QLFB 4I9WD 3ZDYE 2W9DL 2NXZC 1FC1A 1FG9C 5F89A 3MLVL 4A2FA 2EDMA 1NCAH 1P5UC 1QEXA 2VQUA 5D9SA 2DQCH 5D1ZB 3WIIH 5HVHC 1WZ1L 4KKNA 4XO4A 3NA9H 3L4YA 1KFGA 1Q9KA 1IUZA 2WBKA 3GSNA 3HCVA 3IJHB 4GSUA 4HUWB 5D6CB 4RAUA 5KANG 3TH3T 4DEPC 1UXMA 3ARXA 4WI5A 4Q6IA 2ZUWA 3R19A 4GW5B 2EXTA 2N0KA 4MTMA 1KCLA 2G5RA 3SPJA 3V0IA 2V17L 3II3A 2D0FA 3C5SB 5EO9A 3HC3H 5DVLA 3L7EA 3CC5B 4KTEH 3T0EB 1PZAA 3S0PA 1IGJB 2BINA 1I9RH 2IALA 5L6YH 3TZVC 1CDJA 1YDPB 3ECVA 4PJXE 3VGEA 1A4JB 4HEME 5GGSY 3MNWB 3X12A 3QCVL 4L4VE 2Y1AA 4DGVL 4GO8A 1U3ZA 4W9HC 4JG1L 3JV0A 2O6DA 6PCYA 4X4ZA 3L9EA 2VR4A 3QUYB 3MRMB 3UYPA 5FC9A 1Z3GL 4PVBA 4X6CE 3VWJB 5D2NC 1AQDA 3ZL2A 4POYA 3CVBA 1AO7B 3ASOB 3HVNA 5EZLA 3FFCD 3BP5B 1UC6A 2XX1A 3NOIA 5AOZA 2HLFC 4D9LL 3V79C 3ATEA 4ZNEE 3ZE1E 1YUHB 1U91B 1CR9L 1H8NA 3ARBB 3UTPD 3OR6B 1OOAA 3QG7H 5CUSH 1FFTB 3RL2A 2KLRA 1QRND 1QRNA 3EJPA 3HAEH 3IJSA 4EBQH 5C0CD 4LCCC 2XWJA 2W80C 3RDTC 1Y7VA 1SXBA 4V33A 1M7IB 4YDMA 2VDOB 4FF9A 1IVTA 3PJLA 4FFZH 2Q10A 3KEHA 2NT1A 3G04A 4ZUUA 1S7TB 4JO3L 4AQEB 5J9PB 2E7CA 1BQKA 1TKWB 2ENJA 3MRMA 4IOFD 3TO4C 3UYPB 1DDHB 4IRZL 1EFQA 2VUOA 1TQCB 4YDZA 3RVUD 2BIPA 4OLYH 1CWVA 1IZJA 3FT0A 5BRZE 4LVEA 4U05A 4MMZB 4AYGA 2XWRA 3TX4A 5ACZA 1ASPA 1OGAE 4KGLA 4OZFH 4Y9BA 4AV4A 2XFXA 5DD3L 2GSGA 3EBIA 4WY7H 4AIEA 1URIA 1NMAL 1ET7A 3MGTA 5AYUH 2KERA 5EB9A 5CGYC 2GJ6E 5GRYA 5DS8A 5FM5O 4H20L 4IDJL 4HKZA 1FVCA 4EDXB 2XC8A 2DQDL 3CDGA 1MG3C 2XZAH 3QAZB 3SE3A 3DIFB 4W81A 1OEZW 1WIOA 2BVPA 4A2HA 1KENH 5E4AA 1BD2D 4H2AA 2DBJA 5D1QB 4UILL 5SWZE 3PAYA 5ENWB 5IW1A 4WWKC 3OAYK 4FZ8H 4YR6B 5FUZL 1N8ZB 2YXMA 3EBHA 4AYMC 1MXDA 3MNVB 4BZ1A 3I02A 3FMGL 5FHBH 5K1JA 1PPIA 2HG0A 1ZD6A 3TN0A 4KOBA 4CSTA 4OLZL 4OSUL 2FX8H 4ZDHB 1A1OB 3OLGA 1N3NA 2NY0B 1FGNL 3O9WB 2VLKD 1NAMA 4AW7A 2MNUA 1JZHA 4Q7DA 5CGTA 1YEJL 5C0BD 1QLFA 2HT3C 4WUKL 5HHNA 2ITEA 3QJZA 4YFLF 4Z78B 2X44D 1N2RB 1R6VA 1WWWX 4Y4FD 1HH9B 4O2CB 2KC0A 1AYOA 4LIQH 1U2YA 3GO1L 3TIEA 1DSFH 4HIEA 3SZKC 4GQ9H 3EH4B 2BJMH 1ASQA 1W0VA 1WCBB 2A4CA 3MX0B 5H37G 5GIRB 2HX7A 5IR1B 4CVWA 1T3FA 1D5ZA 1P7QA 4YN3A 1U2CA 3ZZQA 2A1WL 2VH5L 1U8NA 2BDNL 2ICCA 1XMEB 1KIPB 4K5PA 5EC2B 2ARJQ 2PUQT 5IVXB 2IBZX 4M56A 1IC7L 2D3VA 1MFNA 4QTHB 4LDOB 5I8EB 1BD2E 1K8DB 3GSXB 1OAXH 1OP3H 2YRZA 1F5WA 4TRPL 3VFNA 1MUJA 1RZQA 4F33A 3ZHNA 3AWFA 3AWEA 1PIGA 3F7VB 3WHE1 4MXQD 3B2PA 3FRUB 1A25A 4NC1C 1IEHA 1MIML 5D1QC 2R4SH 4RGMB 4D7PA 2EUWA 2X1OA 2O61A 1XB8A 1CTOA 3UTZB 3JWDC 3RWGB 2AQSA 2BNRD 2O6CA 3ESMA 3L5WB 5DU7A 1N7ML 2P9RA 5FO2A 5BZWA 3FO1B 4Z7IA 1XB3A 4TVPL 5DVPA 3L5JA 3HPLA 2YGOA 4O5LL 1T2XA 2DMKA 3QWOB 1FO0B 3MLTB 1CGWA 2UZXA 4QHUA 4MB5A 3VI3E 4X4YB 4JRFA 1QTPA 2GAZA 3RIAK 1ZHKB 4BKLA 2Y7MA 5I73B 3DJ9A 2CIIB 3GB7B 3OR6A 4E41D 3TO2A 4DK3A 1A3QA 4X4XB 4UTAL 3SJVE 4MX7B 3ECBA 3GIZL 1MRDH 1JV2A 4UT7H 2UXFA 1A7NL 1O6SB 5J13C 5E4IA 5JOFB 5AW4B 25C8L 3D85A 1XF1A 4X99B 1P84K 5A7EA 3TIDB 4GBXB 1KG0A 3K5RA 4K8RD 3BO8B 5IW6B 3I6GA 1BFVH 1KT2B 3NA4A 3ZE2F 1DBKL 4NX0A 4H88H 2AJYH 3H2QA 5A2LH 4PPTA 3TJEL 2GTWB 3UTQB 1G0XA 4FABL 2FWOB 4TL4A 2BRQA 2WMPA 1NJ9A 4G80A 2F53B 3MNZB 4PBXA 3A23A 3NRPA 2AJSL 5AZEL 2YHGA 3O3EA 1IEAB 3UJTH 4GI8A 5KYWA 4FQQA 1A6WH 3QULA 2BVUA 2R1WA 3BDBA 1H5BA 2X9YA 3DV6B 4P3CH 3CZUB 4R90H 5GS0D 3ARPA 4NQUA 4OZFB 3KVQA 5CSBA 3HG2A 4PG9A 5IK3A 2VLLB 5F1OB 3FH5A 1JHTB 3KH4A 4H5SB 1BP3B 5D1ZA 3BW9B 3IDYB 1B4JL 3HUJE 2GSIB 4D9RD 2J5LC 4DKAA 1HHIA 3QRFM 3ASWA 4JQIA 3BPOB 4OBRA 2HT4C 3HN8A 4K7PX 3LRSB 4I89A 4X7FC 4Y2DC 3G5XB 4J6RH 2QZQA 3ELQA 3LCYA 1IKOP 5IT2L 2EDXA 3QUKA 1YJDC 4XC3H 3SDXB 2BIIA 1DDTA 2F7QA 5HGBA 4LP4A 3GM0A 1BQSA 2FZ3B 3M1OA 3ZUNC 4RFEB 1DBAL 2B08A 1GR7A 2WJ5A 4YE4L 5DC9B 1NDGB 2QHRH 4LSTL 2H3NA 4Z9KB 2FR4A 4IBSA 4R97C 2XT1B 1FFOA 5HGAB 3N43B 2FD6L 4XCFL 2FYVA 2HH0H 5CJ5A 4DUXA 2B0SH 2ZG3A 5I1EH 3IS1X 3K91A 1RI8A 1CGYA 2J7LA 3VD0A 4BZ1L 3K6SA 2DBLH 5GRUL 1NM9A 2CR0A 2XTSA 3MLRH 3LMJL 3H9ZA 1Z9SB 3UTOA 4B41A 3G5WA 3NUKA 1XGQA 2WIIB 3TXAA 2VDRH 1UM6L 4JHAH 3G5VB 2IANB 2VAJA 4ISVA 4CBPA 3EBAA 4NRYB 4OCWH 4OH2A 5MEND 2EDTA 4ZAKB 5FUCE 2NDFA 1QEWB 3TO4B 4ELMF 2HXAA 2EDKA 3CDYA 2DQMA 3V6FB 5ILTL 1KJ2L 1ZV2A 3IJ9A 4P06A 5EU6B 1OM3H 4AH2B 1IMHC 1AACA 1LO5A 1XV8A 4FTVB 4N26A 3WJMB 4MA8L 3KW8A 4ONGH 3DURB 3EDFA 1P6AB 4GAYA 3VFWA 5CEZD 1RZIA 3KW7A 4NT6A 3TA3C 2C9VA 1BCIA 4F8OA 1W8NA 5KANI 4P2QE 4ZK8A 2X0WA 4A2MA 5DD0L 4JREB 5JORA 1E8ZA 2P5WE 3EH3B 3V10A 4CVZB 5GGUB 3D85B 2OX5B 1OIOA 7TAAA 2OK0H 1VGKA 5D7IE 4Q6YA 4M4RB 2OULB 5D72H 5A2IH 4TNWK 3WS6A 3AUWB 3BT2L 4M1GH 4YGAB 4Q9QH 4JKPL 3RWEB 1TMCB 4TSAH 3UCRA 3VDBA 2QADB 4P59L 4L3ED 1QRKA 1E6JH 4OI9A 1TYRA 4ZS7L 5LAXA 4JM4L 5I71B 2EUZA 1A6VL 2BM3A 2ZX8A 3GI9L 3K81A 4W9JC 3EJQA 4JFDE 3MRIB 4HXAL 3KXFA 1MQKH 4DEWA 5KW9L 2CDFB 1U8KA 1XSOA 2JV6A 1EHKB 2AW2A 1JNNH 1P0SE 2FBOJ 4U2ZA 1CFMA 1SF5A 5B39B 1YY9C 4RA3A 4A7QA 3LNGA 5GQBA 2H1LM 1ZK5A 3FH7A 4IS6B 2IV9A 1DQJA 3HFFA 4GS7B 1DHKA 2B0SL 4KQ4H 2AJZA 4KH2A 1FZOA 5I18H 5GS0C 2ICEC 3TYGH 3GBEA 3UAJC 2G2RA 5IB5B 4LLWB 3FRPB 2AEOA 3CWGA 5L8LB 1WA0X 4HUXA 4A6YH 4Q9CA 4N2LA 5CEZE 4M8RA 4S1SL 4PWJA 3L9RA 3HNTL 3V7AG 1D6EB 2IPTH 4RBPK 3K6NA 1TO4A 3LH9A 3GJFH 1V10A 5CZVH 4K55A 5F21B 5FYKL 3HHSB 1XF5B 1SUJA 2DAVA 2F7OA 1MCJA 2XYBA 5CHNA 3V6OA 2QQNH 1JZJA 3NCBB 4NQDB 3RDTA 3FQRB 3VFVB 4PYGA 1OO2A 4YZFF 1BOGB 2VDMB 5C0AE 3PCYA 5B1KA 4JLRB 1HNFA 1OSPH 4G7QB 1KEGL 1HDMB 4KDTC 4X4KA 2G5BB 3NSDA 4KJWC 2PXYB 3HNTH 4YXHL 1FZKA 4W6WB 1THCA 1F4WH 2DEWX 3P11L 3IDIA 3ZRCC 2DBLL 4TYUA 3Q7JA 1JG9A 4ZFGH 3DARA 3VXRE 3NZUA 1I9JH 3SE6A 2C26A 4XO3A 2OMZB 4LSRH 4XN2A 1ML0A 4A04A 1HKLL 4UTAH 4HISA 3IFLL 4NKOA 1MRFH 2JELH 1A65A 1BIIB 2J6EA 2G2PA 5K9KA 2WTOA 5K9QG 4FG6D 3MYJB 2HVJB 5LXVA 4WJ5A 3EJZD 4P2RD 3QSKB 1IE4A 4U1MA 2Y7SA 3CQQA 4PJ8A 4KO7A 1RKRA 1Z5YD 2ZJSH 4I3SH 4YHZL 1NWOA 4BHUI 2W38A 4LVHC 3LH2H 1R75A 1TZIA 3KL3A 5CEYA 2CUAA 3H1ZA 3PAUA 3DO4A 5K69A 3PL6A 4I0CC 4FG4A 4Y5VA 4Q8BA 4NBYB 2VN7A 4G8FA 2J88L 1EWHA 4NENB 5LQBH 1QFWM 3KGTA 1F6FB 3BKCL 3VXRB 2A6DA 2Y9RT 5ACZB 5BOJA 3QYNA 3PJNA 1GZPB 2WBJB 1E4HA 1ZHNA 2MCG1 5JHDA 4E9VA 2DJUA 1CFVH 2FJHB 5DEJA 2BP8B 2WZAA 1YEDA 2QKIB 4P99A 5D96C 4B3EA 1KPVB 2BIOA 5SX5H 1J0ZA 3HMWH 2X9XA 3W9DA 4GO6B 5BXFB 3IWUA 4UINL 3W2DL 8FABB 3TWCH 4LSPH 2G4EA 2ITFA 1I31A 4JKNA 3LNEA 3VFNB 1AXIB 1RJZB 1MEXH 1S7SB 3PWVA 2HPTA 2NYYC 3BGMB 4P2RA 4R96B 3ZL4L 4UM9D 1R33A 4J3OF 1O9VA 4ODVH 3HE7D 1EA9C 2Y1YA 4IKKA 3TJEH 1XMWA 3MLRL 5IJCC 3G6JE 4Y2OB 2A6IA 3F12A 1TFPA 1V7NL 1ZGLM 2JJVA 5AAMC 4JN1L 2X09A 2BCMA 3VTTA 1ROWA 3U79A 1MQ8A 5CXPA 2PWHA 1I7TA 4L1HA 1AXTL 3QNZA 4MNQA 5EBMA 32C2B 3GZPA 4G9FA 1SDDA 5I76A 4ZMWA 4OLXH 4DPCX 1G7JA 4OAWA 5F9WC 3GTTA 4LPCA 4WSGA 1HXKA 1VKXB 3FQTB 3VDAA 4HA1A 4OM1H 3NH7L 4DT2A 2KKQA 1F2QA 1A4BA 1U8HA 4LT7A 3FQXA 4H8QA 3TN0B 1FYTE 3GHBL 4GUOA 2QPDB 1KXTB 2WLLA 5M95B 2N01B 3QORA 3D8MA 4P9HL 5HYEA 1VFMA 1NBVL 2OSLB 2NY7H 4OF7A 2NY5H 4Y1SA 3RNQA 4IOIB 4PD4J 5IVXF 1MHCB 5IP4A 4L1DA 3ZKNC 4F7MA 3PWJA 1A1MB 2DI9A 4V2BA 5BUPA 1UB6A 3WTTA 1P4UA 1ZPUA 3GNML 4K3JL 4HDIB 2XRAL 1MAKA 3GXPA 1FH5L 2VB5A 5F88B 1OW0C 5FYJL 2CDGB 1M05B 3Q44A 3BQUA 1P4LB 5C0CA 1DZ0A 3H42L 4KUCD 1NTDA 4MS6A 3X3FL 2J4WH 4JO3H 1UZ6F 3O8XA 4HJIA 3VFSB 2FEJA 4J3XA 5D71L 1MCBA 2BS8A 3KDMA 4P9ML 4FABH 4MLSA 1E8XA 3FSVA 2A9ML 1F4YH 2EVGA 3OAYH 1CD1A 5K93A 4AC4A 2ZXBA 1IM3A 2VLRE 4KO6A 4DF9A 5JOPE 1QHOA 5F71A 3NPSB 4R26H 5DUPL 4YHNB 3AG3B 4HBCH 3TVMB 3UJTL 25C8H 1RK7A 1QNZH 4K15A 4L37B 3TBSA 2WOYA 1S6NA 4I5BA 3HRZA 4M6NL 5ITFB 1BG1A 1MLCB 1XSKA 2NY3B 3NTCH 1XH1A 2BLFA 2YOAA 3C87A 3QDGB 2EUVA 2UYLA 1CYWA 3ABKB 3K4DA 3PREA 2ADIB 2VLLA 1F4YL 2JQMA 1ZDSA 2J43A 3E8UH 2W65B 2ERJB 5CCGE 4JRYB 5HHMB 3UXFA 1WK0A 1YPZA 3B2UD 4NN5B 1HZLA 4GKNA 1HHJB 1WCQA 3MJ8B 3IDMA 5BQDA 1UT1A 4K94H 3NAAL 3QS3A 4Y16B 3NIDB 2ZUTA 4Q58C 3B9VA 2BP8A 3VQ1C 2F7IA 3EHBB 4EI6A 1KTCA 2CHNA 1FGNH 4WHCA 2C7FA 4CGTA 3L1EA 1XL4A 2CK0H 1I1FA 1WS8A 4U4BA 4ZQKB 4AV5A 1CLOH 4DN3L 3KD4A 4MA3A 4WTZA 3D34A 4TTDC 3INOA 4Z7VF 1KXHA 1LP9B 4YK4B 3DPDA 1CMOA 5HYJE 5C6PB 4A38A 4QRRE 4MQTB 1PY0A 3BSZL 1W6WA 1CU4H 4JFQB 1E42A 3HZVB 4ODTH 4P5KB 4WUUE 5IKCB 2J8UF 5LWYH 4Q4EA 2CGRH 1VDGA 3MUGB 1FFOB 4KK8C 2BDNH 1N4XH 1AQHA 2PP9A 3MACL 4R7XA 2O5XH 3HRPA 4HWEL 4TM9A 4TQ8A 5I9QB 4IEFA 1YEGH 5TFSH 3KLQA 1KIUA 4S2SA 1ZLEA 4MZ3A 4P5RA 5EIQA 2K6WA 1QWNA 2Z8VC 1KXTA 5J6HB 1KIRA 3O9WC 4PJHF 1YQVL 3EDJA 4XI5C 4BH7A 5JXAH 1MY5A 3CZFA 4RMBA 5DUPH 3F7PC 3GSUA 4GY4A 4NPJA 3SQOL 3ZDZB 4H0HB 1UJ3A 3K6FA 2NX5B 3HUJF 3UTTD 2XCMC 4Z7UB 4D9QE 1Y0LB 2XQYA 2DB8A 1UD2A 2F9BT 2IDFA 2DWEB 4UQIM 5JHBA 5ABAA 5HDBF 1JE6A 4QXTB 3GSWA 1HDMA 3CC1A 1OSPL 2C9XA 5EC1B 3EDKA 3H4HA 1KBBA 1LHZA 3N1FC 4GUQA 3X3FH 5ALCL 4AITA 1AI1L 3L5WA 5JZ7D 1K4DA 5CILL 4F33B 3KLHD 2C3VA 3PP4H 4K8RC 4AGNA 4PJFA 3KLDA 5E94B 1DQKA 4JFDB 5E00A 1IM9B 1H3GA 1M56B 5G55A 3VGAB 4YQXL 3U4EB 2OYLA 1UFGA 3ISYA 4C55A 5ICZB 3QWRA 4I0PC 5IB2A 4LCWE 1F45A 1J8HE 1T5KA 5DUBA 4NAQA 2YKKA 3D33A 4U0RC 3LX9A 1H9VA 4QTIH 5F7BA 2DKUA 1QSEE 5L4JA 3EFOB 1L6XA 1DQJB 3ATDA 5IHHA 1B2WH 3QUHA 4HKXA 1KOAA 1N4XL 1D5ZB 2N7AA 2V9TA 4MCMA 1QSFB 3RTQA 1JFQH 3W56A 3W37A 4F7CA 2F2HA 5F6HJ 3VGFA 5J1AA 3QJVB 1CICB 2ZUQB 1JPEA 2VDMH 1RJLA 3QUMH 5EG6C 4QXTA 3LNFA 4UV4H 4YSRA 4YSCA 3DUSA 2R8SL 4Z18A 4A2EA 1K5NA 4K94C 4NKMB 3IXTB 1ZGLB 3HIZA 3ARED 2ARJA 4P2QB 2MCAA 3AREA 5E6SB 3BVUA 2AK4E 2EIZB 4HHGA 2XA3A 1BQRA 1OOWA 3MRPB 5I1IL 3A6CH 1LEKB 3S34L 5D7IF 3VNZA 1UZGA 2UXVA 4YIQB 1SN2A 4K5LA 1Q1JH 4UAHA 2CCWA 4YFLI 3GMNB 4LMQE 4X80L 3C8DA 4OVUA 5F1SA 1KIUB 4BGDA 3CVHB 1ZKAA 1F3JA 5CU9A 4J2XA 4U6YA 4P9MH 2E9WA 5DWUL 5SX5K 3PHSA 1YEKL 2ZCKH 1RIVH 2EE9A 1S9XB 1TZHB 1UWEH 4YDJA 2ALAA 3BDYH 3UIZA 1N6QL 5A16A 5GPRA 1F41A 5A43C 3OG6B 3DRTA 2C3VB 2CQVA 4MZIA 5JOPD 3VSQA 4KK6D 2TRHA 5GS3A 5JXAL 1KLUA 1Z9MA 2XVKA 1YC8A 3BAEL 5HI5D 3BUTA 2ZOWA 1XCQA 2J6EL 2YAQA 3ROOA 1XTLA 4BZYA 4EI6B 1N5YL 2R2EB 3N1GC 3E8VA 2WVUA 3RWFB 3D0AA 1XF2B 5DA0B 2BWQA 4WWOA 4JHWL 3AMKA 5DD5L 5HHXH 4WI6A 1OF2A 2ZYRA 5FM4A 3VU1A 2VDNL 3CZFB 2YN3A 1E3FA 2FECI 3P3SA 5JZ7C 4F92B 5C0EB 4JFVA 1CUOA 4TLUA 1IFGA 4ZFOL 1DZBA 5F7KC 5I1LA 4HJ0D 5BRZA 2IF7A 2DQUH 3D1MC 3BPNB 3TNNA 4DGWC 3LKOB 3B6SA 3QUYD 2C4FT 1BVNP 2YD2A 4YBLB 4KZ0A 4FQXA 2NY2D 2R69L 1RVFH 3MGOA 1IGYB 2VN5A 3JBG7 1KGXA 5C8JA 2G75A 4HS6B 5F0MB 1FVCB 3FU7A 1S9YA 4RZKA 4WFEE 5I15L 2NXYC 1CFNA 3GBMH 1DSYA 1NL0L 5DYFA 3U6RA 1BMWA 3FFCB 1WT5A 3RWDB 1K2DA 3BVTA 3T0AA 2VW6A 3QJSB 3UP1A 1MHHA 4XBEL 4L8CB 4JO8A 4FQ1L 4FNUA 5EZOL 3FU8A 5EEUA 3NCMA 5C0CB 4ZJ9A 1UOLA 1HL9A 3IF1A 2XV3A 4Y8DC 5JA9A 3J2PA 5E2TL 3WFDH 4AEHH 4AJVA 4AQAB 4O02A 4HBCL 3C5SA 1I7RB 3DC0A 2P26A 3L45A 4WCYL 1MIEL 1L7IL 1GVIA 3O6FC 1B6DA 4GSRA 3ZKXC 3NFPB 2VRKA 2AP2A 3CNKA 1N5AA 1O6TA 4XN5A 3QIUD 3HRZB 3ZOAA 5ECGA 3FQ4A 4L8CA 1LO4L 1G7HA 5IQLA 1IKNA 3EZ8A 5E1IA 2G9KA 4WTZG 4IIQC 1ZLWK 1LEGB 5B8CC 3ZK0A 2AKRB 4PN6A 4OFVA 3SYCA 5T8IA 1S9YB 3DA0A 4HGWA 1I82A 1BD2B 2W91A 3W5MA 1GGBL 2FNWA 2AI0L 3G6JF 3UMTA 4NO5B 1R3LB 4GINA 3ZDYB 3ULVH 1CI3M 3EXJA 4GXVH 1RPQA 3TEZA 4KVNH 5KYUA 1HSBB 4TUOB 3NFSL 3V4VL 4X50A 2J1XA 4UYQA 3K80A 2ILLA 3P30H 3T0EA 4OZHB 4UQ2B 4QT5B 1TJHL 5HDQH 5IBLD 1R24B 1FC2D 3BXNA 1JXJA 2UXGA 5T33H 4NQVA 3RJDA 2Y25A 3L9BA 4LLQA 5IFHL 5F3FA 3VI4B 2MTAA 3KJ6L 4ETQB 1W16A 1Z7JA 1OAKH 5DJAB 4HLZG 4A37A 4PS8A 4CVUA 1IRAY 1GKOA 1Q9WA 3O11A 5MHSE 2HZHA 3SY0A 3QEUB 3MPCA 1PCXA 3WEMA 3QZWG 3PWPB 4XCCL 1GW0A 4PBVC 2JSFA 5GISH 1DLFH 5D72L 4XR8C 3ZHFA 3T09A 2CRMA 1DJSA 5E2JA 3VWKC 2PYEA 1W72H 3PABB 5EO0B 4E9WA 1LO0H 1B6UA 4HJGA 5SWZD 2Y06H 4AZ8A 1KV3A 3DJZA 2Y1ZA 4EMZA 1SXZA 5JQIB 4Y5VB 2FLRT 1OAUL 2YIHA 2NXYD 4PJDF 3SPHA 3MRLA 4XP4L 5E2WL 1BXAA 1HZHL 3BP6B 2W95A 5DMYA 4Z7VA 5BS0B 4NHUB 4ODSH 2Y24A 2VDLL 2CDEA 1IIKA 2D73A 2GKIA 3EGSB 1E30A 3RX9A 5B8CA 1T2JA 2ODIA 3M86A 3CHPA 3RVXC 2R0KH 4QRQB 3WEXB 4BEIA 5I0ZA 2BVPB 5J57B 1AQKL 3F65A 4RCAA 2FQDA 2FX7H 1N7MH 2J55A 1XGRB 1OD9A 2LV4A 1IGFL 5E6UB 4BKLB 3ZXAC 3HJEA 5GRJL 4QNPE 3LRLA 3B9KB 1XVSA 1I3GH 2OJEB 3P4MA 3T0BA 2D3JA 1UM4L 1HT6A 4GUCA 4QXUL 5E8PA 4PCKA 3UBXG 1MCQA 3ARGA 5FOBA 1SHSA 3FO1A 5JIPA 4XCNB 3T0XA 5I5JA 2F7RA 4J3VA 2AXWA 4U1IB 3DXAD 3SDDD 1ZJBA 5IROA 5IQ7L 5JPMA 5CINH 1UJTA 3JWDH 4MDIA 5I17B 3ETSA 4GKNB 2V9UA 3Q8CA 3TTSA 2V5YA 1KTJA 4K9EC 1D7FA 3ZDXB 3E1F1 3FTWA 4F1SA 1OKEA 4HZ1A 2BWDA 4W9DC 5T3XD 1I8IB 2WKOF 4XP6L 2CJUH 1P53A 1WAPA 3CHRA 1I9IL 4JGUA 2P46B 3ZQ9A 5AW0B 4DKEH 1YUKB 1NCNA 4DAGH 5DRWB 2AQ2A 2L7EA 2E27H 2WUBH 5DJXB 1AGFB 2W60B 4MDJB 4JVUA 3WY1A 2F15A 3VB9A 1AO7A 2X2JA 5T3ZD 3DYPA 4G8GE 4A7GA 1DVZA 1OCZB 2IMMA 2UZIH 1YEJH 4W9IC 1BQHG 2CJSA 2WYTA 3CTTA 4P2YA 2YARA 3KYMB 1PLCA 2D31B 4WFHE 1G7LB 2AXHA 4J3UA 1J9SA 4ODUA 5I82A 1OAKL 4WFED 4YSTA 3WFDL 2YA2A 2PO6D 5AVTB 1LO2L 2OXHB 1F86A 1V27A 2PW1A 3OF6A 3V6OE 3N44B 3MA9L 3IXTA 4BQ6A 4PJEE 4TPRL 4NOBA 3VD1A 4TQHA 1BOGA 3TS8A 3INUH 5JR1H 1T1XB 5ERWA 3ULUC 4KTGA 2DM7A 1GS8A 1TSRA 2JI3A 1CK0L 1EFXD 3N91A 3QQ4B 2E8YA 3QQDA 4JGJA 4CA4A 1CL7L 3UGEA 4JFXB 3LV3B 4NJAL 2F6AA 4W68A 2FYYB 2VDPL 3CVHH 4LDLB 4PB9H 1LK3H 3ZZLA 1T1ZA 3TBTA 5AW2B 4UANA 5ICXB 3WCYA 1FL6B 3QCTH 2E3VA 1RERA 5EBLA 1IJ9A 3FFOA 3KXFE 4JAMA 5GGRY 3STZB 3TPUB 5DO2D 2FGWH 4ZW7A 1A5FH 3ZDYF 3S36H 1T5XB 1IM9A 5EU6D 2FVNA 4RMSA 5DR5L 1TZ8A 4FTVD 5BO1H 3ZE0F 2FIKA 3O6ML 1E28A 1DEDA 1PU0A 3P0VH 5GGVY 1IU1A 4CJ1A 3LXAA 4KZDL 2W07A 1FNFA 3HAEA 3VWJD 2YGVA 5E8NB 1LDPL 1G4MA 3CSYB 4FNRA 4ZUWB 2J6WA 5E2TH 3F58H 2ADYA 3RIFK 1MAML 1WUZA 1C5BH 3LQZB 4URKA 4LLYB 3O6LH 3WAJA 1U91A 5CFAA 1TJGL 5HDBE 2P28B 4PJIF 1CF8L 4G5ZL 2CCVA 1DFBH 5E1GA 4F20A 3BN3B 3SCMB 4HG4K 3NJIA 4B5EA 1TZOA 2PWDA 1VFUA 5C0AA 3QUZA 3TT3H 2AEQH 3E6FA 2AXGB 4Y16C 4AUYA 3PV6A 3QDJB 4MXWH 4FTVA 3WJMA 4HWBH 1UG9A 2RGSA 4Q0XL 5I1JH 4ESKA 3V0AC 4L3AA 3WE6A 3U0WL 4PIBA 3HR5A 3F58L 4OFDA 4B9GA 4OZ4B 1BGXL 5DLML 1NCWL 5F70A 2A99A 3T6WA 1D2PA 5HGHA 3OB0H 3LHPH 2ESVE 4ZSOE 4LLAA 1E5ZA 4X8JA 1A1NA 4WEMB 3VFUB 2CO7A 5EH1A 3UTTA 4PJHA 4XT1C 2EIKB 3QFJD 5DQ9B 5F6HI 2J1YA 4YHYB 1CFSA 1NCJA 1SMAA 1UHVA 2BXYA 4Y19A 5KVFL 1XCTA 4IRSD 4UILH 4JVPA 5LXGH 2QTVA 5CO1A 3K6IA 4C83B 2G75B 3BKMH 4JFOB 2WYZA 2G3XA 4W4OA 1H3UA 3NFNB 5AVRB 1UCTA 5FV1L 3WFEH 3QJRB 1B4RA 4FFYA 4BKSC 5JQ6L 3GSVB 1JSYA 3U6XA 3VWKB 3RWIB 4KTEL 4JUTA 1KT2A 4L9DA 2XKNA 1OLZA 3FN0L 2Y22A 3WNJA 1CDIA 1JPGA 1XX9C 1ZSDA 1XAKA 4O02H 4BCYA 1PKQE 5C0AB 2DLIA 2HB0A 4LSDA 3LKOA 2GIYA 1A2YA 1SY6L 3P3RA 3RHWK 1HVXA 2R0ZH 3BUPA 5GS0H 2R29H 1L7IH 4OD3H 5CP7A 3D0LA 2BVYA 2ZYSA 1M4KA 2W9EL 2UZYA 5D5MF 4MCYB 4OI7A 3WNKA 2UWEA 3L5IA 2A6JB 2DLHA 5GZOD 2LU3A 2UZXB 2DWXA 2QR0A 3VMPA 1EAJA 3CXHJ 3N1PC 3O3AB 5F3HA 3T4YB 1SF3A 4U1LA 3KYNA 4NQQA 4W4NA 4R84A 4M7LH 1COBA 1J8SA 2LW3A 2VLJB 4G43A 1ETA1 3RDTB 1FWXA 1H6FA 3K72B 1NCTA 5K9OA 2CJ3A 3O45B 1HL4A 3CK0H 4M93C 2E7LA 1L4IA 4D3CL 5KSBB 3NJMA 4YHIB 3DK0A 3DTUB 1FSKB 1L5GB 5FW7A 2I9TB 3U9WA 4RLDA 1ILUA 2KS0A 4E9SA 2QL1A 4XCFH 2XTJE 1H3VA 4OFPA 5HY9B 1UH2A 2P8MB 3I9GH 4OZ4A 4XMUA 2FTAA 2GTWA 1UVQA 3GSOB 3OG4B 3IAGC 4HIXL 3X14A 1CBJA 3A6OA 4F7TB 1OQXA 4TUKL 2QELA 3FW6A 3P4LA 1X4XA 2HVBA 2VLME 2DLGA 5CBEB 2BFVH 3WFCL 4JZNA 4M3JA 2WGXA 3BLBA 3AGVA 1U8KB 3QAZC 2QQKL 3RVWC 5AEAA 1RUML 5IB1B 3NGBC 2ARJB 3Q1EA 4PRPA 3CXDH 2EDDA 4JPIB 2GK2A 2VLKA 4ZS7H 1BFSA 2R56H 3TEYA 5EEYA 5DCCA 2GITB 1N0XL 2NUPB 3TWYA 1BQ5A 1N64L 5IFAL 1CL7H 1MRFL 2JELL 3IRZA 2I5YH 4DZ8B 4CN4A 3GTVA 5B1AB 4IOSA 3CFDA 3ZKQD 5E8DL 4TSCL 5T1DH 1YY8B 4ZPVA 1KSRA 1UZ8B 1UYWL 2ADFL 5CBEA 2VISA 2J1KA 2ZKHL 1R3JA 1INEL 2OZ4L 3QH3B 4KRNA 1CLZH 3RPIB 1ZSHA 3S8GB 1YEEH 3GPEA 3GS4A 2CJUL 1F4XL 3N85L 4AEIH 4N25A 5IB1A 4H2CA 4LSQL 5DHYB 3CD4A 3NRFA 1AZBA 3SEPA 1KWGA 2N1TE 4G6KH 5AW9B 4YHLH 2RCSL 2XXCB 4QJ4B 3P2TA 3IPBA 1KB3A 2DQIL 2DPKA 4LIQL 2EXWC 3B7TA 4QHKJ 1G7IB 5E8OB 3WO4C 2JQZA 3NESA 5KVGH 1KN4L 5JPNB 4PHZA 5EF3A 1NGYA 3B9DA 3OKKA 3WFBL 4N2GA 4YEEA 1X9LA 4I88A 5DUBB 1IEBB 2V9QA 1SYSA 5FDWA 4RQQB 5AVUB 3T8XA 4XZUB 3REWB 1JZ8A 1BWWA 4QHNA 3FDWA 2TAAA 3S4SA 4AQ8A 3DETD 3FCGA 5CSGA 1NEPA 2PPEA 2VR6A 3RILA 3R0MA 5GRJH 1L6PA 1HH9A 4O2CA 3HUJB 5K9OB 5I1GL 4PRIA 1XF4A 4JFUA 2H0FA 3AU1B 1EJOL 4ECNA 3O3AA 5L6YL 2R23A 3NIFF 4XC3L 4OGAD 1V7MH 1E9QA 1AD9B 4ZDHA 2BY1A 4G8GD 1P4BL 4IGBD 3G6DH 2C9AA 3FUIA 3HG1D 3D0LB 1HL8A 3GXFA 4ODHH 5DD3H 3UAAA 3WLBB 4BFNA 3QCUH 3VD2A 3X1NA 3LD8C 4NJAH 4MAZA 3BAJA 4ORGB 1QR4A 4AWJC 4XOCA 5MI0C 4U1JB 2IPKB 4FZEH 1M3IA 1KXVC 5DEGB 4F8TA 5ITBL 2APSA 4P07A 4YDVA 5DD1L 5D7LA 3BT2H 3QG6A 4XXCA 1TG8A 3NA9L 4QRTB 5SWQA 2AANA 2EUXA 2MOGA 2ZX7A 4HWNA 3GHBH 3FB6B 3L3HA 1I7ZA 3VTAA 4Z8FH 2J71A 2E27L 2XZZA 3VD4A 2NY0D 1Z1WA 1XFPA 1MSPA 1E4XH 1EHNA 1AZCA 4X9BA 4KRPC 5HHVL 5E9DA 4FA7B 3TA4D 3GZQA 1OK8A 3UADA 1U8PA 4XE0A 1NEZB 2XXMB 5E6ZA 1NCCH 4AGMA 1JRHI 2BXZA 3AAZA 3I50L 5F7MC 3L3JA 1KNOB 2N7BA 1ZEAH 1J5OL 1UQSB 3RJQB 1UKSA 4U1SA 1GZHA 4CADB 2YUZA 2JIXA 1A6UH 4WGKA 2MHAA 3UPAA 3KPMB 1BAFL 4FG6C 2XWJB 1YYLL 1PBYA 3SCMA 2O6PA 4RAVA 4PJ5D 1D5BA 1YHPA 2X4PB 4ODVL 1M6OB 2RH0A 1J05A 3A4AA 4P4RA 1VZGA 3UBFA 1MLCA 2WP3T 2WXMA 4R7VA 4I87A 1HHJA 3RU8L 1CS6A 4NZUL 2IQAA 4HF5L 4APQD 1MCKA 3I50H 2W65A 2F1BA 3RTQD 3RGBA 3HMWL 1A7BA 1F8TL 4XNUL 3ZDZE 4NQCA 2B9AA 2VDKL 4TUOA 5C07A 5ITFA 4FLQA 1DL7L 5AKSA 2BNRB 2XFGB 2IG2H 2LR4A 1AD0B 4P23A 4LLMB 3IVKA 1IAIH 4K8RL 5LBGA 3UAFA 1AGDA 2I7OA 1NGZB 4PGEB 4FADA 3BZ5A 5EV7A 4Z7WE 2P5WD 4KVNL 3MZTA 2QV2A 3VXMB 3LKRB 2CDGA 4I18A 1B0IA 5E1AA 1S7VA 4WI3A 2QHRL 4LSTH 4LHQB 2ZKWA 3WYRA 4MLIA 3HI5H 4YDKH 4IIQA 4WCYH 4RFOL 4KFMA 1MHPL 2QEJA 3NRQA 4P23C 2WLHA 4DVBA 1KB5B 1WEJL 1UD4A 4HKBA 4XN7A 4OGAC 1I4FA 1D5RA 1J88A 5KOVC 3WIAA 1GHFH 4B27A 1TETH 1HCZA 3O6LL 4PJEF 5HSFA 4QRFA 4QD2E 2YC1B 2VR9A 4I3GA 3QNFA 4P46B 3NJJA 1S3RA 2WVVA 1S7XB 1RZKH 1N12A 1IKFH 2V5TA 4HZLA 2HVKB 4HLEA 4JB9L 3MNZA 4HIIB 3MRCB 4TNGA 3BAIA 1JDCA 3O6MH 3SBQA 5INDB 2JI1A 1XH3B 2C3GA 4LOFA 2MQ0A 3SCMC 1GTFA 3OPUA 1AD0A 5KYNA 1BZ9B 5TDNB 2Q6WA 1GJIA 3WEOA 1FE8H 4UINH 3FTYA 4B7IA 3RWDA 3ECWA 1FO0L 2X4SA 3AJ7A 2LABA 3TJHD 3ARFC 3V6ZA 1Z5LB 2GJ6A 4NFBA 2DWSA 3ZN6A 4L4TE 2CR3A 2WXLA 3RQ3A 3BPLC 3WKML 1G84A 1P9MC 4AIZA 1DVXA 4GMTL 4KTDL 2UVFA 5FWRA 1TITA 3ZKND 3UJIL 5BRZD 4KX7A 4ZUSB 4MJ6B 3JT0A 4YBQC 3QZLA 5INCB 1BW8A 2W59A 3LEYH 1QZNA 4JE4B 5DUMH 5EUOE 4F7PA 3IDYC 5HHOE 5JXEA 3QZNA 2HWZL 2ZKYA 3IDIB 1OANA 2EO7A 4FLHA 4Z3HA 4RAVB 4X5XA 1RQ5A 5DRWA 2VLRA 3OZ9H 4L3EE 4Y8AA 2QZ5A 2Q7AA 1DN2A 2PXYC 1YNLL 1BFOB 3SIKA 5B1JA 1BA9A 1KY7A 3PFQA 4NM4L 4POUB 2FB4H 3MR9B 4ABWA 5L4MA 3L7FB 1SOXA 1OAQL 4WFGE 3WEBA 1BJ1J 3EYSL 1PX4A 3HW7A 5A2CA 4MHHI 5IIEA 5CWSB 5I23A 1ZY9A 3FQUB 1JNHB 4ZMTA 2EH8H 2VLMD 3FFDA 5C08D 2Y7QA 2Z31D 3OGCA 5AW5B 2GUYA 4CU7A 1IGCL 5A16B 1RU9H 4R7NB 3OKOA 4Z7QE 3I6LD 4NENA 4ZAKD 5D5ME 2ZICA 5I8KH 5TE7H 4BQCA 4ERSH 4PH8A 3LB6D 3ARFB 4XB8A 5F0PB 5TK2A 3WDJA 3ZBMA 3N0PB 4ABVA 3WUWG 1IBFA 3G5ZB 4L3CB 2P24B 2XLLA 1ZA6A 4UT7L 1VGEL 4KU1A 3MX0A 3NCWA 4JPSA 1XEDA 2DH2A 1FL3B 4HIHB 5C0BE 1Z3RA 4JFFD 2XN0A 4F2ME 5ILTH 2EH8L 2XDHA 5E4EC 1OM3L 5E9DE 2Y72A 1QYGH 1LQSR 3R4RA 4Z77B 2HT4D 4TUJB 35C8L 5HYSG 3QQNA 3BWUC 3J7HA 4F9LA 5FKAA 3ORJA 2PW2A 5MERA 3KR3L 5LBSL 5BRQA 6TAAA 3GUTA 1RD6A 4XPFH 3T1FA 4ZXBB 1ZVNA 5G2NA 4MJ5A 7CGTA 4UQBA 3OMZA 3JZ7A 4P0DA 5AB9A 3W1ZA 3OXSB 4JPIA 2EXYC 1UASA 1DVUA 2PXYA 4OB5L 1H9DA 2H2SD 3T8XB 1EXHA 4U1HB 2NX5E 1J1XL 1IBBA 4P46C 5I1KL 5KSBF 2HRPL 3CDGB 1JPFA 1XZ0B 1ORQB 2X53A 4F7TA 2CMRH 4RFNB 4PRBA 4HCRL 5F7EH 1G7IA 1O6VA 4UNUA 5KBDA 4MQSB 3P9WB 4AMWA 1Z9LA 4GS7C 1AQ8A 3B9KA 1HH6A 4JQIL 1N70A 4ZUVA 3CMOH 3O2WH 4YSOA 1OK0A 1B4JH 1P1VA 1EZSA 3HEIB 4IRJA 1OHZA 4ZUSA 4BE6A 3GK8H 3BEVB 2K45A 4AE1A 3KPSE 2CALA 4HWZA 2E75C 3CSGA 4YIQA 3VXMA 3PWLA 4LL1A 1FZOB 5PAZA 2AMGA 2GFBB 1SHMA 3BH8A 2IANE 3DIVA 3LKPB 4JJHA 4UM8B 3W11D 4DP8X 3T65A 2NR6A 3OPZH 2N1KA 2P80A 3KPQA 3KLHC 4Z0BH 5KVFE 3FUJA 2XWBA 2VXTL 3RDJA 3K2MC 3CN3A 4K7FA 4O2FB 3HKZA 5GGQL 1X5YA 3KVPA 2PXYD 4PJIE 4PW9A 4BQBA 5FAAA 5MEQA 2B2XH 3IM1A 5INDA 4OUOA 4BH8B 5IFJA 1YNTA 3X13B 1MCEA 3WNOA 3E38A 3KWTA 1S7UA 1MRCH 3DJRA 3LKSA 4QAWA 4UIKL 3IGFA 4B97A 2GC4C 1ZV9A 2XY2A 4Y7OC 4ZFFB 3U0TA 2GBAA 3BYTA 3MI6A 4K71B 3TV3H 4BSJA 3QRGL 2ATPA 2PYEE 3VI3A 4PJ7B 5FFLA 3IDGA 5FYJU 3L6FB 1U95B 5DDHA 5E5UB 1F11B 5C3IA 3I6SA 4YZFE 3U9UA 4WK4B 1BMZA 1DJYA 2X4OB 4KHXH 2YSSA 4N0YH 1Q4NX 2XWXA 3Q43A 4XBMA 4U6HA 3QULB 2A9NL 1RUQH 2YOCA 1T03H 4PS4H 2X87A 1MREL 3O41A 2EEDA 1EDHA 4XPGH 4E42A 1T4KB 2SEBB 3NPSC 1UB5A 1FJ1B 3BQUC 2OYKA 3MV7D 3OKMA 4RSYA 5JIQA 1FL5A 4JKPH 3U9PL 3BZFA 4UT6L 1DQVA 4NO5A 3MRKA 1C9SA 3IN0A 3JV4B 2NY1B 5IW6A 5T3ZL 4IBWA 2D2OA 1CG9A 3S5LG 1UA6L 2AXGA 4AYEC 4X99A 3CFTA 1B0RA 2YEZA 4FE9A 1PX8A 1IVLA 4LSUL 4UAOC 4WTWA 4QUOA 1RURH 1BIHA 4PW3A 5TTRA 2Y36L 3PDOB 1PLGL 1EO5A 3TO2B 3NQKA 4XPHH 2P44B 3N42B 1DEEB 1ZPLA 3FPYA 1IB5A 2GTZB 1WV7T 5IF0A 4O2FA 1WC7B 3CHSA 1QI3A 4GYBA 4WUUD 1CE1H 2VZVA 1E9QB 5FHBL 4LF3A 4L5FE 3MA9H 1HHIB 5EDSA 3T5WA 4X6BA 1NFIB 5C9JB 1IGMH 2X2YA 4M7JL 1MVFA 5DZAA 3NPZB 5DJ2B 2VXUH 2Y6TE 4DK6A 5SWSA 1JD9A 1S5IH 4YPGB 5IHZB 5KVDE 4J4PC 1SXAA 3KDMB 4OKVA 1C8PA 1TZGL 2UY7B 2WLJA 1OB1B 3MRDA 3BPNC 4TLKA 3NIGF 2JJTA 2FO4A 2QVMA 3PIQA 4O00A 4GP8B 3B56A 5GGRA 3UABA 4ACTA 3BQUB 2EO1A 2OSWA 1F3JB 1VPOH 2JLLA 5L8JB 4QF1A 3P3UA 5I1DB 1FHNA 1MFMA 3MRHA 2E5EA 4UDTA 1FNLA 3AT8A 5HHQA 2IADA 4JGNA 4I1RA 1JFQL 1CD0A 1XZWA 4H44C 3ROLA 1U21A 2ZXWB 1JTPA 2CCLA 1MCOL 1YG9A 2WXHA 3LN9A 1B9ZA 1PX3A 4MVBC 3VXQA 3RX7A 4ZPTA 5HPOA 5C7XL 3PQYD 4LLUA 2LVCA 3QQ3A 1A7OL 1WS7A 3OQ3B 5DK2B 5B1JC 4A7TA 1JJUA 1GYCA 1WH0A 4JFZL 1J8RA 3DUUA 3IBOA 4GBXA 3T2LA 5A2AA 3TBSB 1UZ8A 2IJ0C 3HE7C 2J25A 3FQWB 1YAZA 1UWXH 3DOSA 1QFWL 5IEHA 2H41A 2Q8BH 4WHYG 5HHNB 4PIRF 2A0LC 1P5UA 4GO9A 3AREB 4U1GC 1WQVT 5A6LA 4YDLB 3PL6C 1CIDA 2L0DA 3D69B 2GBTA 1G7JB 4NI6A 5EU7E 1PD6A 1NFDB 2JCCF 3NJXA 3SSGA 3UBXB 3PHQB 4JMXA 4LLVB 3DSNB 4QRRD 4PGDB 4UWQB 1XCQB 2B77A 1LL1A 4GSQA 1MELA 6FABL 5JW5B 2VLJD 4G6MH 2AEQL 1T4WA 1ZLDA 3T77B 4CU6A 5T1LA 2I69A 3QUZD 2DMGA 3II1A 4GAJH 4X7EC 5DTFA 4CDHA 5I16B 3KBFA 4LSQH 3I3DA 2VXQL 4MDJA 3WIFA 4EUPA 1UGKA 4PYHA 3HG1A 2ATKA 1UFUA 2IV8A 1RHHB 3M1BB 3ESNA 3G08B 1KMGA 5HHMD 1KCRH 4R0LC 1YN6A 3C08L 2VXTH 3FUFA 1JK8A 2VO5A 5JIMA 2A4ZA 5BO0D 4M6OL 3SKNB 1MDAA 3T3MB 1MWAB 2A77H 2AV1B 2X4UA 1DQLH 1NC2A 2Y06L 4N0FA 4PGDA 4UOQA 1IQDB 4WWNA 5HDBB 2B59B 5B7FA 5EF1A 1U6AL 5KSBA 3GUTB 2OL3B 2QHLA 3MV9D 2E59A 4L9LA 1U9KA 1BOYA 4KKBD 5F1KC 2F18A 3ZW3A 1QBAA 5B4MC 5IUCA 5E2VL 3BYYA 3RURA 3S8FB 4MBRA 2JWYA 3SBWC 1PLAA 3H42H 3OLEA 3US1A 1PG7H 4MMXC 2FRGP 4XNMA 3PL6B 2E9GA 3L3OC 3RL2B 2JKWA 1LK3L 1JF1B 1DQIA 5CN2A 3D2UD 1PZ5B 1ZT1A 1Y0LA 4L1TA 5E6ID 2WNXA 3UO1H 2ZT9C 4G6JL 4LEBA 4MJ6A 2HA1A 3QPQC 5DMKB 3FB7A 1PF3A 5IG7A 2A3TA 5DZNA 4F15B 4HUVA 1J8KA 4WSJA 1TENA 3ROLB 3OC8A 1WBXB 1F4WL 2IWEA 3EG9B 4NUQA 3SZ6A 3GFUA 4HYTB 1J5DA 2AQRA 1C5CH 2R7EA 3CH1A 3CSFA 3MV9A 4P9HH 4PJ9A 4WHTA 4Y19E 4BK4A 4X98A 1KEML 1QSEA 2X4SB 1OCOB 3GBNL 5GZOA 2I24N 1YLBB 5I6OA 3TURA 1A66A 1JAEA 3RX8A 2D03L 4CRPA 2DDQL 2MQGA 4JQVA 2NX5D 4WNQA 5KAQF 5ICYB 3S2CA 4KXDA 1S78D 3B2UC 2BMKB 4KITB 5EOQL 5IKCA 2H47C 4HKZB 1UUSA 1YEDB 1RCYA 1AZRA 2H8PA 5KOMC 3FT2A 1KC5H 4WFFD 1B4LA 3GSNL 3A4DA 1VAHA 5EDXA 4D7BA 3O2DH 3DTXB 3DMMA 1MJ8H 3GRBA 1JNHA 4PMEA 4P23D 5E24E 3E9TA 4ELME 1PVHA 5CHNB 4M48L 4ZMVA 1BZQK 2AK4A 4H8WC 2B3RA 3UTSD 1BF2A 1EMTL 1AR1C 1T21A 4ERSL 2UWEB 1L9OA 4QLWA 2WUBL 1E5UI 3F7KA 3NJKA 1RK1A 4OIIL 3CFUA 1BZEA 4ZFOB 4MQ7A 3NDZE 4O2EA 5AZUA 5ADOL 3AZUA 3CHOA 3CPLA 4G8GB 2ED9A 3IGLA 1ZE3H 4JL2A 1DR9A 5JIHA 1MFVA 2VW7A 4FYSA 2IH1B 1S7UB 1ZANH 3QDMB 1S7WB 4K3JH 4OUUA 3MBWA 2WLZA 4BM7A 1VACA 4YSQA 1GH7A 3IFPA 1NC4B 2NTFA 4LQ1A 1ZS8B 2A6KB 1UCBL 4AQOA 4HG4J 2NZ1A 4H1LG 3NABL 1AFVL 5GGVL 2AEWA 2F58L 4XI5D 4C4UA 3P30L 2ENPA 2XPZA 2XTJC 3MC0A 2AJ3A 2Y69B 1XT5A 3ZQWA 3DVGA 1SEQL 2J8OA 1SM3L 4K8RH 4DESA 4JO5A 5DQ9A 2XBDA 1USZA 4CC1A 4JFYA 5IVXE 4TOYL 4UOW0 4YBQD 4G8IB 2VT0A 1I1YB 3V8CA 3VFVA 1XH2A 4MJIE 3JWOC 1JGUL 5I19H 5J8OA 1AKJB 5LHDA 5LCVL 4FJ6A 4GMTH 1OAZH 4KTDH 2ED7A 2VLKE 5LGHH 4LQFL 3HCVB 3IJHA 4V1DA 1KFAH 3THML 4B53A 4C59B 2KZWA 1KYOK 4MMZC 1QI4A 1RUKH 3C2AH 4IIQB 4PVLA 3QE5A 4OFYA 4Z95H 5I6XC 4PLKC 4M03A 1J48A 1V7NH 1H6EA 5T1MB 5E99H 3T3ME 1SJHA 4XMPH 1DQMH 2XZCH 3HI1B 3WG7B 4M1DL 5B38G 4KTYA 1BVOA 4IBTA 4AQ1C 1IKFL 1JN6A 1NGQH 1PAZA 4UQEA 3CFJB 3ZE2E 3IVKB 1MIEH 4FX5A 4B6ZA 1XGZA 2ZAHA 3UH8A 1U8HB 1JV5A 3GDCA 3DOHA 3RWHA 5KSVB 5KG9B 1EDQA 4LHUA 1YEHH 4F15C 5IJVB 1SBBA 5J6GB 1RUKL 3O4OB 3DI3B 5C07B 3LS5H 3SGJC 2EKJA 3QEGL 4O9HH 3IMBA 4ZO8A 3SDDA 3FTVA 4JHAL 3ISWA 2RQEA 3V0DA 3CUPA 4K5NA 2P48B 1BEYL 3EZJB 4PJCF 5JO5A 2FZ3A 3C5ZC 2EYSB 2WWNA 2Y7OA 4FDWA 4URTB 2OR9H 3BFWA 3M1CA 2NY5L 2YRLA 4X0NA 4KI1A 4BBWA 4G9DB 4N3UA 2H32H 2EE3A 1NSNH 3GHEH 4O51A 3BISA 4F24A 4KY1L 3BFOA 3D39B 3PWNB 5DK0A 2QSTA 4HETA 3LV3A 2CSPA 4LBAA 3PXLA 5EPMA 1HQRA 2XKUA 1NDMA 4CMMB 3IDXH 3MO1B 2R2EA 3QDGE 3DHJA 1WIUA 5IK3B 2JK5B 2E4FA 3LZOA 4CN1A 1SUHA 1OB0A 4Y2DA 2CXGA 1MCRA 2YXFA 4C4BA 4FRWA 2M26A 2Y07H 1T1YB 1KLUB 3AB0B 3GHEL 1T0NB 3DX7A 4J7RA 3MROB 5I6LA 5DYOA 3OF6D 3FS9A 4A1RA 3T4AA 4EZJA 1FVEA 3KLSA 3CE1A 4NC0B 5ACMA 2YBRA 2RR3A 4U7MA 3IKKA 4JG5A 3ZIYA 3QYCA 5AVXB 3CSBA 3T9WA 4JKKA 5AW1B 2ESVA 2YJQA 5I8KL 4K2UL 4I1NB 5FA4A 4N6QA 2NTFB 4OIFA 4JDTH 1CXLA 2H1XA 3LY6A 4U7KA 3GMNA 5JHDD 1M1XA 1T0PB 2B9BA 4E9QA 4MD5A 3S3DB 1UWFA 1SHXA 4JQIH 1Z5HA 4F3FB 2G3ZA 4FFTA 1JWUB 2A9DA 3MBEB 4PVNA 5HGDB 2ICEB 1NBYB 4O2EB 2VGLM 3MROA 4UTAA 3UROR 1TCRA 2IGLA 4ELMB 1BZ9A 4AY0A 2OL3A 4IRSC 1A0QH 4JFWA 2K4WA 5BQ7B 4GIAA 3GLEA 4OZGF 1T21B 2WWOA 3HNSL 3WSQH 2A38A 1F18A 3P0YL 4WDIA 2R69H 3VG9B 2HVKA 3P77B 3D6GA 1XGPB 3SDCB 4PJGB 5IMKB 3B2DC 1GZPA 1NIFA 3NYKA 4JM2B 3CFIC 4FZEL 4XVUD 5E2UH 2CGZA 1JXDA 3U7YH 4HK0A 4QMEA 3ILEA 3L9RB 4LNRA 1NKOA 1U93B 1QFHA 2Y3NA 2AI0H 3PWPA 1HJCA 1BX2B 2WNKA 4NCC2 5LKNA 1HHGB 2WXPA 3UX9B 2VDQL 4F9LC 3EJJX 3HHSA 1NCBL 1FRGL 4NIYE 1MCOH 4P2OB 4PWIA 3VH8A 1MUJB 5DHYA 4QHPA 4LLQB 3BPCA 4X98B 1QD0A 5I1GH 4F93B 4JPQA 3WEXA 3EO0B 5I1AA 4YWGL 4U1MB 4YHKL 3P2DA 1ORSA 1AIFB 4X6EA 3LKRA 1NOLA 3EJSA 1DE4B 3WL9B 5IG7B 2D8KA 1OHQA 3HKFA 4G43B 1WBZB 2OI9C 4PJ5B 2B1AL 2H0EA 4LCWA 4WFGD 3O6FB 5C2BH 3N41B 4KKLC 2ESVB 2R83A 4RWYH 3WJLA 3QIBA 2ITCB 2O1AA 3NP4A 3QJOA 3WN5C 2EYTB 4GKOA 4NN6B 1AI1H 1KV7A 2YO3A 4KJYB 3UJJL 2JKXA 3D08A 2BERA 1ACXA 4DIXA 2DL9A 3AXHA 1QKZL 5ESQB 5HJ3B 3QDJE 1PQZA 4YL4A 2NUTA 3HG4A 5AD0B 3FOMA 4Q2ZB 1G6VK 2EIMB 3O2VL 4W6YB 1A6AA 1F1AA 4EI5B 1WFIA 1AANA 1RPUA 3ME0A 2HRLA 2R29L 3V5KB 4M6NH 2BC4B 5L2KA 1GOGA 1NA8A 4GAGL 3RVWD 2P8MA 3KWWB 4TSCH 5T1DL 1X5GA 5IBLC 1SMDA 2VIRA 1JNLH 5I1HH 3DIFA 1MCFA 2P5EA 4QRSA 1OGAD 3NCCB 1DJHA 3GQFA 1TTFA 3B3BA 3L3GB 1NZRA 5JHLA 2MTPA 1QA9A 4C4KO 2C3XA 2XPGA 5DHVB 5FUZH 1PJWA 2VDQH 5E9NA 5JQ6H 2VRAA 3QEHB 3KCPB 4MNQD 2CU9A 2LTQB 1KEMH 4JHVA 3VFTB 1PZ3A 2YAEA 5C08A 5I0WA 5J89A 1XGQB 2WIIA 3DXAB 2XTLA 1SJEB 5SV4A 2VABA 4ZFQA 3LZNA 1X7SA 4HF5H 3SPCA 3J8F7 3VWKD 3NK3A 3F05A 4XH2A 2UZPA 4QKXB 4W9FC 4XPAL 4HS6A 3QNYB 3PDOA 3S9DB 5IBTL 2ZX9A 5A3IC 2VWEC 3IRCA 1YMMB 3HN5A 4NN6C 4DOHE 2H32A 3HNVH 4NN7B 5LGKA 5FYKE 4NO0D 1IT9H 2Q20A 1I8UA 4GKSA 4M5YH 5IHUH 1LO3L 3VFGL 1A7RL 2L7JA 1M6OA 3BVNA 3BN9C 5TF1H 4FOMA 4PRIE 3NJGA 3PHAA 4TVPD 1R3IL 3B83A 3V0WH 4LGSB 3SPVB 4E0RB 2Y2WA 3QG7L 4M1DH 4PFEA 4BFGA 3V95A 4H5SA 5K1NA 5DGRA 4YPJA 1V3KA 1IEAA 2E76C 2BSSB 5DRNA 3H4FA 2YGQA 1RZGA 1TSHA 2EICA 4YH6A 3BZFB 2GSGB 4JRXB 1LO3H 3VFGH 1C1EL 3T71A 1ZAGA 1FNSH 2ZWNA 3WJJA 5IJKC 3K5SA 3STLA 2IALB 2WBXA 3JTTB 4Y4FA 1D5XA 5IHZA 1XEUA 2DWDA 3QUML 4GPVA 5KUKA 4PJ7A 5C0RL 5EOTA 3IDMB 1SN5A 2MNJB 5EU3B 2ZX5A 3AGWA 5JIIA 2YQ2A 1H3XA 2MJWA 4KUZL 3U1QA 4HUVB 1JGLL 4U0RB 3UC0L 1YJDL 5GZND 3KGUA 5JHLH 3ERXA 4DETA 1FH5H 3P9MB 2F7PA 2O5NA 3LQAL 3WLBA 3R8QA 2DWTA 1B88A 2VISB 1IE5A 1KG0B 5CCHE 2YMOA 4WEUD 3V9CA 1AGEB 1HX0A 2L7UA 2YMTA 5I8OH 3BRDA 2ZCLL 4UQ3A 3LH8A 2JFCA 2IPUG 7FABH 5IOPA 3V4VB 5I8CA 3G7TA 3RGVD 3D39E 4WUUB 5DJZA 3V0GA 3RPBA 4R9HA 3ROOB 1NC2B 1H8OA 4DN4L 4M8VA 5L4IA 2PO6C 3VRJA 4LOEA 1NUNB 3I84A 4L2LA 2B16A 2FLBT 3QORD 4JAMB 1SYSB 4CC0A 1FJ1A 4Q52A 4EBQL 3CSTA 4N2HA 4YBLC 4HFUL 3SE4C 2CJTA 4H26A 1EGJH 3N6YA 2APVA 3QEQB 5KS9F 1TJIL 1SZNA 3L7EB 4S0TD 2P4AB 1GC1L 4G3YL 3ZE0E 3DX9A 2EEXA 3ULUD 4JDTL 3CZKA 3MMEA 1UADC 5FKPB 1VFAA 2P80D 4Q9RH 4EAEA 1U8NB 3U4BL 3GS7A 2DQFA 3HNVL 3Q9PA 1S78C 3BH9A 5E5MB 5ANHA 3ATBA 5AYTA 1EPFA 1VEPA 5AAMA 2ZWKA 2GSMB 4UTBH 1RJYA 3S35H 3AXLA 4I9WE 2EDNA 4LEOB 2LLGA 4QXGL 2PTTB 2WXGA 3ES6B 4EQ3A 1G9MC 2WQXA 1RZPA 2PP7A 4MB3A 3P9LA 4FQHA 2CK2A 1OF0A 2XBTA 1FYTD 2XN9B 4M00A 4Z7AA 3VACA 3KE0A 3R0NA 3CFDB 4NXSA 2WIMA 4HU8A 5EIVA 3SODB 2VDKB 4KK9C 4MMXA 4LAQL 1W0VB 1FUNA 1RUPH 3WXVL 3PUUA 3S5LB 2AQNA 5D4JA 4K4KA 4ODTL 2DLFH 1SGKA 5IQ7H 5K39A 1JPTH 2OJEA 2FWUA 4GNKB 1SN0A 4U49A 4HK3N 5E9DD 1BZ7A 2V5MA 2NDGA 3S35L 4RGNE 2A9AA 4L4VD 2LT9A 5E08H 2W0LA 2XSKA 3PP3H 5AOJA 4I2XA 3APFA 4YSDA 1CDYA 4H8HA 1BQUA 5EUOF 2WNWA 1XF3A 3V8OA 3GYRA 4WAFA 3BIKB 1R1CA 1W15A 5J56B 2IPUK 2NNFA 1IQDA 3U48A 4MD5B 3UYOD 3BDYL 1CK0H 1N6QH 3FTXA 1ZK9A 4RMTA 4X6DA 3WFEL 1BYNA 1BXUA 4K3HA 1O9WA 4R7DA 3BAYA 3CXFA 2JJSC 3UIYA 1HAWA 4UTBA 4GG6F 2OCFD 1MQKL 3FFDB 5E7BA 5T1KD 5I1CL 8FABA 4JCMA 5C08E 3ZKMC 1INDL 4GIPD 3QB7C 1NGPL 1FV1B 1T1WB 4G9FE 4ALAC 4BRJA 3H7BA 1AC0A 5FGCE 1CYGA 3IJEA 4PBDA 4MZ2A 2B2XL 5DWPA 2WKLA 2OL3L 1ODAA 1NCDL 3QEQA 1MPAL 3O0RH 4MFHA 3N55A 4LSSL 5FGRA 4PJGA 3KYNB 1RZ8A 4DGYH 5I6NA 5HYIA 4FA8A 3SY0B 4XAKD 3DX6A 3MLZL 5E8PB 2EYRB 3IJSB 3DIDA 1Y6MR 2EDJA 5EA0L 2GTZA 2IDQA 1E90A 1F58L 4JY5H 2CRYA 5BQ7A 2UZYB 5IMMA 3BZ4A 2B5IC 4G71B 5CEYB 4HULB 1DQQB 1A6TB 4QCIA 3IMRA 5J9PA 2IOIA 4F2MB 1MJJB 4XTRC 4DUWA 4LVHB 5I66B 4GIOA 2LTQC 1RK0B 3LKQA 4HWBA 1M6UA 5T5FH 2NY4C 2CBMA 3I2CH 4Q9BA 2X4QA 5EOCJ 4X5XB 3X3GH 4OZGE 5JUEH 4ZS6C 2RB8A 1AOHA 2DTML 3LSOB 4Y4KC 3EYSH 4B9PA 2VDPH 3CVHL 3PRZA 4PEEA 1OAYL 1PY9A 1A21A 3VG9C 4IJ3B 1ERNA 3VA2C 5DZVA 5DMGD 1E6OL 5J12C 5I5IA 4G1EB 5CSZB 1T20A 2LGNA 3P4OA 4PHXA 1ET5A 1MFEL 4YXLL 1F3DH 2QKIC 1KZYA 1NGWA 1KJVB 4PG2C 3HNSH 1QP1A 1QSZA 3OGOE 2X4RB 3QW9A 4KVPA 4XNMB 4UNVA 5GGSB 4FXTA 5IVZA 2IIJA 1NANH 4GLRI 4RGNB 1X4YA 3SDXF 2CHXA 3PGCA 4LMQI 1G94A 1NOAA 2FEDD 1S7QB 4GJTB 3MGAA 1AGCB 5FF6A 35C8H 1LO2H 2YLHA 3B9KC 2AZAA 3SKMB 3WN5A 3E8UL 4PRHA 2GHWB 3ARUA 3CJJA 3KPSD 3SN6N 2JXMA 3CC5A 4ONOA 5T1MA 3WXWL 3BGFB 2Q0ZX 1U0QA 1P7HL 3AXLB 3KXFD 3QXAA 4JO2H 2J8UB 1XIWC 2VQ4A 3HVDA 3SE9H 4RZCB 1BPLB 3MRQA 4XX5A 3V0EA 1MHCA 3MV01 4XP4H 4DOHB 2HP4A 1HZHH 4K5OA 3VXOB 1TQBB 2X4NB 4ADIA 1FP5A 3QZMA 4PLJD 4JQXA 2VXUL 5DVNA 1SY6A 4IMLB 3KYOA 3WHXB 4QDGA 2ITDA 3AS0A 1ADWA 2JMRA 4J3OD 4ZTEA 4HOZA 4G8IA 3VXUD 3HZKA 1KPUB 4LSPL 3DECA 3QK0A 3HAEB 5FYLD 1QMUA 4PJHE 1OW0A 1LTXA 1BD2A 1RMFL 3MNMA 3ZRSA 3O2WL 1HEZA 4E9RA 1CD1B 2YBGA 3O81A 4LGRB 4Z3GA 1HCVA 1KTDB 3EFDL 4NC1E 1YEIH 4KUCF 2DYPD 3NMEA 4HEPA 4Z0XA 2L3BA 4DFHA 4TF4A 1T5XA 1OSYA 5IFHH 3FCSA 4H0LC 2CBQA 2NRDA 1GIGH 3N1MC 5BRZB 3LZFL 3AY2A 4KK5C 3U46B 3BKCH 1R17A 3OZ9L 4X0KA 3H9SA 3NIFE 2R4RH 2J8UE 3FUNA 1OTUC 2NY7L 4ZUVB 3FTUA 5ICXA 4FNQA 3IPFA 1TFHA 3GT6A 3O41B 5KBKA 3VXUA 4PW4A 3I9AA 3I3EA 3MRQB 4IBZA 5L88H 3IEAA 1K6QL 2ARWA 1EV2E 2VIRB 3IT8D 1BZ8A 1I7RA 1I75A 4KNQA 2P45B 2V3FA 1B4TA 3ILPA 1PZBA 4QO1A 4PJAA 2GG1A 3WTUA 4PS4L 4OLVL 4X7TB 4DKFH 4UV7H 3WDIA 4KAQH 2EIJB 1L9MA 5E2WH 5ID0A 1JPST 1MCLA 1FNAA 4DP6X 1I9JL 4MKMA 4PJCB 4JK0D 5G5DB 2WCPA 5D1ZC 3OBAA 1TVBB 4NQEA 4FQJL 4XBPB 3FU7B 5B39G 4MA1B 2IO5A 5H37A 3VGGA 2OFQA 2BSSA 5DRNB 2W92A 3B9AA 1HI6A 1PGRB 1KEGH 4JY6B 4GG6E 2IFGA 2FR4B 3TNNB 4R2GB 1NFIA 2AJUH 3F2LA 1GJWA 4NCDA 2YD3A 1UT2A 1HEJC 3S37H 1GCFA 5C8JB 2CH8A 1C16A 1MY7A 2FSDA 1YEKH 2JKLA 3D51A 5DJ0A 3EUUA 2J20A 5TF1L 3P1VA 4ZFZA 1AC6A 2OA9A 1QAWA 3WS3B 2ZOUA 3BPLB 5BVPL 1MNNA 3MLXH 4MJ4A 5I66A 2ENYA 3DDGA 5TQ2L 1D3CA 1SYVB 2JJWA 3FO2B 2E7HA 2ZNXA 4JZOB 4Y9FA 3X1EA 2CIIA 3GB7A 4B50A 1EZUA 1JHTA 1L3NA 1I1CA 4C47A 2B1HL 1I1AA 1SM3H 2C9RA 3C6LC 2ZWLT 4XZUA 4POZD 4WO4C 4CADA 2FJHA 1ZMYA 2N3JA 3OC5A 4XP1H 2MEJB 4JFFA 5DJYA 3SGEH 1XR8A 3FUHA 3HB3B 2NT0A 3LEYL 4J3OC 3B7YA 5KVDH 1OTTD 3AY4C 4AMXA 1K9TA 1PG7W 2VSMB 1A4AA 1CCZA 5DJDA 3F00A 3C6EA 4MHHG 3L16A 4G8EA 3UDWC 1XGYH 1BQHB 5F96L 1T2QH 2VN4A 3Q48A 1WP6A 2J72A 3FB5A 3UACA 2H9GA 5C09A 2P42B 2WXKA 2C7UB 2UZIL 1D9KA 1PEZA 3FSOA 5CGBA 2PN5A 5DJCA 4PJ9B 3SJVD 5HGDA 4ZW8A 5JMRA 1AJ7H 3MV7E 4I18C 3PGFH 2B4CH 3MUY1 4TUJA 3U82B 4YSUA 5DZJA 1NQBA 2BVEA 1NGQL 2FDBP 2DJ4A 1KYDA 1KJMA 1XF3B 1MFDL 5HYJB 1RH8A 4BZ2L 1AY1H 3IDNA 3U30C 4MX7A 1D7DA 3KEDA 1MJ8L 4HSCX 4ONGL 5I5MA 3DX8B 5E0FA 4Z3IA 5IM7A 2BSEA 2V8MA 4WENB 3HC4L 4JG0H 1UOVA 2XUWA 2VAAB 1WG3A 1F02I 4PP2B 4PRAA 5DT1L 4BFOA 3ULUL 3CDZA 5E56A 1HYRC 3GMOA 4DKFL 1R3KB 5AAWA 2APTA 4B9CA 1WPCA 1E7UA 5CJOH 1RULH 3QI9C 4P2QA 4OIIH 4MCNA 2PYEB 2OTPA 4D0DB 2Z35B 3DSFH 1QLRB 1MW0A 3QA3B 1Q0YL 1T1YA 3VFPB 3MUHL 5KAQG 3QO1A 1KWKA 2GITA 3JXAA 4BZ2H 3VXPB 1YO4A 3IKCB 3BH8B 4UM8A 3ASNB 5H2BA 1KBGL 1QSFA 1UVQB 3GSOA 4M3HA 3VXQB 4EE2A 5CMAA 3F62A 4M7KL 2PABA 4BXVA 3GSNH 5E6RB 1KTLB 3ARGD 1G0DA 5A2BA 3QR1A 3RTLA 2HKHH 4OZFG 3FONA 5GISL 1EBPA 2XG5A 2PLTA 3QARA 2ZF9A 1Y1UA 1H0DA 3SO3C 4A7SA 2XG4B 2NCEA 3MOQA 4DWHA 1HNGA 1YEGL 4H40A 3TZVD 4E5XG 3QHZH 4UT6H 3B3IA 2A0LD 4ZOAA 4PGEA 1AKJD 4HQQH 1HKLH 4KMTH 4Z8FL 3ZIMA 5J11C 5AOMA 5C0ND 3I6KA 1H19A 2J56A 1XQ4A 2BSDA 1NUGA 2YPVA 3F7QA 3HG1E 1LWJA 4M6AA 2OCJA 1HSAA 5FW6A 4XNZC 3VFRB 3H54A 2IAMD 3V0HA 4TULH 1MCNA 5HP5A 2JJUA 4MJ5B 1P5UB 4HIQA 4R90L 5GZNC 5DJ8B 3UO1L 2RIKA 3H3PH 1MCSA 2Y4SA 4NRXB 4OD1H 1DCLA 3LZQA 3VA6A 5B3NA 5C0JB 1EDYA 5IUSA 1E4WH 4FYQA 2FBJL 1JN6B 4RGMC 3LZPA 1SBSH 1S8DB 5F3BB 1IGTB 2VR3A 3F7YB 4I77H 5FO8B 3GPSA 3RZCC 1SVBA 2YD7A 5C0EA 4CDGC 2WVSA 3S5YA 1BBJB 1T89A 2DQIH 3GMLB 3MFFA 3PP4L 3VI4E 4KHTH 4QRPD 4QRPA 1F97A 5HYQA 4HUNB 1MHPH 5EZOH 5ISZB 2JNZA 1INDH 1T80A 3KPRA 2DDQH 4QJ3B 3V5HB 2YAHA 4JANA 4Z7QF 5IVNA 4EDXA 2OSXA 3DHUA 3QO0B 3RWFA 1XCTB 1AZUA 2AEIT 4WJKB 5ES4B 4PWEA 5CD5D 1U8PB 3MXVH 4E5XA 1U58A 3DXAA 3G6JA 3VM7A 5E6IA 3C5JA 4IBVA 1ZXKA 1IC4L 3IE9A 2HH0L 3LJ3A 2XQBH 1FYHB 4CJ0A 5D7JD 5C71A 1CGSL 2YD6A 3BWAB 3HZVA 1FVDB 1FDLL 1E6OH 4XWGH 2XHNA 1RUAH 5IFAH 3EGDB 3FB6A 3L3HB 3MCLL 4KPHL 5FWQA 3WO4B 1IFHL 3FN0H 1AMXA 5D2LA 5LB1A 3APDA 3U25A 2ICWB 4NQSA 1I1RA 1QOKA 3TESA 2ZSVB 3ZDXE 3RUGB 4L8DB 5CSZA 5SWSD 3KJ4C 4KUZH 2XN9E 1TTRA 4MCYA 5FO8A 1YMME 4NBXB 12E8L 1OGTB 2HTLD 2HMID 3RY5A 3SBWA 4E0RA 3L95A 3GTNA 3UERA 3WJLC 4F7PB 3ULAB 3QWRD 3LB6C 2Q7YB 2V33A 4M48H 1I1AC 5DFAA 3F7LA 3UPRB 3LPGA 1F3RB 3MRBA 4AKQA 1TU2A 4FQLL 1BEYH 2KDGA 1RHFA 2KZBA 1LK2A 2GJPA 2DQEH 3G3LA 3PU7A 1RSFA 4G1MB 1OP5K 2VABB 5C0JA 2VUKA 1H5BC 4GI9A 3GZKA 2I9LB 4N2MA 3FOLB 1L9RA 2JIXB 1X5JA 4LAQH 3FL7A 1NIAA 1TQWA 3GBDA 4NEHB 4GQRA 4PM1A 3QEHA 4N2AA 2ROXA 3VFRA 4ZSOB 3O3DA 4Q97A 4MNGE 2YPKA 4NQCE 5AW8B 3UCQA 4B9IA 5F88A 1T1ZB 3FTSA 1CF8H 3K74B 4FMFA 4MYPA 4HIIA 3HI1A 1CT8A 4W9LC 3VG0L 1JGEA 1ZS2A 1AGBA 4FFZA 2R1XA 2F5BH 4NZ8A 1JGDA 3MJ6A 1IC4H 3PWVB 1IC1A 5D1QE 3T2NH 3STZA 3TPUA 5IWLC 2K8MA 4X6CA 3VH8B 3RNQB 4XVSL 4XXCC 3SBPA 4N85A 4Z95L 4P46A 4OSUH 2YEQA 4A6YB 4TNWF 2Z91A 2DQGH 3TCLB 1KBVA 3VXRD 5IMLB 3BESR 4PRBB 3EYVB 1Q9KB 4HDIA 2OV0A 3O4LB 1L7TH 1QW8A 4NJ9H 4QRTA 4R5XA 2H3XC 1N64H 5SWQB 2L4OA 1UWGH 3W0WB 3FQXB 4MS8D 1Z9PA 1GXEA 2NQCA 3VUAA 1A47A 1PQZB 1QATA 2OP4H 4Y7MA 1B90A 1YPZE 2DI8A 3ME0B 1XDTT 4A55A 5KVFH 4GRWB 4I18B 3M8OL 5BUGA 3RZCA 5CZRA 1SXNA 2WAQA 1NEZG 2DWEA 3ZQXA 1RUQL 2VR7A 1P7KB 5GSVA 1NIEA 3HE7B 3H53A 4LL4A 3M07A 1SJVA 1WUNT 3D0VB 5LNDA 1OGAA 2ICEA 3QIUA 3EO1B 1PZDA 4GH7B 4HJ1A 1U8QB 2XOTA 4JHZA 2YRPA 4FL4B 3NZ8A 5CKAA 5EZPA 3QFJE 3PQYE 1HXMA 3B2VH 4RGOL 4BWTA 5I75B 3FO9A 1PS3A 3BPCB 1BMGA 5JUEL 3F6LA 2C3WA 1THAA 1Z9OA 1ZT4B 4W4OC 4ABQA 1FL6A 1HH6B 5GRZA 5ICZA 3T6QC 2BFVL 2BSBA 4L4TA 1HHKA 1JZDC 3OAUL 5AKVA 4CW1A 4MDIB 1BXVA 5I1AB 1VFBA 2A74A 2HKHL 2DV6A 2KQNA 4LNRB 4FC3E 4JFXA 3ARBC 4PB0H 3TN0D 3OHXB 4RISH 4WI2A 4DO5A 2YA1A 3AQZA 1XBDA 3AC0A 3HC4H 3LPPA 4IM8A 3Q3GA 3VD5A 2FH6A 1Z0NA 3BAKA 2PR9A 5KSAD 2OMUB 4EKJA 4ZMXA 1CYXA 3Q2LA 3L3IB 1PDKB 5IW3A 2YUXA 4N0UB 1QVOB 3BFQG 4GRLA 4K94L 5AB0A 1T1XA 3DV4B 1IBGH 4OM0H 3TIEB 4OCMC 2VDRB 1I8AA 1H15A 4P5SA 4NXKA 1MZZA 1DFBL 2ZSWB 2XU9A 4HC1A 4XCCH 3MTXA 1MJ7L 2PW1B 2YEVB 4DZ8A 3O9WA 3Q01A 3BQUD 3CDZB 4JDZB 4FYRA 1EVTC 3EBGA 3MODH 3QCTL 5DZLA 2ADIA 3Q6GH 1QSEB 4QXVA 4BIKA 4L8SC 4H1LH 3BUDA 4AENA 4EQ2A 4PRPD 2CMRL 3HBGA 3JWNC 1HWGB 2IC2A 4ZQTA 4H8WL 1X7TA 2AV7B 4R4FH 5JO5B 4UNTA 2OMZA 4AVJA 4Z23A 1G87A 1NC4D 1IARB 3NCXA 3BIKA 4M7ZC 4F57H 3AFLA 3LDBB 1TJHH 5FO9A 1JGIA 2FHCA 5HDQL 4GOSA 5BO1L 1BVKA 3F8UB 3KBPA 3PQYB 5ID1A 3IFNH 4FXGC 2QSVA 3NN8B 2H6PB 3ULVC 5DS2A 2A83B 1GYAA 1N10A 1OV8A 1U3HB 4FQ2L 4G83A 2YQ3A 2FJFA 1SDYA 1T04B 4QYAA 1WFNA 1Z32X 2MRYA 2FE0A 2P8PB 5EU4A 3MODL 1IZKA 2EE2A 4BFBD 3O9WD 3VSUA 1REIA 4KK5D 5HY9A 4LCCA 2OMYB 2QMKA 1DYZA 4ONHA 4ZO6A 5AAPA 1AQKH 2OP4L 4NQDA 2E6QA 4R5VA 2E56A 1ID5I 3HUJA 1HJBC 3UBHA 1SJHB 1W8OA 2EVHA 4XAWH 4AEEA 3MBEC 1A9EA 4XWGL 3BCFA 4E9TA 3K4ZA 1KULA 4W9CC 2BP3A 3IMSA 2NSQA 1TQBC 4M5SA 3MJ7B 1CGVA 3IMUA 4LKCA 2IOOA 3FUKA 1E40A 1IEBA 5A2KH 1DJXA 3OHXA 1A3LH 2ROYA 1E8WA 3TH2T 4GRWE 2QSCH 4LDEB 2AEPH 1D2OA 3MO1A 1TLKA 4E9LA 1GMIA 3QC5X 5BV7H 3JWOH 2Z7ZA 4AG4H 2CBPA 3GEFA 5B39A 4APQA 2WNGA 2IDUA 3IYLW 1HIMH 5AG9A 4HJSA 3CSYA 3DOIA 4PQXA 5D1ZD 3T77A 2Y07L 4LBEA 4AKOA 3ZL1A 3CFNA 1K4CA 2VMDA 3BE1L 5C07D 1FRGH 3ZT5A 3CMOL 2CHZA 5L0QC 1HWWA 3GGWA 3WY3A 1U3HC 1J8HA 4FAAB 1EO8H 1KXQE 5AYUL 2H6OA 3QUXB 1I7TB 3DMMD 4MAYC 2BVOA 3OXRB 3T3PF 1RIHH 1CXIA 4PJGE 3UAJD 2P5PA 2NNCA 2GK0A 3WNNA 1IGJA 4FTDA 2BW5A 1EEYB 3ALPA 4OV5B 5DXWA 1XSJA 1J1PH 3D2UB 1W2KT 3JVGA 4OF6A 5KSVA 3TWCL 1S5HA 4IKNA 3HI6L 2PO6A 4YHZH 4C58B 2QQKH 2YPVL 4CKQA 3UJIH 4JFTA 1CURA 1I4FB 3QUZC 3C6LD 1MHEB 1NUDA 2F54B 3C6LA 1ZHLB 4FMVA 2VN6A 5F9WB 4E41E 4PG9B 1ZWIA 2F1AA 5DD5H 3QO1B 3QEQD 4FQIL 5D9SB 3WKYA 1KLFA 5EIIB 3BP4B 1OTTC 5AKTA 5EO1B 3CHQA 3GMMB 1FE8L 5TE4L 2XYCA 3VFMA 1JOIA 3ZHKA 4Y9GA 1DSWA 3K2UH 1A3RH 5JHMA 1B3IA 1J87A 1EZLA 1R3KA 4KJYA 1WGVA 4KZDH 4BINA 1XL6A 4P5MB 5SWSE 5TJWK 1HSBA 3ULVD 2AJ3B 3PF2A 4ONHB 3FO0L 4MJHA 2G4GA 4X6DE 2HAZA 1HYSC 4ZUWA 1W72L 1UD6A 3I85A 2LQRA 3KPRB 5C9JA 2W8CA 2FGWL 2FX9H 4RMUA 1VFOA 2GJ6D 3EJZC 4TS6A 1ESOA 4EUPG 1GPOH 1ORSB 5DZ9A 3GXDA 2FT6A 2W0KA 1CICD 2XY1A 2C1OA 2GSIA 4JR9H 3QBTB 3PAZA 5FFGA 1I8IA 1QPXA 5E6IC 3MLUH 4A7VA 1A4CA 2HG5A 5JXED 5BJTA 3QPQD 4ZD3H 1Q1JL 3G5XA 3NVQA 2X6AA 3QP3A 4N5UA 5IBUB 3RVTD 3W9DB 5BXFA 1UA6H 3GRWL 1XZ0A 3V4VH 5DHDA 4ACPA 4LP8A 1MVYA 1HHHA 5I1EL 1L9SA 3AUVA 1MJJA 1IGIL 2AQPA 4HJ0C 3PNWA 3STBA 3NH7H 4N8PA 5F7YC 1NCBH 1BECA 4YLCA 2QVFB 4NNPL 4HQQL 4KMTL 4XNQB 4H8WH 3LRMA 1LVEA 1A6VH 1WZAA 3QFGA 4NC2B 3N04A 5EU5B 5FB8A 2NXZD 4IJ3C 4Y4HB 2O5ZL 3BMVA 5C0BB 4OCXL 1GCYA 4NLHA 3WKQA 1JP5A 2XXFA 2ZPKH 4JZOA 3UP6A 2Z1PA 4N2EA 4S0HA 4X7SH 3G6JB 2X2UA 1FLTX 1WYJA 3ULSA 5JDJA 4GG8A 4WW1A 1URZA 4Y5YB 4WNQB 4D0BB 5DD0H 2MKWA 3DVIA 3RWJB 1KB9K 1SLVA 2FCBA 3QUXC 4NWTH 4PREA 1U33A 1VLXA 1TQUA 5BV7B 4QIRA 3ZGHA 1BZ7B 5GRXG 4AX3A 3HZYB 2R1YB 2HRGA 4GMSL 3RI5K 5HJGA 5KBPA 5KJRH 2A1WH 4P5TC 2EABA 2WQRA 4Z78A 4WEEA 5DT1H 4JKMA 2KUTA 3FBQA 4XRCA 1S2EA 5ADPH 1L6ZA 3VXSD 2RCSH 4YFDB 3GJFK 1JZEA 2P5WA 3S88L 4WK0B 1IBGL 2DRUA 2QADD 5TDPA 4ES8A 4L3EB 4UMSA 4YDIH 1Q9OB 2BNQA 3SBRA 4HS8H 2YXWA 4NPKA 1MWAA 1RJYB 2AV1A 2XTJD 4N0FB 1Q9WB 2I25N 3O11B 1S3KL 4N86A 5DF0A 2IWKA 1I3GL 2NY2B 5G4NA 1ACCA 5I26A 4UQCA 2CA4A 1ZHBB 2QFRA 3DGCR 4CC4C 1QZ1A 4Z7VE 5BZDB 1VADB 4JFDA 2HLAB 3OWRA 4MQXC 4G9DA 1MN4A 2R15A 4UDUB 1E4XL 4O5LH 3QWQB 3JUYA 2FWSA 5IB2B 2OMXA 5D7JC 2VDLH 3S96A 4DPAX 2ZX6A 2Y5TA 1DQDH 1CT8B 1IAII 2A2QT 4F5CA 3KXFB 4OJFL 4D8OA 1L9NA 4U1HA 2B39A 4PLKD 1VEOA 1X44A 5H2BB 1HEZB 3ZSTA 2VJ0A 2VSDA 2XQ0A 2FX7L 3AS1A 4Z7UA 5A40E 2EIZA 4XMPL 3TBWA 1P7KA 4P5TB 5GSVB 3W57A 1A6ZA 5C86A 2F58H 1GRWA 2OYPA 4AL8L 2H3NB 5HYSB 4RFNC 2X4TB 5D7SL 2HTLC 3EJRA 3GMOB 1VRSA 1PYWA 1N2RA 3GF8A 3P9MA 4NSKA 4N0UE 2XVGA 3QIWD 2VXQH 4HCIA 4D3CH 3D3VB 1MAJA 4WWKD 3K2KA 5IB4A 3H3BC 2WZPD