2LGNA

Lactococcin 972
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
EGTWQHGYGVSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactococcin 972
publication title Structure and properties of lactococcin 972 from Lactococcus lactis
rcsb
molecule tags Antimicrobial protein
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09683 Lactococcin_972 Bacteriocin (Lactococcin_972)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lgnA00
2LGNA
chains in the Genus database with same CATH superfamily
1ZHKA 2GC7C 3G6DH 1JF6A 4M02A 4TOYH 1JFHA 1MW0A 4LSVL 1XFPA 5JYMA 1YPZF 4BSWB 5JOFA 2XRAH 5JW4Q 4FQHB 1TXKA 3QPXH 2DLGA 2FL5B 1NDMA 4E42B 3PDDA 2XY1A 5AKTA 4EI6A 2G5BA 2V2TA 1E30A 4GAGH 3KPSE 4IKLA 5FA4A 2HA1A 1IC4L 2OTUB 5FGBA 4FLQA 2WZPD 1KYDA 4MS6A 1QPXA 2P43B 4PH8A 4Y2DA 3P02A 3HC0A 2X87A 3P3YA 2VABA 1E4KA 3CDCA 1GZQA 5CBAA 4L1BA 2YA0A 3O8XC 4PBVC 2IH3A 5D55A 2X28A 5DMJB 2PCXA 4CN4A 2D7QA 4PRID 3WD5H 5BCAA 3T0EA 1WD9A 1QSEA 3UZEC 2GSGB 1A7NH 2F9BT 2XG4B 3QORC 3ARDD 4H0IA 3TBSB 4PWGA 3ZMNA 4HA1A 3BHBA 3D39A 3EYFB 3MRIB 4W1TA 4NN6B 5BV7L 2G3ZA 1IGMH 2N59A 3CPLB 3PWNB 4ZMQA 2YBRB 4JHWL 1D6EA 2HSIA 4CJ1A 4AXWB 4KMQA 5L6YH 4JN2A 2V8MA 3QZWB 2EVFA 2QFRA 1CXKA 3C5ZB 2Q10A 3WE1A 3VXUA 3QUHA 3IF1A 5DQ9B 4WNSA 3H6AA 4LP5A 1YY8B 3QHZH 4MD0B 2OA9A 1G7MA 5FUCE 1OSPH 1YNLL 3H0TB 3VXRE 1CD0A 5GGQH 3NK3A 3VFGH 1NCBH 1A9EA 4GPVA 4AEHH 1WFJA 2Y1VA 4AJVA 4KXCA 4DHLA 3D3VB 5I1AA 3PP3H 3Q6FA 4OQTH 4UAOB 3GRGA 2NW3A 1QFWH 1MI5D 1U6AL 2ZOLB 3C2AH 1G4MA 3QQXA 2CDGB 1TPXC 4BFBD 1E5YA 3RYMA 4PGCA 3TIDA 3M7OA 3GSUA 4U1IA 4MA7H 5CSZB 3P0VL 1ASQA 4RAUA 3U1SH 5HI5D 2H32H 3HUJA 5ICXB 4MX7A 4PG2C 1E2ZA 4FEMA 4JG1L 4GNKB 1F56A 5K9JL 4LCCA 2ZXQA 5AW3B 5HDLA 4Z7QF 2YD7A 2ZG3A 5C0RH 3SYAA 5GRUL 5JDSA 4URKA 2BP5M 2K7QA 3SQRA 1OAKL 1DJIA 4CW1B 5FYLD 5AD0B 3I02B 2X41A 5DK2A 2XBDA 4MXQC 3QO0A 3TT3L 1OLLA 2C5DC 3DX3A 3PJSB 5GGVL 1AE6H 1IC7H 5TPWH 1L9MA 4EVNA 3J8F7 3GJFK 4OZFG 1OGAE 5SWZA 3REWA 1N5YH 1C5BH 3LN4A 3LYRA 3IJYB 4TUKL 4KKLD 3WY3A 2YN5A 4PRNA 2R4RH 2HYMA 3EJQA 1P7BA 1AI1H 1BYPA 4Y7MA 3VXSA 4UDUB 3CDZA 4ELKA 3BIBX 2YUWA 1FFPA 1JYWA 3NA9L 1EZUA 4K3DH 5T3XD 2CHWA 2HX8A 1Q94A 2GTZB 4JJOA 4N87A 1G1KA 4QDGA 1DSFL 4BH8A 4L48A 1DP0A 2OBGA 4W4OA 2X7LB 4UQ3A 3PY9A 4UU9A 3K8KA 3T3PE 4UIKH 5F0JB 1AZVA 3PS6A 2VR6A 4DQAA 4AOFA 1BFOA 1JDAA 1G7HB 1XZWA 3ME0A 4WNQA 5CU5A 2WLIB 4XNXL 5E8EB 1E6OL 3CU1A 1A7RH 5C3IA 4ERSH 1ZEAH 5DJAB 3UBXB 4FA7B 5JNYA 4OFYA 4PMFA 4U3HA 4ZO8A 1BAGA 4PJ8B 1ZA6A 4PJEB 3T0EE 1QSEE 2VITA 3AS3A 3KGTA 3O9WC 3KEHA 3RVWC 3DARA 5GHWL 2H4EA 2JJUA 1B0WA 3KCWA 4OM0H 3NFSH 1URIA 2B59A 3B9KA 3FB7A 2CBTA 2IQ9L 5D5MF 3SIKA 2CA3A 3MU3A 1LK3H 3VXOB 1QA9B 4ANKA 3CFBA 4HG4K 4LE8A 3G5VB 1RCYA 3K6FA 1GAFL 2B2XL 2VISA 2E6JA 1KTDB 1LP9A 3KAAA 3O11A 3U4EB 2WZAA 1A5FL 4J3OG 2X6UA 4G80A 3VXUE 4Y16B 1OAYH 3EJRA 4S1RL 2P52A 4M7ZB 1ZHNA 2C8NA 2FO4B 1YQVL 2A9ML 5TE7L 4BGDA 1YQ2A 5IW1B 3FRPB 1SXSA 4KKAC 3P4MB 2IBZX 1QSFD 4XVJL 1JGVL 3L95A 1JP5A 2BP0B 3QQDA 1A4AA 4PJ7B 2G0KA 1NCDH 4JW3A 1YDPB 1QBBA 1MAMH 3OQ3B 5E0FA 4OTXL 2JFCA 1SN5A 2A0LC 5HHOE 3TN0B 2F1EA 2ESVE 4RCAA 5ITBH 1TENA 1OF2A 2ZWLT 1DDHA 3MUJA 4XCCL 2DMCA 1CO1A 2XTJD 1N6UA 5IBUB 1G9NH 4KO6A 1HC1A 2H8PB 2R56H 2NCEA 4JFVA 1DBAL 3JT2A 4LLMA 4JFYB 4Z0BH 2J8HA 3U4KA 5I1CL 2WYZA 3W0WA 5JIKA 1G9MC 2F61A 2B3RA 1V7ML 3ZZLA 1RK1B 1AS8A 4XMXA 5C08E 1DBML 4K73A 3BDYL 4XNBA 1WYJA 4P2RD 2GJZB 1ITCA 4A2HA 2AQ2A 5DD3L 4XNZC 5I5IA 1T2QH 2W59A 1AXTL 4FQCL 3SDAC 4DH2A 2YLHA 4Q6IA 1N18A 3MRNA 3OR7A 4OLYL 5EEUA 5DJ8B 1N67A 5JQIB 3DVIA 4DGYL 1MNUL 1AHKA 2ILLA 3OAWA 3F7LA 2JK5A 3QIUA 3AJ7A 3IDYB 2X2YA 2XZZA 1MJ8L 5J3HC 3ETSA 5BS0D 1SOSA 3ZL2A 3B34A 1DQDL 5EZPA 2PABA 3DBXA 4K7PH 3SGJA 5I15L 1J0JA 1H5BB 1ZANH 4WJ5A 1UWYA 2IG2L 1KTLA 5JXAL 1H3PH 1LO2L 4JRYE 1RURL 5AWNL 4EBQH 5JHLL 2CIKB 1CI3M 3D50A 1KIQB 3PHOB 3I75A 5B1KA 4O02H 1RZPA 2EKSB 3IVKB 3L3KB 2DQGH 3IMTA 4NFCA 4P3CH 2JJSC 2XQYG 1LE5A 1MHCA 2NXYD 4GMTH 4U1LB 4AX3A 3RVTD 2NY3B 3C9NA 1G5AA 2VUYA 2VXVL 1MHHA 3PIQB 1MW1A 4MDJB 1TZIB 4PJ5A 5KSBF 5I75B 1E9QA 4H1LA 1FNLA 1BVZA 4PGDB 1MCLA 1SMAA 2WBXA 3M17B 4U1GC 3TLRA 1Y1DA 1R5WB 1L5GA 2R8SL 4QRTA 3MDJA 3BMWA 4XH2A 5IT2H 2RAMA 5D1ZA 1D3CA 1CFTA 1MJUH 2HWZL 1KGCE 4AVJA 3FT0A 4BHUA 2WNWA 2B1AH 4DKEH 2Z7ZA 3GXNA 3U2SB 4LU5L 3PXHA 5F9WC 3RY6C 4GKZA 4TSBL 3CK0H 5JZ7D 1CF8H 5EEZA 2WB1A 3L9BA 4WTWA 4NRZA 5FW6A 3FO1B 1H3GA 2ZONA 4I48A 2ZXEB 4P57A 4QXWA 4D7PA 2ZOOA 4I85A 5CEXA 4QXGL 3ZDZE 3UEZA 1D5ZB 5MP6L 3RZCA 4W9JC 4BWUA 1ODAA 1CU4H 1EO8L 5I0VA 5CCKH 3VDCA 2F19H 4L8CB 1RFDL 1A4KA 3MXWH 4A7VA 4Y2LA 2J21A 4JO3H 2ZNXA 4OW6A 4QCIB 3VRIA 4OZIE 5ADPL 1J1XH 4E5XG 3A67H 4XCFH 1GY1A 4PLNC 5AKRA 4DP2X 2XPYA 3C08L 4K23L 2PF6A 2ZYIA 4N20A 4ACTA 1B6DA 2ZOKA 5GS2H 1TTFA 1KCLA 3DOIA 1KJVB 4ZAKC 3O2DL 4GG6F 3BQVA 4KX7A 2WB7A 4U31A 4F7TA 3PGDB 1WAAA 2P5EA 4O2CB 5ALBH 4WI2A 1GZHC 3HFML 4YDIH 5DT1L 3AXLB 4RMSA 3CSYA 3IBOA 3KS0H 1RERA 3F7YB 4JKKA 1J5OL 5GJSL 5DC4B 3O6MH 1ZV9A 1HXYB 3BE1L 4NO0A 4C83A 2YAMA 3SDCC 1I8KB 4G9FA 1RSFA 2NY5H 2NZ9C 3K4DA 2X4SB 3QI9D 4IRSB 3KHQA 5DQDH 3QEHB 1FYTB 1SDDB 3B43A 5EU5A 4QRRB 3S35X 2Q3AA 1ACZA 3TPKA 1DEEA 2YPVL 3SPGA 3H9ZA 3HKZA 5I71C 5ABAA 1IM9D 4LLWA 3BQUD 1JHKL 2O6DA 5ETUB 3CN3A 3IFOA 3O45B 3S5LG 5DEGA 1F3JA 1PZ5B 2F53A 3JWDH 5FS5A 1MY7A 4MJJA 2J8UE 4GSDL 3WOVA 2IAND 4Z7AA 4GRLB 3PLYA 1I3GH 3DTXB 4OCLC 4ODHH 3U25A 1NC2B 2WXQA 3TA4D 4HEMA 3CHPA 3GBDA 3ZYOA 1MCKA 1YPZB 4NQEA 1HL5A 5I82A 3FCTA 5HGHB 3JV4B 1RJZB 3E2HC 3HR6A 3RPIA 5JXED 1MFDH 1UZ6F 1X3DA 3KJ6L 5FYKH 4N1HB 2AJSH 4FXGB 5TH2B 1HINL 1R75A 1A6ZB 2ZOUA 5EPMA 2ZKXA 4AKOA 4I4WA 3T6VA 3T0XA 1ED3B 2VE6A 2VSKB 1FZOB 2XV2A 1MRDH 2R83A 4HUMB 2BVOB 3FPXA 3FQUB 1FVCA 2RHEA 4WFHE 4J23A 1BXXA 4UDTB 4FLOA 3O6LL 2E9GA 1UATA 1SPDA 3IDGA 4EQ3A 2B20A 4P07A 3VG9C 1RI8A 4AZ8A 2EIKB 5C8JB 3R18A 4IMLB 5IHZB 3GMMA 4R9HA 1KLFB 3W3BA 5AW4B 3UACA 1SM3H 1YEKL 1RLWA 4TLTA 4OIFA 3MNWA 1H6TA 1NCHA 2PXYC 1AO7D 3MV8D 3QJUB 4YGVB 5B21A 3ZIYA 5J6GA 3ISYA 5EUKB 5FHAL 4HHAB 1K4CA 1U58A 3DLQR 2OKMA 3BVNA 3FKUS 2YD1A 3SE9H 5CLWA 5C07B 3B2XA 3RUGF 4L3EE 5JIQA 4HGMA 2GABA 4EN2A 4DK5A 4OF5A 2HTKD 3AITA 2R0KL 4NP4L 1U30A 3M88A 1LLAA 4LCIL 2A74B 4LEXL 1HL8A 4ABQA 2WSPA 4P2QA 1J0HA 1IVLA 1DYZA 3C5JB 2CLVA 4KZCA 1G0YR 1UB5A 5J8OA 3OKMA 3GBLA 1AMXA 1MLCB 2E86A 1Q9KB 2L7UA 2NSQA 4OCYH 1I1YB 3V0IA 3U46B 2X89A 1XSKA 3SOBH 4B9CA 4MJIB 1WAAE 2P5EE 1MFCL 1DL7H 5B7MA 3AROA 3VE0B 4YHLH 2AXWA 4YZFF 4DGIH 3FN0H 1RUAH 3V2AR 3GMOB 3HS0B 4MB1A 5PCYA 3IFNH 1OAQH 1TTUA 2OMXA 4OGZA 4OSUL 4FF9A 4XMLH 4KGJA 4QR7A 1N0LA 2BCKB 3CNKA 4ZS7L 3JTTA 1DJWA 2A9BA 2DQEL 3KYNA 4IW4C 1A14H 3GHBH 1OE2A 4TN9A 1ECYA 2APSA 4QAWA 5E8NA 4ODTL 1DN0B 4A2EA 4KK9D 2LHAA 5IB1A 3K81A 4KV5E 3A4AA 1EO7A 1ADWA 1NPNA 4RAVA 4WI8A 2IF7A 4AL8L 4GUQA 5BRZE 4EE2A 3FU7B 2QVMA 4FKEA 3ZTJH 4NPJA 4D9RD 1SUHA 4ABVA 1DQLH 1I75A 5I23A 5HHVH 4LLYA 5CEYB 4D3CL 4LF3B 3IETA 4ZW3A 2OMZA 1FGVL 3N1PC 3VXRD 5C09A 4YDLB 3H3PH 2E47A 2CO4A 5JHLA 4KGLA 2AGJL 1WFMA 4JFEB 4I3SH 5KYUA 2PTTB 4KY1L 4MVBD 2KQMA 2ATKB 2V8LA 5DK0B 3HNTL 2GPZA 3NACL 4YPGA 4HUVB 1VPOL 3EOAB 4PS7A 4M7KH 4M6OL 3IWUA 3QUYA 4PV9B 3DYOA 1ZVHA 2X9WA 3DHJA 3L5WB 3WLBB 3KXFB 4MQ7A 4L37A 3BAIA 3Q8BA 2VQ1A 4PRAB 3RTQA 2YSTA 4LLUB 2I85A 4QT5B 1MFAL 3WXWH 4EIZC 5FECB 5D5MB 1MCIA 2E6PA 1LO4L 1ND0B 3BSHA 4HWZA 1XCXA 3BAKA 5H35A 2VAJA 2DQTH 4ZPTA 1D9KB 5I8OL 2A9CA 1ZSDA 1T89C 3FYEB 3FUMA 1DQJB 5ID1A 3OMNB 5E4OA 4XP1H 3ZQ9A 4BFJA 3L3IB 3VWKB 1T1ZA 3AWGA 3O3AB 4IOIB 5E6RB 3U2JA 1JAEA 4KJPD 4QRUA 5TK4A 1KGYE 3FO9B 4WW2A 1DJXA 3T77B 3NFPB 2BOCA 4OF6A 4P2QE 1V7NH 2RCSH 3JV6A 2Z92A 1NKRA 1LK2A 4YDMA 5I1LA 4FFZL 5JUEL 1ZGLP 4OD3L 2N0KA 2ZSVB 2I7OA 5I75C 4IBTA 3RDTA 2DM3A 3II2A 5ESVA 2QFPA 3HEIB 3NA4A 4WWNA 4NKIL 4KMTL 4BK8A 1NLBL 1P1VA 5CGYC 3BXNA 4DKTA 3R06A 1YMMB 3ILPB 4Y2DD 3I2CH 2C3HA 1Z3GL 3UP1A 3ZX1A 2QEJA 5KVGH 2Z6FA 2CO7A 1QMUA 3T2NL 5ESQA 1J12A 2P24B 3Q1SL 2E3VA 4K8RD 5B3JF 1JG9A 3SKOB 3WG7B 4FQIL 3R1GL 3T0ED 1QSED 1BYOA 1H15A 3FO0H 3DPBB 5E2UH 4Y5VB 3S96B 3HE6B 3ZE1F 4XHQA 4J3SA 1KN2H 2LV4A 5TTRA 3ETTA 1NWOA 1X5XA 1MRFH 4R4ND 4UQ2A 3RWHA 2XJLA 2MJWA 4PJAA 5LGYA 1ZLWK 4K3JL 2VXQL 3L4XA 1XXDC 3EJTA 5GRYA 4FQXA 1DQKA 3BKJL 2UWEF 3KR3H 3OXSB 4I0PB 1P9MC 3NIGE 4JKPH 4G6FD 4OZHA 4MJ4A 3VXUD 5IUSA 3B2UC 3OZLA 3QPKA 5D1QA 2VDLL 2YKKA 5MEPB 3KL0A 4N2IA 4PD4J 2IDSA 5IP4A 5C09E 3X17A 4OV6F 2O5ZL 1FG9C 2OL3B 1SVZA 1NAKH 1SHXA 1ZVSA 5HGDA 3RWIA 2E75C 4MQXD 5LB1A 1Q0YL 5KSUA 1XF4B 1LXMA 3C60A 1IGJA 2D03L 4YDJA 5KSBB 3ULUE 1GTNA 2ESVD 2EDKA 3JTBA 3QJSB 2DQ6A 4MRCA 4ZOCA 1Q0XH 4OGQC 5GS0D 2R69A 3C75A 1AHMA 3QXTA 4X5LA 4M43L 2XWJB 1SXBA 1V27A 2OTWB 3QJXA 3IDNA 4FAAB 2Q0ZX 4EKXA 4DZBB 4ZZFA 3FQRB 5CD3B 4N0FB 4PRHA 1MH5B 1NGYB 2Y7MA 4N3TA 1OO2A 3DVGA 3F6LA 1ECZA 4HOZA 4DF9A 2BIHA 3D87B 3H55A 4UQ9A 3VWJB 3MA7B 1MJ7L 4L4VA 4KPHL 5DJZA 1NMAH 3EJYD 3UG5A 3IMVA 1CDUA 1S4IA 1HWGB 2HJLA 3MUY1 2XG5B 2IPUG 3RGVA 1PLGH 1KNOB 3A3YB 3SJVA 1EHLH 3TNNA 1C8QA 5I17B 1CFNB 2WW8A 3MCYA 5I76A 1I53A 4GAFB 3SGEH 3OAUL 1QPPA 1MY5A 1QR4A 4GRLC 4DKFL 5SWZD 4A2GA 2XVBA 2PYEB 3ZE2E 3HPLA 4PTUA 1TG8A 1CZ8L 2IADA 2B4CH 2XN9B 3QJFA 4FNRA 2LTQC 4H25A 4PCSA 3S3DB 4I2XA 4RMWA 4BZ2L 4ZFFA 3LIUA 4FQ1H 4JFOB 4OT1H 4AJ0A 5KJ4A 4Y1TA 1NEZB 3RWJA 4M4RA 4IBYA 4JFXA 2PN5A 4MKTA 5FOBB 4KKRA 4GG6B 1ZTXH 4O2FA 5TD4A 4YHKL 4XPAL 1NAMB 2CDEA 5LN4A 2OSLA 1JNHA 2X4RA 1PSKH 1NJ9B 5E9DA 3QFDA 2UY6B 7TAAA 2ITDB 3G08B 1VGEL 1ANUA 4OFYD 3EZJB 4Y5YA 3EGSA 5J0BA 1KLGA 5MERB 3BX7C 3JBG7 1U2HA 1FNFA 4JL2A 1T6BX 3HN8A 4LHUG 2YD8A 2YOCA 4PI0A 1HI6A 4HF5H 3K6NA 4Y19A 1T7YA 1PCSA 4AMKL 5F9DC 2A77H 1SZNA 2B39A 2OMTB 2R2BA 4WO4A 4DN3H 2J25A 1CGSH 3Q44A 1TCMA 3B9KD 4K94C 5F1IB 3QIBC 3NIFF 2FYVA 3V0VB 3VYPA 3T1WA 1DBJH 2BHYA 3HHSB 1FP5A 3RBGA 1CGYA 4ZPVA 5EBWA 2APTA 2RR3A 3VD9A 4U1SA 2GK2A 2GKIA 3KG5A 4LHUA 3CHQA 4LEBA 3WELA 1V55B 3QEGL 3N85H 2BCMA 3V52H 4EIBA 2HLAB 2EH7L 4ZFOL 1JZ2A 4WTZA 4PSPA 4QYAA 2Z3FA 1UKQA 3ESVF 5J9PA 3KYOA 4WGKA 3QDJE 1SYVB 3ZYZA 4M1GH 5EIQA 4YDZA 3THMH 4GO6B 1JGDA 3CVCA 1LM8V 1T2XA 1U91B 3PGCB 1AGCA 2FBOJ 4HSQA 4F7EA 1SJEB 4WF7A 1SBSL 1X5IA 3EFOA 5E6IA 4HD9A 3ZTEA 3FT9A 1F02I 2ROYA 1AR1C 2VLMD 3QIWA 4FFYH 4PJHA 4HOXA 4I89A 5EULV 2WXJA 2F8IA 4JZJA 4I3GA 1JGIA 4PJIA 3SDXF 3N1GC 4TNEA 3NTCL 1HHGB 3W0WD 2JI1A 2GAZB 3M6DA 2A4CA 4HKZA 1SJVA 2ZUYA 3ESUF 3CVHL 3H85A 4D0DA 3UL4A 3LY6A 5CJQH 1F5WA 4B7IA 2DD8L 5C0BB 4L4VE 1RXLA 1H3UA 2YKLH 1U8LA 1UWEH 2C3GA 3E6HA 2KHAA 1KACB 3PWPA 3RPKA 3BRFA 1HSAB 5IJKC 2QQLL 3SEPA 4ZMVA 4HIJA 2WBJA 4X80L 3L6FA 3HPJA 1S7SB 3ZR6A 3QIUD 1Z9SB 1NGXA 2JIXA 2YOAA 2HFFB 3GMNB 3ZTNH 1Q0EA 5C86A 5C9KA 4P5TB 1XB6A 3ML8A 3RUGB 2BSTB 3DHPA 3WS6A 2PWDA 4PJDF 1QBAA 2DQHL 4YBQC 1EK3A 3G3LA 2RFXA 1GOHA 4YXHH 3EJUA 4BZ1L 2FO8A 2XETA 5I74B 1JSYA 2DBLH 4OCXL 2BZDA 2B0SL 5AB1A 5TDPA 3CVIL 2QDWA 5DYOA 1JWUA 4K15A 3MRLA 5E0QA 1OE3A 2RALA 3JWNG 4QUOA 3LS4H 4JN1H 5KYXA 4HIHA 4K5MA 1A6WH 3O2WH 1WDAA 3QXDB 5I1EL 5EFIB 5EUOF 1I1FA 4FFZA 5I5JA 3D51A 4Q58C 1LO0L 2EDYA 1J05A 4XMUA 4WFFE 4KI1A 1P5UA 2NNAA 4N4YB 4YSAA 4S2SA 2AKRB 3DOSB 4X4ZA 3QC5X 4K3EH 1IGCH 4KH2A 5FYJH 1AQDA 4ZW7A 1NCWL 4Y4KA 4KTGA 2YPLB 2LT9A 3FH8A 1S46A 3OX8B 3QJTB 3OAYH 5J7CC 4WNJA 3V6OE 1MREL 4Y19E 2V7HA 3MJ8B 4QLRA 3MBXH 1D5IH 2V17H 2IXQB 5DMKA 1L3WA 4GUPA 1MFEL 1ZJAA 4BELD 3IFLL 4POUB 1VSCA 5LG6A 5TF1H 3FTSA 3LEYL 3KM1A 1DANU 1T1WA 3MFGB 4YXKH 4W81A 1NBZA 4LAQL 4QOKA 5JPMC 2NNRA 4WEBL 4OD1H 1RZIB 3RZCD 3GF8A 15C8H 2XZAL 3LNDA 3GSWB 3D85D 2NLJB 4JVPA 2YRLA 3OLIA 3KWWA 1F4HA 4G7YL 3U9UB 1M7XA 2AXHA 4PRIB 3VX0A 4NZRL 2NQCA 1ULVA 4PVNA 4UT9H 3ARDB 3GI8H 3VFRB 1JZDC 4NRXB 5GZNC 1LO5B 1L7IH 3QXWA 2HUHA 3GXTA 5F0PB 3BUYA 4YUEL 3UGEA 2GUOA 3HS9A 4PJHE 5TQ0H 4BUGA 1BZ7B 3MODL 2P5ED 3D6GA 2F54B 1P6FA 2NX5A 2N3JA 3FFCA 3H3KA 4JQIL 3IAGC 3EGDA 3DJRA 2Z31A 1KGUA 2BSRA 3G6JE 1OTTC 3GXUB 4IKKA 2X4TA 5HD8C 5C0DB 2PO6A 3N91A 4NO0D 2EQDA 1MHEA 4PUBH 2XCMC 3DGGB 4XNUH 3G5YA 1DVFA 5H94B 1BV8A 2BWDA 1VCBC 1NFIB 4PG9A 4DJMA 5KVMC 2COVD 2DL9A 3OKDA 1YMHA 4NNXA 1T83C 1M56B 3APFA 4HJ0D 2WLHA 2IALB 3D48R 1MW3A 4A55A 1MFBH 3HE7C 3L4VA 4XGZA 1LHZA 1MI5B 4LMQI 2EUWA 2NUTB 5HVHC 4PS3A 5IQOA 2F53D 4AJWA 4NERA 5BRZD 2VLJE 4LPTA 3CN4A 3GSRB 1CR9L 5MEOB 2O93L 5EOQH 4ORGB 2WLMA 1F6LL 1QWHA 4NENB 4U6VL 3KWTA 4P5MB 2OFQA 4NQDA 4ZK8A 4BZ2A 4PREB 3SD5A 3MRRB 4P9HC 3LRSA 1XH0A 1JNNH 4NQED 2BHFA 3D2TA 1F4AA 1J86A 4ZI8A 5I0YA 4RMVA 4YHNB 2VZ1A 4R3SA 1MXGA 2QDVA 3X13A 3A5VA 3FBQA 3X3FL 4FFTA 3RURA 5FGCB 5ABZA 1AGEB 2OYMA 2ZWNA 5E4AA 3BPLB 4H2CA 4GUCA 5IBLD 5DJ0A 1A1NA 3IJEB 2F2HA 3BIKB 1U0QA 4DGVL 3S37L 4YOKA 4X0NA 5DVNA 5B1BB 1H6EA 5IVZB 1JPGB 2CLRA 1AHWC 4M6AA 3MUGA 3ZE1B 1KBKA 3UYPB 2XICA 3AU1A 2XQYK 3OMZA 4NBYB 3VGEA 4OFQA 1DUZB 2NZ1A 3RNQA 3ZL1A 2W0FA 1P4UA 1ET5A 4QF1B 2OX5B 3JWOC 3O3EA 2Q6WB 3MGOA 4QOKE 4CSSA 1JOIA 3UTTA 1NTDA 1GJIA 4FULA 2R23A 4GLRH 2BP8A 3CZUB 4PD4K 4U6HA 5CFAA 3RQ3A 2DQJL 2ZUQC 3UXFA 3Q13A 4N8VA 5KS9E 5D93C 4L18A 5IVOA 5AG8A 3F64A 5K39B 5AEAA 2NY4D 1HQ4A 1I7ZA 3HG2A 1XD0A 4ZFOA 5CHNB 4F3FA 3MLTB 2BRQA 4XCNA 5IMOA 3M1BB 3CXDH 2R0LH 3V4PL 4P2QD 1F11B 1G7IB 4M6ML 4W6YB 3WTXA 3GI9L 2P9RA 2X89D 2LLLA 1QO3A 25C8L 2BY0A 4OGXH 1IZKA 2JJVA 1ETB1 5L88L 1JN6A 2NX5E 4HDIA 5JW4M 2YHGA 3DI3B 4B0MB 2A38A 1PNCA 3SE3A 2OJEB 4XVUC 4RETB 4ZUVB 5EU6E 3KPMA 4BQ6A 4PJ6A 3K3QA 2CGZA 3VI3A 5KSAD 2KL6A 3BN3B 3CVHA 4LSQL 2PPDA 2PWHA 3A4EA 5DRXB 1ZLUK 1QSFB 1WE5A 4RMUA 1IFHH 4UZGA 4LZKA 2VJ8A 4KJWC 3GO1H 4YVUA 1F3DH 5DVOA 4ZUTA 2ICWB 4DK6A 4GI8A 4Y7OC 1YN7B 3ULUC 3S37X 1QLEB 3ECWA 4MAUH 1PG7L 4YSUA 4AK2A 3K6IA 5EIIG 1Q38A 1S7WB 4WY7H 2XTJB 1WFUA 3Q48A 3CLEH 4PY7B 4WGVB 2BERA 3LNEA 3QRFM 2Z65C 4HUXB 5A3ID 5I9QB 1VERA 4PJXA 1TZ8A 4XPBH 1KIPB 5LXVA 2EC9T 5FM4A 5AVTB 2ZYRA 5TDOB 1INDH 3MRGB 3V9CA 1MCWM 4P2RB 1KJ2B 2FWLB 1T04B 2VZSA 5DEZA 5C09D 4N1EA 2JB5L 4BH7A 4FHJA 4BZ1A 1E4WH 4ODWA 4BUQA 3D12B 5C0EA 2NY1D 1CTOA 1HDMB 4ZFZA 4TQEL 4F93B 3HJ0A 5EOCH 4HJ1A 1R24B 3DJZA 1NM4A 3ZUNC 3CLFH 4MS8D 1T7ZA 1JXKA 1HQRB 4Z0XB 4EN3A 3CH8A 5AW6B 3G6DL 4XTRC 4EO5A 1ORQA 1TCRA 5BS0B 3FOLA 1EAJA 3QUYD 3FRUA 5I2IA 1QTYT 5D2NB 3U6XS 4PMEA 3P4OB 3VXPB 4ZTPL 1F4YL 2AVGA 4RSVA 4JCLA 4Z76A 2ZKHL 3ILQD 2A99A 3RTQD 1T2JA 4GAGL 1HKLL 4KKQA 2YD9A 5F7EH 5BZWB 3IJ8A 4HC1H 1JUFB 3NIFB 5DD0H 5IHUL 5GSVB 4R7VA 3X12B 2WXKA 3QJHB 5D2LA 1I4FA 2J88H 3BRGC 1GC1H 4HH8A 4JZOA 2Q87A 4R90H 2NXYB 3UTTE 1QFPA 4KQ4H 4BSVB 4DVBA 1P84K 1J1PL 1A4BA 4X50A 4OLVH 4N2LA 3GM8A 2OPCA 2JKRM 5MI0C 3O6KL 3UC0H 3W9EA 1VFMA 5I1GH 2DV6A 1I85A 1K4DA 4XP5L 5HPOA 2BIQA 3GTTA 4NKOA 2AV7B 1AS7A 1IGML 1CXHA 3EDFA 4HCRL 5AW0B 5HDOA 1U3ZA 2GHZA 1PG7X 2XKNA 3WIHH 5DQJA 3H9SA 43CAA 4PHXA 1PQZA 1T0NA 2HRGA 1QW9A 3BUBA 1MCHA 3BP5A 2YD2A 4ODXB 2GEQA 3NH7H 2XKSA 1AXIB 3BFOA 4QY8A 1WCBB 3X3GH 1NFAA 43C9A 1C12B 1E9PA 2DIAA 4AEHL 1JYVA 4L8SA 4OF7A 3IDMA 4NC0B 4Y4HC 4YR6A 3DX1A 2W95A 2UUDH 4LCWE 3CVBA 1CD1A 4JQIA 3MX0B 1QFWL 3GFUA 5FM5O 3DSNB 3TZVC 2XWTB 2CLZA 4QYOA 2WO3B 3C2AL 5FKAA 1A6TB 4WI6A 1OPOA 2EDEA 4MMXA 5B1JA 4DEWA 3VFSB 3PAYA 3JZYA 3KJ4C 4MA7L 3U1SL 4N26A 1AR2A 1U93B 3CSBA 3UCQA 4HIPA 4F15B 35C8H 2XNAA 5L2KA 1ZE3C 1TR7A 5FF6A 4ZD3H 4JDZB 4PJDB 3RJDA 5T5FH 4FQXD 4NJ9H 1GCYA 1DQMH 1JPFB 1DLFH 5HHNB 2EH8H 4JJHA 2UZYB 1BJ1H 3RL1B 2H0PA 1UTDA 5B39A 1KELL 1UG9A 1URLA 3QNXA 5H2BA 2YMTA 3QI9B 3VVWA 1OGPA 2WY3B 1AE6L 5TPWL 3R0NA 3M1OA 3VGGA 3QDJD 3EKCA 5EUOB 1N5YL 1C5BL 1FBIH 2W60A 1JZ8A 1WIOA 1S78C 3C60D 3WAJA 5JIMA 1IM9B 1SVCP 3BQUB 4BKTC 2CUMA 1S8DA 1Y0LB 2Y23A 3CZFB 4TUOA 4XVSH 1IEAB 2QPUA 2M8XA 3K0WA 1BVNP 1V54B 4CL7A 2EDOA 3BLKA 2IANB 4N0UB 4D0BB 3FUNA 1LP9F 3FCBA 3EDDA 1U8IB 3BLPX 1M7IB 2ZOTA 3BPOB 3R4RA 4GW4B 4PRHD 4U2YA 3ZIMA 4UIKL 4FTDA 1MCSA 5AAMA 1NA8A 3M8OH 3LD8B 1BX2A 1ORSB 4JHAH 4L4VD 3JVGA 4FNPA 4LMQE 5E99H 1QFWI 1ZEAL 3W11C 3FBKA 3CFKB 4WDIA 2E9WA 1IKNC 3RGVD 1S5HB 4OD2B 3L3JB 3HAEG 1UACH 4TNGA 4M3JA 1NUDA 3G6AB 1CLOH 4NXKA 3VNYA 4GAJH 5GS1C 2QKIC 3CFDB 5CGTA 1TTCA 2AJZB 1ZKAA 2ADYA 2E4TA 4QAMB 4R7NA 2ENPA 3QRGH 1SJHA 1LK3L 3HRZC 3C8KA 3ZQWA 4RGMB 1CXEA 1CFSA 1EHAA 5TGBA 3BRDA 1R4XA 3UADA 4MB3A 3BISA 3EOBB 3QNZB 1F45A 1CDYA 2DL2A 3B56A 3B7UX 4RGOH 1Z66A 2WAHA 2X53A 3NGBB 3D0AA 3ETBF 1AO7B 3MV8B 4PVMA 4MA3B 5A2BA 2V5YA 1NDGB 5T1JA 3NFNB 5F6HJ 4A67A 4Z3FA 1P7KB 2HJFB 1JFQH 1MAML 4WFFD 3US9A 4NIKB 3BVTA 4IBWA 4P5SA 2FYYA 1SXCA 1H6FA 2G2RA 3SE4C 1M6OA 3BDXA 1FE8H 2QVIA 3LTVA 5AVSB 2GITA 4MSWB 3RWDA 3RWFA 4OKVB 4WI3A 4Y19D 3DJ9A 3OR6A 1G9NL 4ZMPA 4Z0BL 4D8PA 2R56L 3K5RA 3KPLB 5DFVC 4OUUB 2PCPA 4WO4D 4Y2NA 3WMQA 2XJKA 3B83A 4FOMA 4LOEA 3GBMH 4TRPL 5JA8B 1G7LA 3TBWB 5IJVB 5L2KE 2AXFB 5CSGA 4TNVF 4I0KA 1UZ8B 1CT8A 2HG5A 2JSFA 4IKIA 5BVJB 5D9SA 3B4NA 2NY7L 1D7FA 4JVWA 1G7JB 2D7NA 1SEQH 1T2QL 3MLSL 1KXVC 3W2DL 2ZSWA 3A4FA 3VD0A 3S6CA 1WHPA 5C3TA 4ETQA 2K6YA 1ZT4A 2Z4QA 4JFQA 1SXNA 1EA9C 1B2YA 3STZA 3BWZA 3O3DB 4MCZA 3ZQXA 4IBSA 2DDQL 1E28B 4QO1B 4WHTA 4M9OA 1UXWA 3CDGB 4K7PL 3WMSA 1ZANL 1PKQA 5CZRA 3U79A 2X1PA 3TA3C 2EXTA 1H3PL 1Z7JA 4GT7A 3QIWD 2IMNA 2VXUL 1H8NA 4EBQL 1TKWA 1XAUA 1T4KA 4IIQA 3B37A 3KDMB 3V7AE 4O02L 4OVUA 3LIZL 5IHHA 2VMJA 3UPRB 2DQGL 4I87A 4P3CL 1BQHG 1O9WA 1PAZA 3VMOA 5JO5A 5EO9A 1KJ2H 2CD0A 4LXFA 1YYML 5T1DH 3H53A 3G5XB 5KBKA 3MNZB 4FERA 2K3TA 2PTUA 5AZEL 1Z9PA 3ORJA 4IRJA 1A1OA 2MTAA 2X2UA 3VXRB 2VNCA 5FO7B 3TCTA 1P4IH 1TMCB 2XYBA 2CRYA 2EIZB 2DI8A 3OV6A 1PPIA 4CVZB 2WBJD 5I1JL 1DE4B 1MJUL 2JIXD 2HRLA 3AREA 4NAMA 2B1AL 2EDLA 1C7TA 2ZKMX 3DYPA 1NSNH 1FCCA 1U9KA 3OVUB 4H20L 1WAAF 1ZXKA 2VLJD 3BZ4B 3CK0L 3CIAA 3PAZA 1CF8L 3DUUA 5EOTA 4FQPA 3FQNA 5AOZA 1CB4A 1JERA 5CGBA 2DWEA 3RWCA 1JMZA 1FORL 4S0SD 4HCRA 5LXGH 1M2VA 2Q86B 4YPJA 1UT1A 3STLA 2IPUK 1NUGA 4Q7DA 3MOAH 2W91A 3RIKA 5ANMA 3GS7A 3MXWL 2X09A 2AJUH 2EECA 5EF2A 1OSZA 2VDRH 3RP1A 1T7XA 2RQ8A 2DQUH 2EACA 2X3CA 2YN3A 3ARQA 3H7BB 1MHPL 1TQCC 2IDCA 1FJ1B 3E9UA 3FONA 1E0OB 1EX0A 5IOPB 2VR3A 2AS5M 4X7SH 1KBBA 2X0WA 2CO1A 4KV5F 4Y4KD 1GOFA 4LOVA 4K7PX 3QDMA 2UZIH 3HC2A 3H56A 4L8BA 1XCWA 2WINB 2C7UA 3FHQA 4OQTA 3V4VH 2Z93B 4OIIL 1ZHKB 2H0FA 4R7DA 5ALBL 3U36B 3NCWA 3LB6D 4JB9H 3TYFA 3QDHA 4YEFA 2FAUA 3MBEC 1QBMH 2PWFA 4K9JA 4NNPL 5JOFB 1WD8A 4GEIA 2MMXA 4TL4A 5A2AA 3RAJH 1NDMB 3T2OA 4B3EA 2H32A 4EI6B 4QOKD 3PXLA 1CJYA 2NY5L 1IAIM 4IGBA 4KRPB 1VCAA 1UA6H 1KLUA 2EILB 3HI6L 5E6ZA 5FA4B 5IW6A 5J11B 3WFEL 1NIBA 2GIYA 1LD9A 3AC0A 2DS4A 3IPBA 4Y2DB 2I9LA 3O0RH 3RLSA 2VABB 1GZQB 5CBAB 3ZSTA 4AW4A 2IH3B 2CK2A 3C8HA 4X8GA 5DLMH 1S9WA 3ISWA 1WZ1L 1QSEB 2H2PD 3T0EB 3ULVC 1GW0A 1NMCC 3NCFB 1YA5A 3GJEA 1VA9A 3O3BA 2AANA 4KROC 1BHGA 3AM8A 3HG1E 4ODHL 1I3GL 2WTRB 3BHBB 2ZKWA 3US0A 2WXMA 2J44A 3D4ZA 4XMTA 2VLLB 2PYFA 2HX7A 1D6EB 5IQMA 4QTHB 2UVEA 3QXUA 1MFDL 1VFBA 2NX5D 3FFCD 3HNSH 4JN2B 5FYKL 1FFQA 1TJHH 1FI8C 5F0MB 3RFZC 1FIGH 1IBHA 2Z31D 3VXUB 4G6FB 7PAZA 2L3BA 4UI2A 1KULA 4WHDA 3IF1B 5SWQA 1KYUA 2PO6D 3QXAA 1CGTA 3ULAB 3K4ZA 1G7MB 1DVFD 2BY3A 1GR7A 4UCFA 1Y07A 3HG0A 3NN8B 4AYID 1VLXA 2X4UA 1MRDL 3MRKB 3ARGA 2K4AA 4AGPA 3Q6FB 4OLZL 2BC4A 2K6WA 3KBPA 4PVLA 2XIBA 1J1OH 3ZPDA 1CDIA 1UWXK 2CKBB 4AEEA 1OARH 4MJ6A 5F3FA 4KK6C 1UXMA 2BVEA 1QHQA 2ESVB 1B0IA 4GINA 2QTEA 4WI5A 3JYBA 4QNPE 1PY4A 4PGCB 3WFDL 3TIDB 4TQ8A 3GSUB 4U1IB 2GJ6E 1RPKA 1FNSH 1SM3L 2OXHA 3J2PA 3BVVA 3MLVL 3QBTB 4JANA 4MX7B 3QI9C 3VW3H 1L3NA 5IQ7H 5DZVA 1FL6A 4NQDD 3DV4A 1YEFH 4IRZH 4LCCB 2C4FU 5DFWH 3UAJC 3EJPA 4URTB 2O6FA 3GRWH 4PS8A 3T4AC 2Y9RT 4ZMYA 5JDSB 1UM5H 5K69A 4ZMNA 4OFPA 3B5GA 4G72B 4AM0A 2AEOA 4HIQA 2VDMH 5EH1A 5DK2B 5D1XC 3ABZA 2VR8A 4JM2B 2OM5A 3PWLA 3QO0B 5FV1L 2EYTA 5L9DH 1BMWA 5HHPA 3LKPA 5SWZB 3REWB 3NZ8A 1DFBH 4KZ0A 3LN4B 3T5WA 1AG0A 3SOBL 2WYTA 4CMMA 2IPKA 4DKAA 3BFWA 2N7AA 4K9EC 2EDWA 1NCAL 3CDZB 3TCXA 5J12B 2VN7A 5E00A 4UYPA 1FFPB 1JPTH 4PBXA 4JPVH 4DGIL 2I5YL 1IGYB 3X11A 1NFDE 2H1PH 1Q94B 3L4WA 4P23C 4UILH 3QG7L 3F12A 5L0QC 1OAQL 4UQ3B 2EZ0C 1BF8A 4ELDA 3MV01 3UTTD 2CH8A 4AQ8A 1GRWA 4XMLL 1BFOB 4PLJD 3ME0B 4WNQB 2VDKL 1F6AA 1ZY9A 4NAQA 1A14L 2YD0A 4GRMA 2I24N 3GHBL 4IJ3B 3RKDD 1GGUA 4AM0Q 5JNYB 4RGMC 1T6VN 4XPTL 2W80C 4GAYB 2XFXA 2Y7OA 4LRIA 4POZD 1ZA6B 2P5WE 1ZXQA 4V2CB 4EPSA 1B0GA 2VITB 4WW1A 4ES9A 2WMPA 2YXVA 2D9CA 4YXLH 4RRPG 5C0GB 1MQKL 4J4PC 1X9QA 2XV0A 5CP7A 2VB5A 1FL3A 2XU9A 4QXUL 4QKXB 2B59B 2FEEL 3B9KB 3FB7B 4OQ1A 1DQLL 3BP4B 1GGTA 5HHVL 4HS8L 2NRDA 1UJ3B 3CFBB 3SPVA 4GXFA 4YSSA 3RVVD 1R47A 3IXAA 2FR4A 2EUXA 2VISB 1SY6L 4NIYE 3H3PL 3ZDZB 1LP9B 3O11B 3ZT7A 4AYGA 1BLIA 1X5JA 4G80B 5HTSA 1HEZA 3FU3A 3I84A 4O02A 3I50H 1GYAA 2WXRA 2IWGA 4X9IA 3LSOA 4TVSa 5SV4A 1RH8A 4V33A 1WVZA 3ZE2F 2WHVA 5HHME 4D7BA 4N2KA 1E7UA 1J0YA 4NKDA 4WW2F 3G5ZA 3LNFA 4GKOA 4HBQA 3HNVL 4FMKA 2EINB 5E24E 1HXMA 4J6RH 4HBCL 4OAWA 5BZZA 5B3NA 2QJDA 2KQNA 1T0OA 1DLHB 1U8KA 1OF2B 3PWUA 1DDHB 4WJG3 1A3QA 1DEDA 2JKWA 4HAGA 3WXWL 2XN2A 4LLMB 4TLSA 3W0WB 2MOQA 2FJGA 4HLZG 3P0GB 2BVYA 1N12A 2PR9A 3K2IA 4Y0GA 3JTSA 2WJ5A 3UYRH 2P49B 1WFTA 3KWVA 2EO9A 1WWWX 1SDYA 1KTCA 2XXFA 4YBLC 1A7BA 2X2HA 5EC2A 3UPAA 2YR3A 5SWSE 1O9ZA 4N28A 4CJ0A 1MCJA 1KXTB 3MRNB 3OR7B 4Q6IB 2CR0A 5HYEA 2Z1KA 3BP6A 4NLAA 1BCIA 5F21B 4NJAH 5C0CA 5CP3H 1WICA 3ILDA 3AMKA 1OY3B 2JK5B 1DTUA 3QIUB 4HSCX 2B1HH 4Y4FA 3ET9F 3AY4A 3P9WB 3QZWG 4DESA 1P4BL 2FEEI 4NSKA 2XG4A 2RCSL 2ZOWA 4P4KC 4PJAF 5L2JB 2JF1A 1UADC 3DBXB 3RY5A 2ITCA 4WJ5B 3CPLA 1J8HE 2OMUA 3WNJA 3WAKA 3U0WL 3GDBA 2XTLA 4YE4H 4OZHF 4RFOH 2Q8BH 1EBPA 5FA3B 4AXWA 5D7JA 3L13A 1BJ1J 2MPAH 3ZU8A 3OG4B 4J8RA 4XNDA 1INEH 3QFJA 1ETJA 1BYNA 4HPOH 1MHCB 2WQWA 4XNMB 5DQ9A 4V1DA 1YY8A 3DX7A 2O30A 1MHHB 2F5BH 4JFFE 4A68A 3TEZA 4NZFA 5B1CA 3MREA 3MSPA 3PP4L 4PB0H 2I25N 4G6JL 3WMPA 1JZ4A 1E9QB 2MEJB 3FO0L 1N4XH 4H1LB 1QRNE 1DBKH 5E2UL 4HJTA 3EBHA 5BNXD 1KN2L 3B8SA 1WBZA 1RJLB 2MQ0A 3P11H 4QRTB 3HG4A 3SCMA 1MRFL 4BA0A 4J39A 3AQDA 2Y22A 3CX5J 1EZVX 2ZD0A 1FVDA 1ONQA 1DQQA 3H9SD 2FWOA 3K6DA 1JK9B 4G6ML 2C4XA 5LAXA 3POHA 1M7UA 1QPKA 2QPEB 1WTLA 3CFTA 3VFTA 4GKZB 1RZGA 3L4CA 4JKPL 4FCHA 2FBJL 5AKSA 4LPCA 4OFVA 1QI4A 4M8QA 4P57B 2IAMA 1HHJA 5CEXB 2V7NB 3O4LA 4GI6A 5BV7B 5FO8A 2ZTBA 1NAKL 4M3HA 4NCDA 1TIUA 4HK3J 3D85B 1A4KB 1I8UA 3NVQA 4I9XA 3I02A 4R96A 3VRIB 2VMEA 4L3EB 1TZGL 3UPCA 1Q0XL 1XR9A 3OLEA 5FUOL 2W0LA 2Y07H 4FP8H 3A6BL 3QJVB 2DTSA 2MNJB 3MZGB 4PW4A 5F7YC 5ENWA 2ZOKB 3OWEA 1U8MA 4GW1A 4LAJH 1Q9OA 2EDJA 4ZQKA 3V0HA 5L2KD 4F7TB 3FT2B 1KF9B 3IT8D 3AB0C 2P5EB 3CSPA 4N8CH 3UBXG 1J5IA 5DSCA 1FAIH 1NMAL 2JCCE 5EZOH 2XWBB 1E4KC 2GTZA 3CSYB 3DO7A 4HUWA 2VO5A 4K8RC 4Z23A 1PLGL 1XMWA 2X7LA 9PCYA 1EHLL 4RMRA 2OSXA 3TONA 1IE5A 4JQVC 3DJTA 3BKYH 4L4TE 5K9QG 3AS1A 5BVPH 1CD8A 5EU5B 5DJAA 4IOFC 1DEEB 3HI1A 2CKBH 2CM5A 4U1HA 4LBEA 4LLWB 4OT1L 5DJCA 4UOW0 5GS0H 3LJ3A 1CLYH 1A0QH 3IFOB 5DEGB 1F3JB 2F53B 4CGUB 2DEXX 1JS4A 4Z7NE 5BRZB 4N24A 2ZXAA 1A9VA 2OZ4L 2IMMA 2VT0A 4MHHG 1ZTXL 3WCYA 3KYKH 1I7UA 3A6CH 4FNSA 1CDBA 2M26A 2AZAA 3FRPG 4WKXA 2XIDA 1J8KA 4M5ZH 3B9VA 4BUHA 3BVDB 4NQEB 2LFEA 1U21A 3FCTB 3TC9A 4HWBH 1E27B 5HYFA 3V4UH 3EJCA 4LL1A 3FCGA 3QFJE 3CZEA 2QVTA 2AEQH 4Y16A 2EDRA 5CUSH 1M4KA 1XXFC 2E27H 1Z9MA 5J57B 1MJJA 4MA1C 2X4QA 5EPMB 4IIZA 2O61A 4P2OA 4I4WB 2LLGA 5E2TH 2BP0A 3CZJA 2YAOA 4DN3L 3QRLA 4JM4H 2VE6B 2OMVA 4PJHF 4F7MA 1E40A 3N0PB 1CGSL 3E1ZA 3MN8A 1IBGL 2MQ3A 4Z77A 2XXGA 1FVCB 5CJ8A 3MLXL 4MCNA 4UIMB 3LCYA 3OD3A 5EU3A 2HKAA 4DAGH 4KMLB 1BMZA 4A63A 4Z6AT 3IDGB 4HMDA 3MTXA 4HQQH 3HN5A 2IGFH 4JO4H 4AZ8B 1XSIA 2O6EA 3GMMB 5IR1B 4DT2A 3QT2A 4PRDA 5EF3A 3ZRCC 4KDTC 3V52L 2D3NA 4HX1B 3SGEI 1RK1A 3GKWH 3I9PA 1NIDA 3O4LE 3MNWB 3WY2A 1KPUA 4L9LA 5J6GB 2Y1YA 1J8RA 1XMEB 3RIFF 4WZ9A 3R4DA 4M1GL 1K4CB 2F5AH 2VDQL 1IBZA 4P5KA 2CPCA 4XHJC 5FYKE 3BVNB 4A39A 3IM1A 3CIQA 3MXVH 5J89A 1HNFA 5T5NG 3KH4A 2NY4B 4FG0A 3LDBC 1TQWA 4G8AC 4UBDD 4HJJH 4FFYL 4P9ML 3VGAB 2J5WA 3SGDI 3UJTH 4CC4C 4G6KH 1F90L 4P2QB 4RX4A 1UVQB 2CLVB 2G2PA 1UB5B 2HN7A 3RHWF 3OKMB 3CGTA 4HPHA 2XN1A 4CRPA 2BIPA 3QDGA 4LDCA 5CJQL 5DMGD 3N04A 4PN6A 2GBUA 4MLIA 1KIQA 3C6SA 4PWKA 1VF5C 5KW9H 1UWEL 3LMJL 3IVKA 3DJSA 1PZBA 5KYNA 1JTOA 1USQA 4BFFA 2WP3T 4JO1H 4M5SA 2OMXB 3CFNA 4IMKA 5KSAB 3DK2A 4N5ED 5FV2A 3CSTA 2ZZUT 3ZTNL 2BSBA 3D2UA 3JTTB 4PGDA 5E4EB 5CO1A 5HGAA 5EZJA 1R5WA 1MF2H 2XZQL 5AYUH 3VQ1C 3KVQA 5EBMA 1S6NA 4XX1E 3TOPA 3IDXH 5IB1B 4EDWH 4YXHL 8CGTA 4RAVB 2DBLL 5IGXL 2QGCA 3U2SA 4MNQE 5JOPE 2NY6C 4W9EC 3OKOA 4XC1H 2DW5A 1A6WL 5INDB 4ENED 1E7VA 3IETB 1MZZA 1OZUA 4IRJD 3TU6A 1D5ZA 1KV7A 2OMZB 2WWKO 5C09B 4QHKI 2GJPA 4J3OC 1BAFH 2NY1B 5FYJL 4TSAH 4XN1A 1RJCA 3C6LA 3W82A 1U8HA 3OC5A 1OTSD 5KYUB 1TETL 3ZGHA 3QCUH 5HI4C 1IBYA 3D30A 2J2ZA 3DKHA 4YPGB 1JYNA 1HAWA 3V6BR 1DQVA 1YYLL 3ARED 3QR2A 2KC0A 5BOJA 2N7BA 3T8VA 3TO2A 3NSYA 3D69A 3QUYB 1Y6MR 3K71B 2OCJA 1YEGH 2LU5A 3ERXA 3VQMA 4G8FA 3QAZB 2H1LM 1ZTMA 4MQ7B 3DRTB 4L37B 4ZODA 2C1PA 2VQ1B 4YXKL 1W80A 3RTQB 1WP6A 1X5KA 1XHHA 1ZRUA 3BZFA 3PGDA 3UZVA 4IBQA 1YY9D 2OLDA 3G7TA 3WE6B 4Q6IC 4U3SB 3ZHLA 5F6HI 4KTDH 1VZIA 4ANVA 1KXQA 1QZNA 2XX0A 1XF2A 5DHXB 1KIRB 3QIUC 3PQYA 1MFVA 1YEDA 4HWZB 5H35B 3FSOA 3OB0H 1I8KA 3VRLF 4PJ9C 3C09B 2NNCA 1HZLA 3QEHA 1ZSDB 5JIPA 4GRWH 3JXAA 4QRRA 3ARRA 4UT9L 3GI8L 3AQXA 5ID1B 3OF6A 1I9RH 2DH2A 2ED9A 2PKDA 4MZIA 3QDMD 3ARFC 3ZE2B 2B15A 3FCSB 2BVPA 1E65A 5CFHA 1GS6X 4UV7H 2DWSA 3PHAA 4WW2B 4H13C 4AGLA 2RH0A 5GGTH 2BOCB 4ALAC 2IWFA 1YRKA 2ITEA 2VLRA 4GP5B 4HALA 3JV6B 3QDGE 2Z92B 1NC2A 4XN5A 4LSRL 4Q9RL 5BV7H 5LQBH 4XNUL 4JHWH 3U48A 4G8EA 4P2YA 1SFHA 1RJZA 3VSVA 3VCLB 4AITA 3NZUA 3AW5A 3BXNB 2OS7A 3R06B 1UKTA 5SX5K 5D1ZC 1MFBL 4FXGA 2CO7B 3BGAA 3LX9A 2W1NA 4FG2A 1VFOA 4LNVA 3COOA 3DC0A 4FQ2L 3IE4A 2EEFA 1H15B 1RUQH 1ED3A 4C4KO 4JDVB 1WAEA 4FG4A 3UOAB 1E2WA 5EOQL 4X4YA 4H8WC 5DJXA 2P8LB 4UDTA 4UQ2B 4ZMWA 1OCWH 3RZCC 1X5GA 3K1DA 4PJAB 2VN4A 1JNNL 5B4MC 3B2PA 4HZLA 4FQXB 5F1KC 3BGMA 5A43C 2ERJB 3P0VH 1JHLH 1MDTA 5AYQA 2XDHA 2CR6A 5CN3A 1F41A 4JG1H 3ZK0A 2J57A 4H5SB 1AGBB 5J56B 4YGVA 1W8OA 2MNWA 3SKNA 4HHAA 5I6KA 5HGBA 2ATPB 5HHMD 1ZVSB 3RWIB 5HGDB 3QDJB 5F71A 1OT1A 4ANWA 1DQIA 1OAKH 1WO2A 1HCZA 5KSUB 4GMSH 3C60B 1IGJB 3F2LA 4N0CD 3FH7A 3HR5B 2AAVA 4YDJB 3T08A 1L4IA 1J11A 2BFGA 3CX5K 3TT3H 4F57H 5EZIL 4DP7X 5GGVH 4N8PA 4PB9H 5DZNA 3C5JA 3ZVVA 5DZPA 2ZX5A 5CS7A 3IDNB 4TUKH 2R39A 3DMMA 4MJIA 2AVFA 4PRHB 3ZY7A 2B16A 3BUIA 1H3WM 1FLTX 3F7PC 3TF4A 4NRYB 4BWWA 3DTUB 2P80A 2JLPA 5DA4A 2VJ0A 3IDUA 3VI3F 1KXQE 3CC1A 5DD6B 4L4VB 2E56A 5DJZB 1UB6A 3LPWA 3GMOA 3FNKA 2HJLB 3RGVB 1DSFH 1F13A 3RZWA 1HL9A 3TNNB 3H9HA 5HYSA 4AK1A 4YZWA 5I76B 4Y9EA 4G7VL 2GVYA 4ZXBA 2HT4D 2X4OB 2DMGA 4ZO7A 1RUPL 3CXDL 2R0LL 4XNXH 5F3HB 1NCCH 5G55A 2WUCH 4PTUB 4RNRA 3NCXA 3L9YA 1EXUA 4H25B 3VVVA 2LLNA 4R2GD 4PJXF 1T0MA 3KLDA 4RA0C 3SZKC 2BY2A 5GHWH 3RWJB 3BAJA 2F1BA 2VLRE 4LSPL 4FFYA 4M4RB 5DO8A 4JFXB 3WSQH 3PHSA 4YK4C 1QFUL 1IEHA 3HCVA 1VKXB 2IQ9H 4ZMLA 4O2FB 3Q06A 9CGTA 4HHWA 1PD0A 2CUIA 4LF3A 2CDEB 4OCSL 2OSLB 2K8MA 4I8DA 1JNHB 2X4RB 1GAFH 2B2XH 4JFFD 4OV5A 1Z9LA 3QFDB 1R3KA 1ZAGA 1A5FH 4JFEA 4X6CA 2GFBB 3GPSA 4TPRH 2XV3A 4S1RH 3STBA 2AJVH 4Y5YB 5AAWC 1B3JA 1GXEA 5DK0A 1KLGB 1YQVH 1L9RA 1MWOA 1NCNA 5DJ6A 4MAUL 4HUVA 2IDFA 1TU2A 3EOAA 3HA0A 3QJQB 4FFVC 4R5TA 3TJHC 4EI5C 4XNAA 4WY7L 4Y19B 4XVJH 3W9DA 4QRBA 1SVBA 2FECL 3CLEL 4FFWC 4YH6A 4PV9A 3RNKA 2EYRA 2R2BB 4OTXH 4XPBL 3JWOH 4GLRI 1BOYA 3SBQA 4HWNA 4D0CB 3K8MA 5D2LF 2N7SA 4ZPVB 4XCCH 3HS8A 4GXUM 4LLUA 5EBWB 4U1SB 4YDKL 1M71A 1DBAH 1E4WL 3BAEH 5I1CH 2R9HD 3U7WH 3UP6A 2NY4C 1ND0A 1ROWA 3ZE0E 4CVWA 4R5XA 1V7MH 4YAQA 3CLFL 2BW5A 1DBMH 4M5TA 1OK8A 3GMRA 4B41A 4ABUA 2NZIA 3KYOB 1IIIA 4M5YL 3CHRA 5DD3H 3WLWC 4EZMA 5J9PB 1QLRA 1F1AA 3ROLA 1AXTH 3BI9X 5K9OB 2I27N 4QRQA 2KLTA 4OLYH 3D09A 2QQKL 1IT9L 4J8QA 5F1SA 1AGCB 1MNUH 1SF3A 2WO2B 4XP6H 1T7WA 1SUJA 3NFPA 5F7EL 4XWOC 2K45A 3QIWB 4PJHB 4HC1L 2E7LC 4FTVA 3EOTH 1DQDH 2E7HA 5DD0L 2A6DA 5T1KA 2KZKA 3JQOB 3UJJH 5I15H 1GC1L 3QHFL 4R90L 2IG2H 5DO2C 4K3GA 5TE6H 5HHQA 1OP5H 1X5ZA 1LO2H 3RX9A 5C2BL 1RURH 5CLTA 4OZ4A 5JHLH 3KVPA 1XGTA 4X5XB 1U8LB 3E6HB 2YMXL 2AI0L 1YMMA 3DECA 1BXUA 5I1GL 3MPCA 3HTLX 4HIJB 2WBJB 3ULUH 4HWEH 4ZUWA 5C0CD 3L6FB 3HPJB 3F62A 5EMYA 2VLKA 2FECI 2CJUH 2VXVH 1BD2E 2J6EH 3L54A 2ZJSH 2JIXB 4Y4FD 3RIAF 4EMZA 3EDKA 4HV8A 1ZWIA 4S1DD 3R19A 3DX8A 4B53A 5A3IC 2JKSA 2APFA 1UD8A 3SQOH 2VLJB 5K59E 4X2UA 4UT9A 5DD5H 4A1RA 2R8SH 3V10A 1V3KA 2W9LA 4LK4A 5EC1A 3MRBA 2YAFA 5GS2D 4YFEA 4D9QE 5FO9A 3ZKNC 4AV5A 2E9BA 2YEZB 5D7JD 5TDPB 4JG5A 3UTSA 5DYOB 1CC3A 1JWUB 2Z7WA 4I0PA 2YA2A 1LL1A 3QFJD 5KYXB 1JHTB 3KLHD 4V1DD 5MEPA 3D4CA 1I1FB 4RMTA 3WTSA 4HZ1A 2NR6A 4QXGH 3O6FA 1J05B 2NYKA 4X6CE 5MP6H 2WLJA 2XBTA 3L9EA 5E23A 1P5UB 1UA3A 2YUZA 3FPYA 3II1A 4S2SB 4DEUA 2X9YA 1CYGA 2O6CA 4Y9GA 4HT1H 5CWSB 2CALA 3RY4A 1XF4A 2FQGA 4Y4KB 1FFTB 2CBQA 3VDAA 1UENA 4HAKA 4LOUD 3GSNH 3SCMD 2BLFA 1BSIA 1PJWA 2CDFA 35C8L 5ADPH 3PGFH 1MCQA 1O6SB 2V7HB 4E0RA 4ZD3L 3AWFA 3ARTA 4XMVA 5T5FL 4AYDC 1IO4C 4K23H 4GUPB 2A83A 1CUOA 1DQML 1PLAA 1S9KC 4Q8BA 1XQ4A 2OTWA 5KN5A 4L05A 1FSKC 5LGHL 3TTSA 3C09C 3O2DH 4JO2L 1T1WB 2IAMD 1JI2A 1NBZB 1T3FB 4QOKB 3O4LD 3UABA 3N42F 2FNBA 3WHE0 4F1SA 4XT1C 2VDOH 3HFMH 2HZHA 5KS9B 4AI7A 2CIIB 2XG5A 3D5OF 4N2OA 5I66A 5FYKD 3LRMA 1KNOA 5E1QA 1NEZG 3BE1H 5DUBB 5IM7A 2CR3A 3KWWB 4XVSL 2VDLB 1TOXA 1ZT7A 5HDQL 2VZUA 1C7SA 5FYJE 1BP3B 2YPVH 4WTQA 2XN9A 3GJFH 1XCTA 4R83A 4ZFGL 4U1MA 3RDTC 3S8FB 4BK5C 3L4ZA 4QKTA 4U0RB 3CXHK 1M7DA 1JHKH 3M8OL 5IOKA 4FTVE 3DIFA 4KNUA 1UURA 1R19A 5EF1A 2W65A 2NX5B 4GYBA 4H0GA 5E99L 5FOBA 4OCMC 3UO1H 3PAVA 4AIOA 1KCSL 2X1QA 3EGDB 5FEBA 2Z31B 2BSRB 2X4TB 2PO6B 1MHEB 3L5IA 1DVFB 4APQA 2YK1H 2ZX7A 4PG9B 2GIXA 2LU3A 2X38A 3LPOA 2VR4A 3T2PA 3OKDB 5E1AA 4NNXB 1RMFL 4A04A 3IMBA 2AJ3A 2VLKE 4L4JA 4MMZA 2Y69B 2JNZA 4W9CC 2AW2A 2VM9A 2EIDA 4XGZB 3VH8B 2IH9A 3SBRA 4FQXC 3SDDD 4AKQA 1T80A 2ERJC 3UTQB 3EBIA 2OMTA 5JPNC 1X5AA 1U8PA 4Z3GA 4ONOA 4RGOL 5D1QC 5JOPD 2EE3A 4Y1SA 4NC1C 1VDGA 4TUUA 3RVUC 2NCMA 1PFCA 3G04A 3HHSA 4M48L 2H9GA 4NQDB 4F9LA 5JDJA 3VFWA 1EO5A 3UTSE 3LRSB 2FSDA 3LZFL 1MAJA 1FZJB 4UV4H 1JFQL 4H8HA 4Y16D 2Q20A 3QRBA 2JKJA 4R3SB 1YEKH 4H2AA 1XGQA 3CSGA 4LNRA 1RUMH 1ETA1 3ARUA 3X13B 2CGYA 4NI6A 1FE8L 4YQXH 4EDXA 5H4YA 2A1WH 2FATL 1C8PA 4P2OD 3FN9A 5IMMA 1JGUH 3ZZSA 3GIZH 5FHAH 4NOFA 4BK4A 2H3KA 3NEOA 1NCTA 3GBML 1UT9A 1MSPA 1A1NB 1UYWH 4X98A 1PU0A 3BZ5A 5KOVC 2E76C 2F0CA 3QYMA 3EF7A 3W5MA 2CZNA 3P73A 3U4AA 4AH2A 2CLRB 1SEQL 2R0KH 3BESR 4PLKD 2R0WL 4LCIH 3QEUB 3S48A 2ATAA 2OI9C 2UXGA 2GAZA 2W0FB 4M7LH 2HT3D 3MGOB 3MNVA 3OHXC 3OGCA 4QHPA 1P5VA 2QQNL 4BFEA 3TO4C 3UTTB 2FQEA 2ROXA 2R23B 2BP8B 1I7TA 1YEWA 1Z9NA 4U6HB 2DLHA 2ZAGA 2J6WA 2UYLB 2ZYHA 4N8VB 5EO0B 1WK0A 1BFTA 1TVBA 4FHBD 1HQ4B 3TWCL 3I9AA 5LHDA 4QNPF 1DVTA 4ZFOB 2WXLA 3GMNA 4F3FB 4XCNB 2ZKYA 4P5TA 4ZS7H 4NBXB 5IMOB 1HESA 3TURA 2CWRA 2EXSA 2BSTA 4I9WD 2QSQA 4RX4D 4QGTA 5AOIA 1EXHA 2VL5B 1NBQA 4MNGA 2CSPA 4HJSA 4Y5XB 1MCWW 3QDGD 5E03A 5T1DL 2YAEA 1QO3B 5GGSY 4QWWC 2CHDA 4AL8H 5I6OA 2YZ1A 1JN6B 3E3QE 5E8OA 4HDIB 4F5CE 1P4IL 4HC1A 8FABA 2WOYA 3CV5A 3GSOB 3KPMB 1MUJA 1KC5H 1I1AA 3SODB 4TSCH 5ADOL 3CFCL 3VI3B 5M94B 2WSDA 3CVHB 2ENQA 3B7SA 3LH2H 2XTSA 1HHIA 4WO4C 1NIFA 4AGOA 1AD9A 3BO8A 3D2UD 3HKFA 3BVXA 3P3SA 4B5ZA 2BVQA 1G9ML 2YPLA 4M93C 2JQAA 5HYJA 2D31A 2W94A 4ZUTB 1RLBA 4BKSC 3QP3A 4KZEH 1OZTG 2WGXA 3BCDA 3HNTH 4Y9BA 4QHMA 2Y7QA 2HMID 2DQIL 4M6OH 3GT6A 3B9DA 4F7KA 1SJXA 3P3UA 3WIHA 3WUZA 3X1BA 4ZNCD 3MOAL 1QFWM 3WTUA 3WIIH 1TQBB 2YUXA 4PJXB 2AJUL 1M9SA 1O7DC 3IGKA 5BZXA 1WPCA 2VDRL 4E9SA 2X42A 4BQBA 3TEYA 1UH4A 4NI3A 1TDQA 3MRHA 1MFAH 4ADJA 4BH7B 2FB4H 4ODWB 5C0EB 4KXAA 4X7SL 4OIBA 4ZFZB 3C6LD 3ISRA 2FD6L 1G0DA 5E6IC 3K7UA 4AYFB 2UZIL 3QIWC 5DHDA 3V4VL 4JZJC 4X6FA 3OKLA 3BH4A 1CF1A 1B9ZA 1I7RA 2WTOA 3EF4A 3VG0H 2NY2D 1ORQB 5J4MA 1R0AH 2YIHA 3ARDA 3FOLB 3FRUB 4PVBA 5I2IB 1G4RA 4L2LA 5CZXD 4NFBA 1EGJH 1PLBA 5GGUA 3FUIA 2I7SA 3C8DA 4Z76B 3ABKB 4KOCA 2BSSA 1XGUA 2UX6A 2Y2TA 3HB3C 4MXVE 2KDGA 4XP9H 3P30L 1M53A 2H6OA 3FUJA 4RIRA 2F54A 3N43F 1S7TA 2DYSB 3TESA 2E9IA 2E7DA 1LQBC 5T5FA 3G5WA 5D2LB 2WZ6A 3PQYD 1I4FB 5JUEH 4OD3H 3WFZA 4BCYA 3V0DA 4MLSA 4MQSB 4DVBB 1USZA 5JORA 1C16B 4NN5B 3O8XA 4UOZA 1NFIA 3BSZH 3LKSA 4KBPA 3WS6C 4ZZKA 4NKIH 4KMTH 4WAFA 1NLBH 2BNRA 2V9QA 3OF6D 2NQDA 3D1MC 1R6VA 1Z3GH 1K4DB 2JJWA 4NKOB 2PW1A 3NIDF 5A7BA 2QVKA 2NUTA 3DETD 2ICES 4M7JH 5GSRA 2XKNB 1QUNA 4FQIH 4L23A 4U7MA 2QL1A 4UOJA 1EFQA 3QUXD 3NDYE 1RIHL 5FXCH 1PQZB 1T0NB 2HVKA 2VLRD 3FHEA 4MNGE 3IRPX 2Q76A 5IVXE 5ESAB 4AQAA 1FIGL 4XE5B 2YAQA 3P77A 4NPYA 3LVEA 4N0RA 4QY8B 2VSMB 5F9JA 4HXAL 3GNMH 3PU7A 4KNSA 1U92A 4HISA 3H4HA 1E9PB 2Y1ZA 5DMIL 4K3JH 4KK5D 2VXQH 1UCBL 4Y4KC 2H41A 3IDMB 3JWNC 4YR6B 4Z7IA 2MPVA 4XOBA 3MRCA 4K3HA 5F6IC 3ALPA 1J1OL 1OARL 2CLZB 4KVPA 4QYOB 5CGMA 5FKAB 3IMSA 6PCYA 1AGEA 4MMXB 5F7WC 3UBHA 1WITA 4FNQA 5EU7E 5JW5B 5HYJE 4APXA 4RFEA 1Q0YH 1XZ0A 2BHZA 2D7PA 3BIKA 1AP2A 4ES8A 2D03H 4FADA 3VA6A 2ZUWA 3TTYA 4FABH 4ZNEA 3CFJA 2XNAB 1RQ5A 5CCGE 5L2KB 1HYSC 4IRZL 3UYPA 4RLDA 2EXYC 4U1KA 2WQVA 2YRBA 4M43H 1UM5L 3PL6C 3BWSA 5I8CA 4QF1A 5J13C 5KAQF 2OX5A 5G5DA 2Q6WA 2W81C 2HT2C 3WTWA 4DPBX 3Q8CA 2VDML 3FZUD 1PL3A 1MVUA 3BUDA 2KMWA 3PAUA 3MTRA 5B39B 2H2PC 3E6FA 2MCAA 2AQQA 4JFDA 3QNXB 6CGTA 5H2BB 1OD7A 1MJ7H 4KUZL 4KPHH 5L9DL 3BT2H 5A2JH 3IDIB 3BN9D 2OJZL 3REVA 4C4BA 3EO1B 2W60B 2BX5A 4B9IA 4NBZB 1WA0X 5HBBA 2P7TA 4F8QA 4ZX3A 2KS0A 1S8DB 2IFFH 3OAUH 4TUOB 3TV3H 2Y7LA 4NQCE 1JPTL 3QGVA 4JPVL 1F11A 4EUPH 2Z31C 2H1PL 4S1QL 2CHZA 1CZ8H 4OU3A 3DMMD 3MLYL 2BSEA 4Z8FL 3CQPA 3IKCA 2P80D 4AQ1C 1QTSA 4JJ5A 1OGSA 2P1YA 5I6XB 1OALA 3PV6B 4CVUA 2UXTA 4WDIB 1UD5A 6FABL 3N42B 4XPAH 5DHEA 4PGEA 5CBEA 3V6FA 2YA1A 2CM6A 2R51A 1A7OH 1BD2D 1QSFA 3N1QC 4YDNA 5DRXA 4ZXBD 3O9WA 4HK0B 1EPFA 1N6VA 4DUVA 2ZCKH 2DKSA 4R7NB 2XN0A 5AZUA 5AB2A 1SJHB 3C8KB 3Q9QA 1ADQH 3WS3A 4JREB 4R97B 4QRAA 3QQ4A 5TGBB 1U8CA 3PFUA 3TNMA 4AMKH 2P44B 2FT7A 3GLEA 2EP6A 3I6SA 3SO3C 1B4RA 2H2SC 1PGRB 1SRDA 4BFGA 1ZLEA 1TJXA 2YMOA 1JPSH 2ZICA 4B9FA 4BFIA 4HPYH 1KJ2A 5TQ2H 1E5BA 3APNA 2HPOA 1JV2A 1HDMA 4PU2A 1A7QL 4KHXL 5D6DC 3QEGH 2VC2H 3V9FA 5DVLA 4UQIM 5I8KH 2EH7H 3GXPA 2FYYB 2G2RB 4BRJA 5C6PB 4K9EH 3RWDB 3RWFB 4BGLA 3OR6B 4D8PB 4R5VA 2X9XA 4PJCA 3KGRA 4HIXL 3HN3A 4YVNA 2PCPB 3VDBA 1GW6A 1RK7A 2HKFL 1G7LB 1D5XA 1UOKA 3P4OA 1TZOA 3NJLA 2WZ5A 3O4OC 5KWYC 2HG5B 4PLJC 1PLCA 3K1KC 5EBGA 1HWWA 2IGLA 5D9SB 2W07A 5MHSD 1CICC 3ECBB 1NGWB 2VERN 2ZSWB 3RKDC 3X12A 5E1GA 4ETQB 4MAYC 3ZUCA 3OJMB 2ISDA 1TNMA 1VJSA 1ZT4B 2Z4QB 3RGHA 4JFQB 4JFDE 1L0XA 3VGBA 4RGNE 4E36A 2F7QA 4CU7A 4X5RA 1H9VA 2CNZA 4HS3A 4JR9L 2L7QA 3STZB 5E70A 2IV9A 1K5WA 3ILEA 3FSZA 4PPTA 3CMOH 3VI4E 2QQLH 3O81A 2AV7A 5FYJD 1DUYA 4X80H 1PKQB 1OPGH 1NIAA 4YE4L 5D96C 4N68A 2YGVA 1IAMA 1JYXA 4IIQB 1WTGT 1T4KB 3V4VA 3SE3C 3KPTA 4FTVD 1ZJBA 2Z34A 4S0TD 2MPAL 3TV8A 5T1KD 1F00I 4WJKB 1BJMA 4GIOA 1UUSA 1MEXL 3OMIB 5JO5B 1ZVNA 2ADGA 3C6EA 2JJSA 4U7KA 5EO9B 4NZJA 5B1AB 3F5WA 4R0LA 2OXGB 4IRJB 1H9DA 1W8NA 4OCXH 2HLEB 1UD6A 4ZUUA 1N4XL 1PJ9A 2B0SH 1DBKL 2BFVL 1XSJA 2BH0A 3B7RL 3P11L 1J9CT 3MX0A 1XDTT 1SNRA 2VLKD 2N4IA 4E9VA 3IRCA 1V5JA 2MQCA 3L3OC 1LO0H 5ACLA 1DN2A 3NSJA 3AREB 4LVHB 2BZCA 3I6GB 4RWHA 3BPNB 3WN5C 1NCWH 2WVSA 2AK4E 3DUUB 4OBRA 3RY6A 4XB8A 3N9GL 5EA0H 4MD4B 4HJUA 3FQNB 4WHCA 4G8IB 1Z5LA 1GGCH 1MREH 1NQBA 3RWCB 4EEEA 3BFQG 1AH1A 1XEUA 2VRQA 3K74B 1M2VB 2YUVA 3UTSD 1ZLWH 1MFEH 1N0XL 4FZ8L 1BGXH 3BGFC 3IFLH 1BQRA 4I0PD 5ANMB 5J1TC 3NP3A 2GSIA 3WJJA 5G2NA 3ZO0A 3RL1A 4EN3C 4I0CC 1KCVL 2OYKA 1OSZB 2Z8SA 3EYQC 4Q56A 4LAQH 3O6FD 5GRVL 5LKNA 3S3SA 4WEBH 2Y07L 5L4IA 1ZCRA 2XZAH 4YDVB 5FCUL 5E2JA 3QDMB 2DEYX 1COBA 2P46B 3RVXD 4L8BB 2IWKA 2C7UB 5HHXH 4AC2A 1Y0LA 4G7YH 1MG3C 3L3HB 4WEMB 4R7DB 4NZRH 4N8CL 5HDRA 1FAIL 5EZOL 3AG2B 4IOSA 2F6AA 4N0UA 2IANA 4YL9A 5K1NA 1GZHA 1U8OA 1EDYA 1NFDB 2NDGA 4NN5C 4GW4A 4P8QA 3GS4A 4YUEH 3K80A 1RZJC 5CD5D 2H32B 5F8RC 3BKYL 5F7DA 3GB7A 3EADA 1R3HA 1YC8A 5DUJA 3EJZC 5BVPL 1KLUB 4YHMH 1NICA 3WNNA 4IRZA 5IW6B 5HPMB 1I85C 1I3RA 1LD9B 4LL9A 3B9EA 3GRWA 1S5HA 2I9LB 4OD2A 3WEXA 1HKFA 2WTPA 3NJNA 3DHMA 5DEJA 2LE9A 3NJJA 1S9WB 4NQSA 5J6SA 3LV3B 3HMWL 1WS7A 1N64L 5KVEL 3J27A 1A9BA 1IBDA 3BEWB 3GJEB 3CH1A 3O3BB 3VXME 2IQAA 3WO4C 4TNWK 3I3DA 4GT0A 1J18A 2VIRA 1M9WA 1VFAA 4GUOA 3V8CA 3HI5H 2ZWKA 4L8SC 4M5ZL 3V5HA 5ISZA 5LCVH 5KYWA 2K4WA 3MCLL 4HWBL 4EJ1C 3CVDA 1VFBB 3OAYK 4PCYA 2OP4L 1U95A 1LTXA 3TF7C 4Y8AA 2QGBA 2QHLA 3N43B 1QYGH 5SWQB 3QXAB 1XBRA 2HKHL 3MV8A 1LWJA 1PTZA 2HTLC 5D7IA 5DUML 4APQD 2MNUA 4KK8C 4MA3A 5E2TL 5JHDE 2EDMA 3WIAA 1MAKA 1U3HC 2HJFA 4JM4L 2PPCA 5HHMB 1PX4A 1OB0A 2X4UB 5DYFA 2B14A 4G9DA 2ENJA 2BC4B 2BS71 5EF0A 4NLHA 3DVFA 3K2KA 3QQ9C 4DAGL 1VZHA 1WT5A 4MJ6B 5F9OL 5K59F 4HQQL 2IGFL 3OKEA 4YHYB 2B7DT 2NW2A 4XOCA 1X44A 3NIDB 4WI0B 4PSRA 4WENB 1FNAA 5IJVA 2QADD 4DGVH 2OXHB 1PAMA 3W81A 5EB9A 1UZ8A 1BFSA 4UM9A 4UTAH 5LNGA 2DJ4A 5HGGS 1FL6B 4F92B 5H37G 3KEDA 1FFRA 3GSXB 4Z7OE 2PXYA 3ARBC 3KPSA 1KJMA 2R29L 2F5AL 3WFCH 5JMOC 5SV3A 4AW7A 4E41E 2FT8A 5I5RA 4AM0B 4KKBC 4PP1C 4B60A 2EXWD 5MENE 4HJJL 3KLAA 4NO3A 4ACPA 3O3DA 4PRPE 3FFDB 3PWLB 4E5XB 4M61A 1E28A 3HRPA 4QO1A 3SPHA 3NJGA 2EYTB 4G6KL 3TFKD 2QELA 3NZ8B 2WLZA 5IFJB 4CMMB 1AJ7L 1J8SA 2BPBA 2IPKB 2Q3XA 4R2GB 3GGWA 1B3IA 3CHOA 4OF0A 1A6UH 3OXRA 3AQYA 3JVGC 5DZJA 5FCSH 3VUAA 5I6XC 1R46A 3ECQA 1CGWA 1T5XA 5KW9L 4W9ZA 3V4PH 5C0ND 1JZGA 4UTBL 3X11B 4AIZA 4M6MH 4O4YH 3F12B 3HZKA 25C8H 1G6RL 1IC1A 5L88H 4PYGA 1TVHA 4JFFB 2AQRA 4Q97A 5FO7A 1F6AB 3QVAA 3VQ2C 3MHZA 1OEZW 2HRHA 3QJRB 2EIZA 4GRMB 4LP4A 1MF2L 3OJ2C 4K94L 5AW7B 4CVZA 1TJMA 1F4WH 5AYUL 1UH2A 4HKXB 1DE4A 2XFXB 4EDWL 5LN8A 1B0GB 3EH3B 5CP3A 4E9WA 3ZHNA 4JG0L 2WMPB 4X6BA 5EU7C 4D2NA 2OTPA 4DP4X 1LMIA 1FL3B 4XC1L 4Z3IA 5ISZE 4GSQA 2ICWJ 2CRIA 1PFOA 3IXAB 3MROA 2FR4B 5I1HH 4FQJL 3D3VE 1ZLVH 4TSAL 1VEMA 4Z7UA 1XGYL 3QUZA 4LEOA 3V0GA 1HEZB 3WXVH 4O02B 4CSTA 5I8EB 1TF4A 1I1AD 3LSOB 2R2EA 4JHZA 3ZKMC 4Z7VE 2YD4A 4X8JA 4WV1B 5DR5H 3KBEA 2CCWA 2JB5H 4OZFH 2IH8A 4NKDB 4OGYH 3TBCA 3G5ZB 4TQEH 5AALA 3QA3B 5HYJD 1P7HL 3CAFA 1OGAA 4OAWB 1J0IA 2W9EH 3QUGA 3UBFA 2WXFA 4OBSA 1U8KB 3PWUB 2Z93A 1M57B 3GSVA 3LXAA 3U36A 4AVIA 1JCVA 2FJFA 1P4LB 4KTDL 2C9XA 2Z7YA 2DB8A 4YNYA 2FJGB 2I32A 3IJHA 1LWRA 4ZTPH 1F4YH 1NCUA 1W0VA 3JTSB 2ZKHH 1VEPA 4ILDA 4N5EC 5DJYA 5ANHA 3SKMB 4N0YH 3FB6A 1HKLH 3DX0A 1WIPA 4YFDB 4GB9A 2FJHA 1IIKA 5DVPA 3AT8A 3FU8A 1ASPA 5EC2B 3GLAA 5FUZL 1WWAX 4JY4A 5EV7A 1I9RL 5IHUH 4M8VA 5KOMC 4EZKA 1CMOA 1ZSHA 2AABL 2EDBA 2X6MA 3BP6B 3JV0A 5JIDA 1RAMA 5C0CB 5E7FA 3QCTL 2RA1A 2O5YH 1J1PH 4UV7L 1KENL 2VZOA 5C6TL 1OV8A 4Y4FB 5F9AC 5GGTL 3DXAA 4NSKB 3T65A 3O6KH 3L81A 1MFUA 5KVFL 2WTRA 3ROOA 4DW2H 4GJTB 1A66A 1AZCA 4XP5H 4MZRA 2ITCB 4ENEC 4YSOA 3GLZA 4HCRH 2OMUB 3P3TA 2VLLA 2QHRL 1G94A 2G9KA 4N9GA 2IOOA 5B7FA 5EWIL 2JKTM 5HYQA 2F54D 3ZE0F 4QTHA 5D7JB 4GOSA 3KPPB 2ZUSA 4J8RB 5A6LA 1W0YT 3F01A 3QFJB 4PJEE 4LLAA 1DANT 3IYLW 1W16A 1S9VA 4V1DB 3AREC 2G9HA 4LQ1A 3ZL4L 4F27A 5BUGA 1UHVA 3DX7B 3NN8A 3MREB 3O8XD 4L8DB 3WDHA 3S88H 1ACYH 4HHGA 2GT9A 1FV1A 4KC3B 1RUQL 3RB7A 1XGPB 2BNRD 1U8QA 4W9FC 3TBTA 2DLIA 3MRKA 3QORD 4FXKA 3GMQA 1QD0A 1WBZB 5FR3A 3SCMB 1DJSA 5HHOA 3W38A 1PKOA 2CKBA 1OCWL 1IILE 2ESVA 1FVDB 3DV6A 1ONQB 1DQQB 1U4EA 2IAAC 3L2LA 2FWOB 2YWZA 3GD1C 2UY7B 2APVA 5LAXB 5CLZA 5DHMC 5AB0A 1NEUA 2DIBA 3VFTB 1JHLL 1I9EA 5KBDA 1UXSB 1RZGB 4D9LH 3QB7C 4DPRA 1EXGA 1P9MA 4M8QB 1G9EA 4KFZC 5C08A 3OLDA 2CJ3A 2IAMB 1HHJB 1EJFA 3ELAT 2WQRA 1PNDA 3O4LB 4JFHE 5FO8B 1K8DA 1DFXA 1QKZH 3MGAA 4Z7UE 3NPSC 5IMKA 4KRMB 5A2IH 2P42B 4JDEA 1JZEA 1KCRH 4FC3E 3VFNA 4HWBA 2QR0A 4GMSL 3KLQA 1RZ8A 4LPYA 2B8OT 2FWSA 2LU4A 4IEFA 4R96B 4RGNC 1KELH 3L16A 5HY9A 1MRCH 3NJIA 4JM2A 4F57L 1XR9B 3O41A 1ZHLA 4PB9L 2B9BA 4ALAH 1N70A 2WKLA 5D6CA 3CHXA 5ENWB 1BDYA 1E50A 2GBTA 2D73A 2VSDA 4HOWA 1U8MB 4GW1B 1Q9OB 2WC7A 3L3GA 4ZQKB 4IGBC 3DX2A 2I26N 1G1YA 1ZD6A 2DJUA 4JRYA 1KFGA 4N9OB 3APCA 5DSCB 1E43A 4JPSA 1IGYA 3W37A 3DO7B 4HUWB 4M1CC 2VW6A 1LEIA 4X6CF 2JCWA 1WWCA 1N68A 5IIEA 1RL1A 4JUTA 1AZNA 1LVEA 4JFDD 4F2ME 1N3NA 4PJFE 3MRJA 3AM8C 4MXQD 2EC8A 1NCCL 1WIUA 4PBDA 1VB9A 2WUCL 3VYOA 3L5HA 3HI1B 1E3FA 4GAYA 3NJHA 4U1HB 3MJWA 1ZPUA 4LBEB 1BXVA 3DXAE 5DJCB 4NWTL 4P9HL 2EE6A 3SDDB 2OK0H 4FN0A 1IC5L 1OAZH 2F7OA 1B4JH 2VDNH 4JAMB 4XI5D 5DRZB 5FM8A 5C0GA 3WSQL 4DQOL 1WWBX 2ENYA 3L3DA 3BP4A 2BJMH 3LRGA 1I7UB 4E9LA 5CJOH 1UJ3A 4GKNA 3SQBA 5DI8A 4XPHH 2BSED 3ZDXF 1CE1L 1V8HA 2Q8AL 2GBVA 3ARGC 5FWRA 4TNWF 1K85A 4N0CC 4TPRL 3SHSA 4UNVA 5TK2A 2AJVL 2CGRL 3F6IA 1MJJB 3HJEA 2X4QB 2V5TA 2O61B 4OZIA 2LQRA 1G6RA 1OB1A 4HH9A 4P2OB 3O9WD 1GZPA 3RVWD 1FNGA 5C6WH 1ZLUH 3BDBA 3BKML 2OMVB 4F7MB 3SO5A 3IU3A 3W1ZA 3JWOL 4Z77B 4KVNL 2H3XC 3QIBA 1DLHA 2BP3A 5EU3B 3LZRA 1QHPA 2P5PA 1I8LC 1C5DA 2DOCA 3BAEL 2WQUA 3U7WL 5KVEE 3EG9A 4PRDB 4TRPH 3CTTA 3UFIA 3QWQB 1KUMA 4Z78B 1JNJA 2X4PA 5FC9A 1FFNA 2YLKA 4NZDA 1KPUB 4L9LB 2NY7H 3MLSH 4KKAD 3W2DH 5C7XL 2FRGP 2DPKA 2YJQA 4C56E 1LDPH 3H42L </