2LGOA

Solution nmr structure of a fkbp-type peptidyl-prolyl cis-trans isomerase from giardia lamblia, seattle structural genomics center for infectious disease target gilaa.00840.a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
MAHHHHHHMGTLEAQTQGPGSMSAQLEKKVLTPGDGVTKPQAGKKVTVHYDGRFPDGKQFDSSRSRGKPFQFTLGAGEVIKGWDQGVATMTLGEKALFTIPYQLAYGERGYPPVIPPKATLVFEVELLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a putative FKBP-type peptidyl-propyl cis-trans isomerase from Giardia lamblia.
pubmed doi rcsb
source organism Giardia lamblia
molecule tags Isomerase
molecule keywords FKBP
total genus 22
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lgoA00
2ZR6A 3O5LA 3KACA 1L1PA 3KCEA 2PV3A 4QT2A 1F8AB 1NSGA 2ZQUA 4ODQA 1F40A 4TYOA 5BXJA 1J4HA 4TNSA 1YW5A 4N19A 2PPNA 3TDBA 5GPGA 4DZ2A 3JYJA 3O5RA 3PRDA 1QZ2A 3KAIA 3O5GA 1Q6HA 3UQIA 1NMVA 1FKHA 2PPPA 5DITA 2Y78A 3CGMA 4JYSA 3UQBA 2XPBA 1Y0OA 1R9HA 1JVWA 1FKRA 4QIBA 2XP6A 2KI3A 2LPVA 2MF9A 5HW6A 1B6CA 2MLYA 3KADA 4IQCA 4U86A 4DT4A 3H9RB 4W9QA 1D7JA 4ODMA 5HT1A 2MPHA 1J4RA 3O5MA 2XPAA 5HKGA 2FAPA 4FN2A 3NRKA 4J4OA 4DRQA 1Q6UA 2ZQVA 4NNRA 4JFJA 4IPXA 5HW8A 1J4IA 3O5JA 1KT0A 1Q6IA 3TC5A 1FJDA 1ROTA 4JFMA 3RGCA 1M5YA 1YATA 2N87A 3O5IA 3CGNA 3O5DA 4ITZA 1W26A 3WH0A 3UQAA 3JYMA 4G50A 4W9OA 3O5QA 2KR7A 2M1IA 4TW6A 1PINA 3UI6A 4DRHA 1BL4A 2KO7A 1FKLA 2MLXA 2VN1A 1KT1A 3NI6A 4LAVA 4MGVA 4LAWA 4DRMA 1NMWA 3JXVA 4R0XA 5I98A 2XP4A 4J4NA 3KAGA 2M2AA 2Q5AA 4QT3A 1T11A 2RQSA 2M08A 5HTGA 4LAYA 4ODLA 4G2PA 2AWGA 1EYMA 1ZK6A 3NTPA 4IQ2A 2MLZA 1J6YA 2KE0A 1C9HA 3TCZA 4W9PA 2ZR5A 3UI4A 2RUDA 4DRJA 2XP5A 1N1AA 2DG4A 2ZR4A 2UZ5A 3I6CA 3OOBA 5DIVA 4ODOA 3UI5A 2FKEA 3UF8A 2LJ4A 1ROUA 2RSEA 3O5KA 4JFLA 3VAWA 1D6OA 2PBCA 5B8IC 1EQ3A 5D75A 2OFNA 3KAHA 1FKFA 2XP3A 1FKSA 3O5OA 2RUCA 3IK8A 1FAPA 1FKJA 2VCDA 5HWCA 3B7XA 4BF8A 4TW7A 2F4EA 2F2DA 4LAXA 2PV2A 3IKGA 2LKNA 4JFKA 2XP9A 1BKFA 2ZQSA 3RFWA 1HXVA 3KZ7A 4DZ3A 2ITKA 1FKBA 3O5PA 1QPFA 4DRNA 1D7HA 2MNTA 2RURA 3MDYB 1D7IA 4U84A 2RUQA 1FKGA 3ODKA 2JZVA 1U79A 2KFWA 3PA7A 4ODNA 2LGOA 4TX0A 4DROA 4FAPA 5DIUA 1FKTA 2DG9A 4DH0A 2F21A 4JFIA 1FKDA 1Q1CA 5J6EA 1FD9A 3IHZA 4U85A 5HW7A 4DRIA 1TCOC 2D9FA 4DIPA 4ODKA 2IF4A 3O5EA 2XP8A 2PV1A 2ZQTA 1JNSA 4GIVA 4TW8A 3GPKA 2KGJA 2XP7A 2DG3A 1FKIA 3O5FA 3KAFA 4MSPA 4ODPA 4GGQA 3PRBA 4DRPA 4C02B 2PPOA 1P5QA 2K8IA 2L2SA 3LUOA 1JNTA 3IKDA 4DRKA 3KABA 3EY6A 1PBKA 5HWBA 4ODRA 5HUAA 1FKKA 1QPLA 3FAPA 4O2TA 1A7XA 1ZCNA
chains in the Genus database with same CATH superfamily
5GQBA 3ARRA 3O5LA 5DF0A 2PV3A 1F8AB 1F40A 4N19A 1JNDA 3WD1A 1LG1A 1ZBCA 3PRDA 3FY1A 3UQIA 2PPPA 1FKHA 3CGMA 4JYSA 1FKRA 4HBEA 2XP6A 2LPVA 1E6RA 2MF9A 1HKMA 2ESCA 3KADA 2MLYA 4U86A 3O5MA 2YBUA 1ZBKA 2FAPA 2ZQVA 3GTYX 4IPXA 1KT0A 4Q22A 4JFMA 1ITXA 1W1VA 3O5IA 4ITZA 4DWSB 3JYMA 2DSVA 3PRAA 4G50A 2G8ZA 3UI6A 1LJYA 2KO7A 1GOIA 4LAWA 3JXVA 4Q7NA 4NSBA 4P8XA 1SYTA 3NTPA 3CHEA 4Z2JA 4IQ2A 2MLZA 4MNMA 1GPFA 1C9HA 3UI4A 1E6PA 2ZR5A 4DRJA 2ZR4A 5DIVA 4ML4A 3UI5A 4AY1A 3UF8A 4MTVA 3QOKA 1TFVA 3ALFA 4S3JA 1FAPA 5HWCA 1LL7A 3B7XA 2G41A 2PV2A 4HARA 2YBTA 1ZL1A 4FAPA 1JCHB 4QZVB 4ZS6A 1Q1CA 1FD9A 4U85A 1HKIA 3O5EA 3G6LA 2XP8A 1JNSA 4TW8A 4WJXA 1LL4A 4DRKA 1P5QA 2K8IA 3EY6A 1PBKA 5HWBA 1QPLA 4L72B 2O9OA 4O2TA 3ARYA 2A3CA 1L1PA 2P4VA 5GPRA 3AS2A 1NSGA 2ZQUA 2DPEA 1D2KA 3AQUA 3OA5A 2PPNA 3TDBA 3WD3A 1EDQA 4R5EA 3ARUA 3JYJA 4P8WA 1GRJA 5DO2A 1SR0A 1R9HA 1JVWA 1W9PA 1E9LA 4QIBA 2KI3A 1NWSA 4DT4A 1X6LA 1O6IA 3WL0A 1J4RA 2XPAA 5HKGA 4FN2A 3NRKA 4DRQA 5HW8A 4KR0B 3RGCA 1XHGA 3CGNA 3O5DA 3UQAA 1W26A 3O5QA 1W9UA 4DRHA 1PINA 2VN1A 1ZBVA 1KT1A 5I98A 3PR9A 1NMWA 4J4NA 4QT3A 2Q5AA 2O92A 4Z2GA 2F23A 2IUZA 4W9PA 1H0GA 2DG4A 3OOBA 2UZ5A 3I6CA 3CHDA 2FKEA 1ROUA 2RSEA 3O5KA 3VAWA 1D6OA 3ARTA 5B8IC 1LL6A 3KAHA 3WD4A 1FKFA 3O5OA 3WQVA 3IK8A 3WL1A 1FKJA 2VCDA 4S3KA 3B8SA 3B9AA 4UDMA 4DWSA 4TW7A 2F2DA 4LAXA 1ZU8A 3RM4A 2XP9A 3RFWA 1HXVA 4DZ3A 3O5PA 4U84A 4URIA 2JZVA 1U79A 2KFWA 4TX0A 4DROA 1HKJA 1FKTA 4JFIA 1FKDA 5HW7A 1E6NA 2IF4A 4MPKA 2PV1A 2DT3A 2ZQTA 4IT4A 2XP7A 3O5FA 2DG3A 4DRPA 3RM8A 4C02B 3LUOA 2L2SA 1JNTA 3KABA 4Z2LA 1A7XA 2DT2A 1UR8A 2ZR6A 3KACA 1EHNA 1LQ0A 1JNEA 4TYOA 5BXJA 1WB0A 4TNSA 1YW5A 3ALGA 2PI6A 3WIJA 3KAIA 1UR9A 1Q6HA 1NMVA 2Y78A 3UQBA 4ZPTR 3RMEA 1E44A 5HW6A 1W1YA 1B6CA 4IQCA 3H9RB 2MPHA 1W1TA 2DT1A 3AROA 3W4RA 1Q6UA 4JFJA 3O5JA 1VF8A 1ROTA 1FJDA 1YATA 2N87A 4ZPVR 4MNKA 1EIBA 4WKFA 2DSWA 4TW6A 1BL4A 2MLXA 3NI6A 3GU0A 2XP4A 2M2AA 1T11A 2RQSA 4L3NA 5HTGA 1HJXA 4G2PA 2AWGA 1EYMA 1J6YA 2KE0A 2RUDA 2WM0A 1RD6A 1E15A 3B9DA 2A3BA 2DSZA 3ARWA 4ODOA 1OGGA 3ARXA 2LJ4A 4JFLA 2PBCA 1HKKA 2FDMA 2B5UB 3CZ8A 3ARPA 2XP3A 1FKSA 4WIWA 2RUCA 4BF8A 3G6MA 2F4EA 1NWUA 3IKGA 1IX5A 3KZ7A 1QPFA 1D7HA 2MNTA 4WKHA 3MDYB 4WK9A 3ARQA 3ODKA 3BMBA 4ODNA 2LGOA 1FFRA 2DG9A 2F21A 5J6EA 3RM9A 2PN0A 4DIPA 4ODKA 4DWSD 4MNJA 4GIVA 3GPKA 1FKIA 3KAFA 4ODPA 4GGQA 1W1PA 4MNLA 2PPOA 1WAWA 3ARZA 5HUAA 3WD0A 4KQZA 3FXYA 1OGBA 3KCEA 4QT2A 4ODQA 4WKAA 1J4HA 1OWQA 5GPGA 4DZ2A 2WK2A 3EIPA 3O5RA 3B9EA 1QZ2A 3O5GA 2B31A 4HBOA 1XRVA 5DITA 1LG2A 2XPBA 1Y0OA 1H0IA 2AOSA 3CH9A 3WKZA 2DSUA 4Z2IA 4W9QA 1D7JA 4ODMA 5HT1A 2DT0A 3BXWA 4J4OA 4P8VA 4LGXA 4NNRA 1HJWA 2EULA 2A3AA 1J4IA 1FFQA 1Q6IA 1HJVA 3TC5A 1M5YA 3WH0A 2WLYA 4NZCA 4W9OA 2KR7A 2M1IA 4XAKA 1FKLA 4MGVA 3CHFA 4LAVA 4DRMA 4R0XA 3WD2A 3KAGA 1NWTA 4MAVA 1K9TA 2M08A 4LAYA 4ODLA 1KFWA 1ZK6A 4W5UA 3AS1A 2QF8A 1CTNA 1WNOA 3TCZA 2A3EA 5JH8A 2XP5A 1N1AA 4IT6A 4P8UA 1EQ3A 5D75A 1ZBWA 2OFNA 1ZB5A 4DWSC 3WQWA 1X6NA 2LKNA 3AS3A 4JFKA 4PTMA 1BKFA 2ZQSA 2ETNA 1FKBA 2ITKA 4DRNA 1GUVA 2RURA 1D7IA 2RUQA 1FKGA 1NWRA 4ZPWR 5DEZA 3PA7A 1NH6A 5DIUA 3CHCA 4DH0A 3IHZA 4Z2HA 4DRIA 1TCOC 2D9FA 2OLHA 4Z2KA 5HBFA 3ARVA 2KGJA 4MSPA 3PRBA 2WLZA 3IKDA 3ARSA 1E6ZA 1W9VA 3AS0A 4ODRA 1FKKA 3FAPA 1ZCNA
chains in the Genus database with same CATH topology
5GQBA 3ARRA 3O5LA 5DF0A 2PV3A 1F8AB 1F40A 4N19A 1JNDA 3WD1A 1LG1A 1ZBCA 3PRDA 3FY1A 3UQIA 2PPPA 1FKHA 3CGMA 4JYSA 1FKRA 4HBEA 2XP6A 2LPVA 1E6RA 2MF9A 1HKMA 2ESCA 3KADA 2MLYA 4U86A 3O5MA 2YBUA 1ZBKA 2FAPA 2ZQVA 4IPXA 1KT0A 4Q22A 4JFMA 1ITXA 1W1VA 3O5IA 4ITZA 4DWSB 3JYMA 2DSVA 3PRAA 4G50A 2G8ZA 3UI6A 1LJYA 2KO7A 1GOIA 4LAWA 3JXVA 4Q7NA 4NSBA 4P8XA 1SYTA 3NTPA 3CHEA 4Z2JA 4IQ2A 2MLZA 4MNMA 1GPFA 1C9HA 3UI4A 1E6PA 2ZR5A 4DRJA 2ZR4A 5DIVA 4ML4A 3UI5A 4AY1A 3UF8A 4MTVA 3QOKA 1TFVA 3ALFA 4S3JA 1FAPA 5HWCA 1LL7A 3B7XA 2G41A 2PV2A 4HARA 2YBTA 1ZL1A 4FAPA 4QZVB 4ZS6A 1Q1CA 1FD9A 4U85A 1HKIA 3O5EA 3G6LA 2XP8A 1JNSA 4TW8A 4WJXA 1LL4A 4DRKA 1P5QA 2K8IA 3EY6A 1PBKA 5HWBA 1QPLA 4L72B 2O9OA 4O2TA 3ARYA 2A3CA 1L1PA 5GPRA 3AS2A 1NSGA 2ZQUA 2DPEA 1D2KA 3AQUA 3OA5A 2PPNA 3TDBA 3WD3A 1EDQA 4R5EA 3ARUA 3JYJA 4P8WA 5DO2A 1SR0A 1R9HA 1JVWA 1W9PA 1E9LA 4QIBA 2KI3A 1NWSA 4DT4A 1X6LA 1O6IA 3WL0A 1J4RA 2XPAA 5HKGA 4FN2A 3NRKA 4DRQA 5HW8A 4KR0B 3RGCA 1XHGA 3CGNA 3O5DA 3UQAA 1W26A 3O5QA 1W9UA 4DRHA 1PINA 2VN1A 1ZBVA 1KT1A 5I98A 3PR9A 1NMWA 4J4NA 4QT3A 2Q5AA 2O92A 4Z2GA 2IUZA 4W9PA 1H0GA 2DG4A 3OOBA 2UZ5A 3I6CA 3CHDA 2FKEA 1ROUA 2RSEA 3O5KA 3VAWA 1D6OA 3ARTA 5B8IC 1LL6A 3KAHA 3WD4A 1FKFA 3O5OA 3WQVA 3IK8A 3WL1A 1FKJA 2VCDA 4S3KA 3B8SA 3B9AA 4DWSA 4TW7A 2F2DA 4LAXA 1ZU8A 3RM4A 2XP9A 3RFWA 1HXVA 4DZ3A 3O5PA 4U84A 4URIA 2JZVA 1U79A 2KFWA 4TX0A 4DROA 1HKJA 1FKTA 4JFIA 1FKDA 5HW7A 1E6NA 2IF4A 4MPKA 2PV1A 2DT3A 2ZQTA 4IT4A 2XP7A 3O5FA 2DG3A 4DRPA 3RM8A 4C02B 3LUOA 2L2SA 1JNTA 3KABA 4Z2LA 1A7XA 2DT2A 1UR8A 2ZR6A 3KACA 1EHNA 1LQ0A 1JNEA 4TYOA 5BXJA 1WB0A 4TNSA 1YW5A 3ALGA 2PI6A 3WIJA 3KAIA 1UR9A 1Q6HA 1NMVA 2Y78A 3UQBA 4ZPTR 3RMEA 5HW6A 1W1YA 1B6CA 4IQCA 3H9RB 2MPHA 1W1TA 2DT1A 3AROA 3W4RA 1Q6UA 4JFJA 3O5JA 1VF8A 1ROTA 1FJDA 1YATA 2N87A 4ZPVR 4MNKA 1EIBA 4WKFA 2DSWA 4TW6A 1BL4A 2MLXA 3NI6A 2XP4A 2M2AA 1T11A 2RQSA 4L3NA 5HTGA 1HJXA 4G2PA 2AWGA 1EYMA 1J6YA 2KE0A 2RUDA 2WM0A 1RD6A 1E15A 3B9DA 2A3BA 2DSZA 3ARWA 4ODOA 1OGGA 3ARXA 2LJ4A 4JFLA 2PBCA 1HKKA 2FDMA 3CZ8A 3ARPA 2XP3A 1FKSA 4WIWA 2RUCA 4BF8A 3G6MA 2F4EA 1NWUA 3IKGA 1IX5A 3KZ7A 1QPFA 1D7HA 2MNTA 4WKHA 3MDYB 4WK9A 3ARQA 3ODKA 4ODNA 2LGOA 1FFRA 2DG9A 2F21A 5J6EA 3RM9A 4DIPA 4ODKA 4DWSD 4MNJA 4GIVA 3GPKA 1FKIA 3KAFA 4ODPA 4GGQA 1W1PA 4MNLA 2PPOA 1WAWA 3ARZA 5HUAA 3WD0A 4KQZA 3FXYA 1OGBA 3KCEA 4QT2A 4ODQA 4WKAA 1J4HA 1OWQA 5GPGA 4DZ2A 2WK2A 3O5RA 3B9EA 1QZ2A 3O5GA 2B31A 4HBOA 1XRVA 5DITA 1LG2A 2XPBA 1Y0OA 1H0IA 2AOSA 3CH9A 3WKZA 2DSUA 4Z2IA 4W9QA 1D7JA 4ODMA 5HT1A 2DT0A 3BXWA 4J4OA 4P8VA 4LGXA 4NNRA 1HJWA 2A3AA 1J4IA 1FFQA 1Q6IA 1HJVA 3TC5A 1M5YA 3WH0A 2WLYA 4NZCA 4W9OA 2KR7A 2M1IA 4XAKA 1FKLA 4MGVA 3CHFA 4LAVA 4DRMA 4R0XA 3WD2A 3KAGA 1NWTA 4MAVA 1K9TA 2M08A 4LAYA 4ODLA 1KFWA 1ZK6A 4W5UA 3AS1A 2QF8A 1CTNA 1WNOA 3TCZA 2A3EA 5JH8A 2XP5A 1N1AA 4IT6A 4P8UA 1EQ3A 5D75A 1ZBWA 2OFNA 1ZB5A 4DWSC 3WQWA 1X6NA 2LKNA 3AS3A 4JFKA 4PTMA 1BKFA 2ZQSA 1FKBA 2ITKA 4DRNA 1GUVA 2RURA 1D7IA 2RUQA 1FKGA 1NWRA 4ZPWR 5DEZA 3PA7A 1NH6A 5DIUA 3CHCA 4DH0A 3IHZA 4Z2HA 4DRIA 1TCOC 2D9FA 2OLHA 4Z2KA 5HBFA 3ARVA 2KGJA 4MSPA 3PRBA 2WLZA 3IKDA 3ARSA 1E6ZA 1W9VA 3AS0A 4ODRA 1FKKA 3FAPA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR6 A;  3O5L A;  3KAC A;  1L1P A;  3KCE A;  2PV3 A;  4QT2 A;  1F8A B;  1NSG A;  2ZQU A;  4ODQ A;  1F40 A;  4TYO A;  5BXJ A;  1J4H A;  4TNS A;  1YW5 A;  4N19 A;  2PPN A;  3TDB A;  5GPG A;  4DZ2 A;  3JYJ A;  3O5R A;  3PRD A;  1QZ2 A;  3KAI A;  3O5G A;  1Q6H A;  3UQI A;  1NMV A;  1FKH A;  2PPP A;  5DIT A;  2Y78 A;  3CGM A;  4JYS A;  3UQB A;  2XPB A;  1Y0O A;  1R9H A;  1JVW A;  1FKR A;  4QIB A;  2XP6 A;  2KI3 A;  2LPV A;  2MF9 A;  5HW6 A;  1B6C A;  2MLY A;  3KAD A;  4IQC A;  4U86 A;  4DT4 A;  3H9R B;  4W9Q A;  1D7J A;  4ODM A;  5HT1 A;  2MPH A;  1J4R A;  3O5M A;  2XPA A;  5HKG A;  2FAP A;  4FN2 A;  3NRK A;  4J4O A;  4DRQ A;  1Q6U A;  2ZQV A;  4NNR A;  4JFJ A;  4IPX A;  5HW8 A;  1J4I A;  3O5J A;  1KT0 A;  1Q6I A;  3TC5 A;  1FJD A;  1ROT A;  4JFM A;  3RGC A;  1M5Y A;  1YAT A;  2N87 A;  3O5I A;  3CGN A;  3O5D A;  4ITZ A;  1W26 A;  3WH0 A;  3UQA A;  3JYM A;  4G50 A;  4W9O A;  3O5Q A;  2KR7 A;  2M1I A;  4TW6 A;  1PIN A;  3UI6 A;  4DRH A;  1BL4 A;  2KO7 A;  1FKL A;  2MLX A;  2VN1 A;  1KT1 A;  3NI6 A;  4LAV A;  4MGV A;  4LAW A;  4DRM A;  1NMW A;  3JXV A;  4R0X A;  5I98 A;  2XP4 A;  4J4N A;  3KAG A;  2M2A A;  2Q5A A;  4QT3 A;  1T11 A;  2RQS A;  2M08 A;  5HTG A;  4LAY A;  4ODL A;  4G2P A;  2AWG A;  1EYM A;  1ZK6 A;  3NTP A;  4IQ2 A;  2MLZ A;  1J6Y A;  2KE0 A;  1C9H A;  3TCZ A;  4W9P A;  2ZR5 A;  3UI4 A;  2RUD A;  4DRJ A;  2XP5 A;  1N1A A;  2DG4 A;  2ZR4 A;  2UZ5 A;  3I6C A;  3OOB A;  5DIV A;  4ODO A;  3UI5 A;  2FKE A;  3UF8 A;  2LJ4 A;  1ROU A;  2RSE A;  3O5K A;  4JFL A;  3VAW A;  1D6O A;  2PBC A;  5B8I C;  1EQ3 A;  5D75 A;  2OFN A;  3KAH A;  1FKF A;  2XP3 A;  1FKS A;  3O5O A;  2RUC A;  3IK8 A;  1FAP A;  1FKJ A;  2VCD A;  5HWC A;  3B7X A;  4BF8 A;  4TW7 A;  2F4E A;  2F2D A;  4LAX A;  2PV2 A;  3IKG A;  2LKN A;  4JFK A;  2XP9 A;  1BKF A;  2ZQS A;  3RFW A;  1HXV A;  3KZ7 A;  4DZ3 A;  2ITK A;  1FKB A;  3O5P A;  1QPF A;  4DRN A;  1D7H A;  2MNT A;  2RUR A;  3MDY B;  1D7I A;  4U84 A;  2RUQ A;  1FKG A;  3ODK A;  2JZV A;  1U79 A;  2KFW A;  3PA7 A;  4ODN A;  2LGO A;  4TX0 A;  4DRO A;  4FAP A;  5DIU A;  1FKT A;  2DG9 A;  4DH0 A;  2F21 A;  4JFI A;  1FKD A;  1Q1C A;  5J6E A;  1FD9 A;  3IHZ A;  4U85 A;  5HW7 A;  4DRI A;  1TCO C;  2D9F A;  4DIP A;  4ODK A;  2IF4 A;  3O5E A;  2XP8 A;  2PV1 A;  2ZQT A;  1JNS A;  4GIV A;  4TW8 A;  3GPK A;  2KGJ A;  2XP7 A;  2DG3 A;  1FKI A;  3O5F A;  3KAF A;  4MSP A;  4ODP A;  4GGQ A;  3PRB A;  4DRP A;  4C02 B;  2PPO A;  1P5Q A;  2K8I A;  2L2S A;  3LUO A;  1JNT A;  3IKD A;  4DRK A;  3KAB A;  3EY6 A;  1PBK A;  5HWB A;  4ODR A;  5HUA A;  1FKK A;  1QPL A;  3FAP A;  4O2T A;  1A7X A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 5GQB A;  3ARR A;  3O5L A;  5DF0 A;  2PV3 A;  1F8A B;  1F40 A;  4N19 A;  1JND A;  3WD1 A;  1LG1 A;  1ZBC A;  3PRD A;  3FY1 A;  3UQI A;  2PPP A;  1FKH A;  3CGM A;  4JYS A;  1FKR A;  4HBE A;  2XP6 A;  2LPV A;  1E6R A;  2MF9 A;  1HKM A;  2ESC A;  3KAD A;  2MLY A;  4U86 A;  3O5M A;  2YBU A;  1ZBK A;  2FAP A;  2ZQV A;  3GTY X;  4IPX A;  1KT0 A;  4Q22 A;  4JFM A;  1ITX A;  1W1V A;  3O5I A;  4ITZ A;  4DWS B;  3JYM A;  2DSV A;  3PRA A;  4G50 A;  2G8Z A;  3UI6 A;  1LJY A;  2KO7 A;  1GOI A;  4LAW A;  3JXV A;  4Q7N A;  4NSB A;  4P8X A;  1SYT A;  3NTP A;  3CHE A;  4Z2J A;  4IQ2 A;  2MLZ A;  4MNM A;  1GPF A;  1C9H A;  3UI4 A;  1E6P A;  2ZR5 A;  4DRJ A;  2ZR4 A;  5DIV A;  4ML4 A;  3UI5 A;  4AY1 A;  3UF8 A;  4MTV A;  3QOK A;  1TFV A;  3ALF A;  4S3J A;  1FAP A;  5HWC A;  1LL7 A;  3B7X A;  2G41 A;  2PV2 A;  4HAR A;  2YBT A;  1ZL1 A;  4FAP A;  1JCH B;  4QZV B;  4ZS6 A;  1Q1C A;  1FD9 A;  4U85 A;  1HKI A;  3O5E A;  3G6L A;  2XP8 A;  1JNS A;  4TW8 A;  4WJX A;  1LL4 A;  4DRK A;  1P5Q A;  2K8I A;  3EY6 A;  1PBK A;  5HWB A;  1QPL A;  4L72 B;  2O9O A;  4O2T A;  3ARY A;  2A3C A;  1L1P A;  2P4V A;  5GPR A;  3AS2 A;  1NSG A;  2ZQU A;  2DPE A;  1D2K A;  3AQU A;  3OA5 A;  2PPN A;  3TDB A;  3WD3 A;  1EDQ A;  4R5E A;  3ARU A;  3JYJ A;  4P8W A;  1GRJ A;  5DO2 A;  1SR0 A;  1R9H A;  1JVW A;  1W9P A;  1E9L A;  4QIB A;  2KI3 A;  1NWS A;  4DT4 A;  1X6L A;  1O6I A;  3WL0 A;  1J4R A;  2XPA A;  5HKG A;  4FN2 A;  3NRK A;  4DRQ A;  5HW8 A;  4KR0 B;  3RGC A;  1XHG A;  3CGN A;  3O5D A;  3UQA A;  1W26 A;  3O5Q A;  1W9U A;  4DRH A;  1PIN A;  2VN1 A;  1ZBV A;  1KT1 A;  5I98 A;  3PR9 A;  1NMW A;  4J4N A;  4QT3 A;  2Q5A A;  2O92 A;  4Z2G A;  2F23 A;  2IUZ A;  4W9P A;  1H0G A;  2DG4 A;  3OOB A;  2UZ5 A;  3I6C A;  3CHD A;  2FKE A;  1ROU A;  2RSE A;  3O5K A;  3VAW A;  1D6O A;  3ART A;  5B8I C;  1LL6 A;  3KAH A;  3WD4 A;  1FKF A;  3O5O A;  3WQV A;  3IK8 A;  3WL1 A;  1FKJ A;  2VCD A;  4S3K A;  3B8S A;  3B9A A;  4UDM A;  4DWS A;  4TW7 A;  2F2D A;  4LAX A;  1ZU8 A;  3RM4 A;  2XP9 A;  3RFW A;  1HXV A;  4DZ3 A;  3O5P A;  4U84 A;  4URI A;  2JZV A;  1U79 A;  2KFW A;  4TX0 A;  4DRO A;  1HKJ A;  1FKT A;  4JFI A;  1FKD A;  5HW7 A;  1E6N A;  2IF4 A;  4MPK A;  2PV1 A;  2DT3 A;  2ZQT A;  4IT4 A;  2XP7 A;  3O5F A;  2DG3 A;  4DRP A;  3RM8 A;  4C02 B;  3LUO A;  2L2S A;  1JNT A;  3KAB A;  4Z2L A;  1A7X A;  2DT2 A;  1UR8 A;  2ZR6 A;  3KAC A;  1EHN A;  1LQ0 A;  1JNE A;  4TYO A;  5BXJ A;  1WB0 A;  4TNS A;  1YW5 A;  3ALG A;  2PI6 A;  3WIJ A;  3KAI A;  1UR9 A;  1Q6H A;  1NMV A;  2Y78 A;  3UQB A;  4ZPT R;  3RME A;  1E44 A;  5HW6 A;  1W1Y A;  1B6C A;  4IQC A;  3H9R B;  2MPH A;  1W1T A;  2DT1 A;  3ARO A;  3W4R A;  1Q6U A;  4JFJ A;  3O5J A;  1VF8 A;  1ROT A;  1FJD A;  1YAT A;  2N87 A;  4ZPV R;  4MNK A;  1EIB A;  4WKF A;  2DSW A;  4TW6 A;  1BL4 A;  2MLX A;  3NI6 A;  3GU0 A;  2XP4 A;  2M2A A;  1T11 A;  2RQS A;  4L3N A;  5HTG A;  1HJX A;  4G2P A;  2AWG A;  1EYM A;  1J6Y A;  2KE0 A;  2RUD A;  2WM0 A;  1RD6 A;  1E15 A;  3B9D A;  2A3B A;  2DSZ A;  3ARW A;  4ODO A;  1OGG A;  3ARX A;  2LJ4 A;  4JFL A;  2PBC A;  1HKK A;  2FDM A;  2B5U B;  3CZ8 A;  3ARP A;  2XP3 A;  1FKS A;  4WIW A;  2RUC A;  4BF8 A;  3G6M A;  2F4E A;  1NWU A;  3IKG A;  1IX5 A;  3KZ7 A;  1QPF A;  1D7H A;  2MNT A;  4WKH A;  3MDY B;  4WK9 A;  3ARQ A;  3ODK A;  3BMB A;  4ODN A;  2LGO A;  1FFR A;  2DG9 A;  2F21 A;  5J6E A;  3RM9 A;  2PN0 A;  4DIP A;  4ODK A;  4DWS D;  4MNJ A;  4GIV A;  3GPK A;  1FKI A;  3KAF A;  4ODP A;  4GGQ A;  1W1P A;  4MNL A;  2PPO A;  1WAW A;  3ARZ A;  5HUA A;  3WD0 A;  4KQZ A;  3FXY A;  1OGB A;  3KCE A;  4QT2 A;  4ODQ A;  4WKA A;  1J4H A;  1OWQ A;  5GPG A;  4DZ2 A;  2WK2 A;  3EIP A;  3O5R A;  3B9E A;  1QZ2 A;  3O5G A;  2B31 A;  4HBO A;  1XRV A;  5DIT A;  1LG2 A;  2XPB A;  1Y0O A;  1H0I A;  2AOS A;  3CH9 A;  3WKZ A;  2DSU A;  4Z2I A;  4W9Q A;  1D7J A;  4ODM A;  5HT1 A;  2DT0 A;  3BXW A;  4J4O A;  4P8V A;  4LGX A;  4NNR A;  1HJW A;  2EUL A;  2A3A A;  1J4I A;  1FFQ A;  1Q6I A;  1HJV A;  3TC5 A;  1M5Y A;  3WH0 A;  2WLY A;  4NZC A;  4W9O A;  2KR7 A;  2M1I A;  4XAK A;  1FKL A;  4MGV A;  3CHF A;  4LAV A;  4DRM A;  4R0X A;  3WD2 A;  3KAG A;  1NWT A;  4MAV A;  1K9T A;  2M08 A;  4LAY A;  4ODL A;  1KFW A;  1ZK6 A;  4W5U A;  3AS1 A;  2QF8 A;  1CTN A;  1WNO A;  3TCZ A;  2A3E A;  5JH8 A;  2XP5 A;  1N1A A;  4IT6 A;  4P8U A;  1EQ3 A;  5D75 A;  1ZBW A;  2OFN A;  1ZB5 A;  4DWS C;  3WQW A;  1X6N A;  2LKN A;  3AS3 A;  4JFK A;  4PTM A;  1BKF A;  2ZQS A;  2ETN A;  1FKB A;  2ITK A;  4DRN A;  1GUV A;  2RUR A;  1D7I A;  2RUQ A;  1FKG A;  1NWR A;  4ZPW R;  5DEZ A;  3PA7 A;  1NH6 A;  5DIU A;  3CHC A;  4DH0 A;  3IHZ A;  4Z2H A;  4DRI A;  1TCO C;  2D9F A;  2OLH A;  4Z2K A;  5HBF A;  3ARV A;  2KGJ A;  4MSP A;  3PRB A;  2WLZ A;  3IKD A;  3ARS A;  1E6Z A;  1W9V A;  3AS0 A;  4ODR A;  1FKK A;  3FAP A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 5GQB A;  3ARR A;  3O5L A;  5DF0 A;  2PV3 A;  1F8A B;  1F40 A;  4N19 A;  1JND A;  3WD1 A;  1LG1 A;  1ZBC A;  3PRD A;  3FY1 A;  3UQI A;  2PPP A;  1FKH A;  3CGM A;  4JYS A;  1FKR A;  4HBE A;  2XP6 A;  2LPV A;  1E6R A;  2MF9 A;  1HKM A;  2ESC A;  3KAD A;  2MLY A;  4U86 A;  3O5M A;  2YBU A;  1ZBK A;  2FAP A;  2ZQV A;  4IPX A;  1KT0 A;  4Q22 A;  4JFM A;  1ITX A;  1W1V A;  3O5I A;  4ITZ A;  4DWS B;  3JYM A;  2DSV A;  3PRA A;  4G50 A;  2G8Z A;  3UI6 A;  1LJY A;  2KO7 A;  1GOI A;  4LAW A;  3JXV A;  4Q7N A;  4NSB A;  4P8X A;  1SYT A;  3NTP A;  3CHE A;  4Z2J A;  4IQ2 A;  2MLZ A;  4MNM A;  1GPF A;  1C9H A;  3UI4 A;  1E6P A;  2ZR5 A;  4DRJ A;  2ZR4 A;  5DIV A;  4ML4 A;  3UI5 A;  4AY1 A;  3UF8 A;  4MTV A;  3QOK A;  1TFV A;  3ALF A;  4S3J A;  1FAP A;  5HWC A;  1LL7 A;  3B7X A;  2G41 A;  2PV2 A;  4HAR A;  2YBT A;  1ZL1 A;  4FAP A;  4QZV B;  4ZS6 A;  1Q1C A;  1FD9 A;  4U85 A;  1HKI A;  3O5E A;  3G6L A;  2XP8 A;  1JNS A;  4TW8 A;  4WJX A;  1LL4 A;  4DRK A;  1P5Q A;  2K8I A;  3EY6 A;  1PBK A;  5HWB A;  1QPL A;  4L72 B;  2O9O A;  4O2T A;  3ARY A;  2A3C A;  1L1P A;  5GPR A;  3AS2 A;  1NSG A;  2ZQU A;  2DPE A;  1D2K A;  3AQU A;  3OA5 A;  2PPN A;  3TDB A;  3WD3 A;  1EDQ A;  4R5E A;  3ARU A;  3JYJ A;  4P8W A;  5DO2 A;  1SR0 A;  1R9H A;  1JVW A;  1W9P A;  1E9L A;  4QIB A;  2KI3 A;  1NWS A;  4DT4 A;  1X6L A;  1O6I A;  3WL0 A;  1J4R A;  2XPA A;  5HKG A;  4FN2 A;  3NRK A;  4DRQ A;  5HW8 A;  4KR0 B;  3RGC A;  1XHG A;  3CGN A;  3O5D A;  3UQA A;  1W26 A;  3O5Q A;  1W9U A;  4DRH A;  1PIN A;  2VN1 A;  1ZBV A;  1KT1 A;  5I98 A;  3PR9 A;  1NMW A;  4J4N A;  4QT3 A;  2Q5A A;  2O92 A;  4Z2G A;  2IUZ A;  4W9P A;  1H0G A;  2DG4 A;  3OOB A;  2UZ5 A;  3I6C A;  3CHD A;  2FKE A;  1ROU A;  2RSE A;  3O5K A;  3VAW A;  1D6O A;  3ART A;  5B8I C;  1LL6 A;  3KAH A;  3WD4 A;  1FKF A;  3O5O A;  3WQV A;  3IK8 A;  3WL1 A;  1FKJ A;  2VCD A;  4S3K A;  3B8S A;  3B9A A;  4DWS A;  4TW7 A;  2F2D A;  4LAX A;  1ZU8 A;  3RM4 A;  2XP9 A;  3RFW A;  1HXV A;  4DZ3 A;  3O5P A;  4U84 A;  4URI A;  2JZV A;  1U79 A;  2KFW A;  4TX0 A;  4DRO A;  1HKJ A;  1FKT A;  4JFI A;  1FKD A;  5HW7 A;  1E6N A;  2IF4 A;  4MPK A;  2PV1 A;  2DT3 A;  2ZQT A;  4IT4 A;  2XP7 A;  3O5F A;  2DG3 A;  4DRP A;  3RM8 A;  4C02 B;  3LUO A;  2L2S A;  1JNT A;  3KAB A;  4Z2L A;  1A7X A;  2DT2 A;  1UR8 A;  2ZR6 A;  3KAC A;  1EHN A;  1LQ0 A;  1JNE A;  4TYO A;  5BXJ A;  1WB0 A;  4TNS A;  1YW5 A;  3ALG A;  2PI6 A;  3WIJ A;  3KAI A;  1UR9 A;  1Q6H A;  1NMV A;  2Y78 A;  3UQB A;  4ZPT R;  3RME A;  5HW6 A;  1W1Y A;  1B6C A;  4IQC A;  3H9R B;  2MPH A;  1W1T A;  2DT1 A;  3ARO A;  3W4R A;  1Q6U A;  4JFJ A;  3O5J A;  1VF8 A;  1ROT A;  1FJD A;  1YAT A;  2N87 A;  4ZPV R;  4MNK A;  1EIB A;  4WKF A;  2DSW A;  4TW6 A;  1BL4 A;  2MLX A;  3NI6 A;  2XP4 A;  2M2A A;  1T11 A;  2RQS A;  4L3N A;  5HTG A;  1HJX A;  4G2P A;  2AWG A;  1EYM A;  1J6Y A;  2KE0 A;  2RUD A;  2WM0 A;  1RD6 A;  1E15 A;  3B9D A;  2A3B A;  2DSZ A;  3ARW A;  4ODO A;  1OGG A;  3ARX A;  2LJ4 A;  4JFL A;  2PBC A;  1HKK A;  2FDM A;  3CZ8 A;  3ARP A;  2XP3 A;  1FKS A;  4WIW A;  2RUC A;  4BF8 A;  3G6M A;  2F4E A;  1NWU A;  3IKG A;  1IX5 A;  3KZ7 A;  1QPF A;  1D7H A;  2MNT A;  4WKH A;  3MDY B;  4WK9 A;  3ARQ A;  3ODK A;  4ODN A;  2LGO A;  1FFR A;  2DG9 A;  2F21 A;  5J6E A;  3RM9 A;  4DIP A;  4ODK A;  4DWS D;  4MNJ A;  4GIV A;  3GPK A;  1FKI A;  3KAF A;  4ODP A;  4GGQ A;  1W1P A;  4MNL A;  2PPO A;  1WAW A;  3ARZ A;  5HUA A;  3WD0 A;  4KQZ A;  3FXY A;  1OGB A;  3KCE A;  4QT2 A;  4ODQ A;  4WKA A;  1J4H A;  1OWQ A;  5GPG A;  4DZ2 A;  2WK2 A;  3O5R A;  3B9E A;  1QZ2 A;  3O5G A;  2B31 A;  4HBO A;  1XRV A;  5DIT A;  1LG2 A;  2XPB A;  1Y0O A;  1H0I A;  2AOS A;  3CH9 A;  3WKZ A;  2DSU A;  4Z2I A;  4W9Q A;  1D7J A;  4ODM A;  5HT1 A;  2DT0 A;  3BXW A;  4J4O A;  4P8V A;  4LGX A;  4NNR A;  1HJW A;  2A3A A;  1J4I A;  1FFQ A;  1Q6I A;  1HJV A;  3TC5 A;  1M5Y A;  3WH0 A;  2WLY A;  4NZC A;  4W9O A;  2KR7 A;  2M1I A;  4XAK A;  1FKL A;  4MGV A;  3CHF A;  4LAV A;  4DRM A;  4R0X A;  3WD2 A;  3KAG A;  1NWT A;  4MAV A;  1K9T A;  2M08 A;  4LAY A;  4ODL A;  1KFW A;  1ZK6 A;  4W5U A;  3AS1 A;  2QF8 A;  1CTN A;  1WNO A;  3TCZ A;  2A3E A;  5JH8 A;  2XP5 A;  1N1A A;  4IT6 A;  4P8U A;  1EQ3 A;  5D75 A;  1ZBW A;  2OFN A;  1ZB5 A;  4DWS C;  3WQW A;  1X6N A;  2LKN A;  3AS3 A;  4JFK A;  4PTM A;  1BKF A;  2ZQS A;  1FKB A;  2ITK A;  4DRN A;  1GUV A;  2RUR A;  1D7I A;  2RUQ A;  1FKG A;  1NWR A;  4ZPW R;  5DEZ A;  3PA7 A;  1NH6 A;  5DIU A;  3CHC A;  4DH0 A;  3IHZ A;  4Z2H A;  4DRI A;  1TCO C;  2D9F A;  2OLH A;  4Z2K A;  5HBF A;  3ARV A;  2KGJ A;  4MSP A;  3PRB A;  2WLZ A;  3IKD A;  3ARS A;  1E6Z A;  1W9V A;  3AS0 A;  4ODR A;  1FKK A;  3FAP A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...