2LGOA

Solution nmr structure of a fkbp-type peptidyl-prolyl cis-trans isomerase from giardia lamblia, seattle structural genomics center for infectious disease target gilaa.00840.a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'MAHHHHHHMGTLEAQTQGPGSMSAQLEKKVLTPGDGVTKPQAGKKVTVHYDGRFPDGKQFDSSRSRGKPFQFTLGAGEVIKGWDQGVATMTLGEKALFTIPYQLAYGERGYPPVIPPKATLVFEVELLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP
publication title Solution structure of a putative FKBP-type peptidyl-propyl cis-trans isomerase from Giardia lamblia.
pubmed doi rcsb
source organism Giardia lamblia
molecule tags Isomerase
total genus 22
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lgoA00
3O5DA 4ODKA 4DRPA 4MSPA 2MLXA 4DRIA 1QZ2A 1FKHA 2PPPA 2XPBA 4LAYA 2LPVA 3RGCA 3KZ7A 3UQAA 4IPXA 5HW8A 1J4IA 2OFNA 2DG9A 1HXVA 1J4RA 5DITA 3NI6A 1Q6UA 5DIVA 4DZ3A 3UI4A 1FKFA 4ODOA 1R9HA 3I6CA 1T11A 1FKTA 4FN2A 1N1AA 2ZQTA 3B7XA 1Q6IA 3UF8A 1FKDA 1NMVA 3GPKA 1D6OA 4DRMA 3LUOA 2AWGA 4DRNA 1FKSA 3O5RA 3IK8A 4QT2A 1QPFA 3KAIA 2F4EA 1JVWA 3O5EA 4U86A 5HWCA 4DIPA 1KT0A 2MLZA 3FAPA 4NNRA 5HUAA 2RUCA 3KACA 3KADA 4U85A 3JYMA 4DRHA 1J6YA 2PV3A 2KR7A 2IF4A 2KO7A 4TW6A 1ROUA 3O5LA 1D7JA 3O5KA 4JFJA 5J6EA 4DRQA 4DROA 5HKGA 3JXVA 3KCEA 4JFMA 4LAWA 4QIBA 2ZQVA 3IHZA 3O5MA 4TNSA 1Q6HA 5HTGA 3CGMA 2XPAA 1BL4A 2ZQSA 4DRJA 1FAPA 4ODNA 1FKKA 2ZR6A 4W9OA 2N87A 1TCOC 2K8IA 1FD9A 4IQCA 3UI6A 1A7XA 3IKDA 5GPGA 1D7HA 2M2AA 4JFKA 4BF8A 4DZ2A 1F40A 2FAPA 5B8IC 4ITZA 2XP8A 5BXJA 5I98A 3WH0A 3O5PA 2XP3A 2JZVA 1NSGA 4LAXA 2DG3A 3NRKA 4FAPA 4N19A 4TW7A 4J4OA 2M08A 2XP4A 4QT3A 3O5OA 1M5YA 2XP6A 4JFIA 4DT4A 2RSEA 1ZCNA 2PPNA 5HW7A 2FKEA 1Q1CA 3ODKA 3O5FA 3UI5A 2PPOA 4DRKA 1FKIA 4MGVA 2PBCA 4JFLA 4TW8A 2F2DA 3OOBA 1YW5A 2RUDA 4J4NA 3PRBA 4JYSA 1F8AB 4ODMA 2KI3A 3TC5A 3UQBA 2KGJA 1Y0OA 1FJDA 2LKNA 2RUQA 2KE0A 1FKBA 3O5QA 1J4HA 2MF9A 2XP7A 3H9RB 3KABA 2KFWA 2D9FA 4U84A 1YATA 1FKGA 1U79A 2RURA 2MNTA 3O5GA 1PBKA 2RQSA 3KAFA 2Q5AA 1FKLA 4TX0A 1ZK6A 4IQ2A 3NTPA 3UQIA 2PV1A 4G2PA 1QPLA 3PA7A 2PV2A 1B6CA 1KT1A 2XP5A 4C02B 2DG4A 5HW6A 2MLYA 4ODQA 1FKRA 5DIUA 1PINA 2ITKA 3IKGA 5HWBA 2LJ4A 1EQ3A 3O5IA 4LAVA 2Y78A 3VAWA 4W9QA 2ZR5A 1P5QA 2L2SA 2XP9A 3CGNA 1EYMA 3MDYB 4DH0A 1JNSA 4O2TA 2LGOA 2ZQUA 1ROTA 4ODPA 3TDBA 4G50A 3KAGA 1D7IA 1W26A 4TYOA 3TCZA 3PRDA 4GIVA 3JYJA 2VCDA 5D75A 3O5JA 5HT1A 4ODLA 4R0XA 3EY6A 4ODRA 1NMWA 2VN1A 4GGQA 1BKFA 1FKJA 2M1IA 4W9PA 1L1PA 2MPHA 2ZR4A 2UZ5A 1C9HA 2F21A 3RFWA 3KAHA 1JNTA
chains in the Genus database with same CATH superfamily
4MSPA 1SYTA 1QZ2A 1W1VA 1GUVA 4Q22A 3UQAA 4MPKA 2B5UB 5HBFA 3ARTA 3PRAA 2B31A 1J4RA 1VF8A 3AS2A 1HXVA 4WK9A 4ODOA 4Z2KA 4FN2A 1FKDA 3GPKA 4DRMA 2DSZA 1FKSA 1JVWA 1TFVA 3EIPA 1SR0A 3O5EA 1W1PA 3FAPA 3KADA 3GTYX 3JYMA 2DPEA 2PV3A 1OGGA 1RD6A 3WD2A 3W4RA 4WKAA 4QIBA 3O5MA 2XPAA 2G41A 3CH9A 1FKKA 4ODNA 1FD9A 4IQCA 4DZ2A 1UR9A 1F40A 2FAPA 3G6LA 3WH0A 4FAPA 4TW7A 4J4OA 1W1TA 4QT3A 3O5OA 3FY1A 4JFIA 5DF0A 4DT4A 2PPNA 5HW7A 3UI5A 3ODKA 4MNJA 4DRKA 1FKIA 3AS3A 2DSWA 3UQBA 4Z2GA 2KGJA 1Y0OA 2RUQA 2XP7A 4Q7NA 2KFWA 2D9FA 4U84A 1FKLA 4IQ2A 1JNDA 3WIJA 1HKMA 3PA7A 2XP5A 4ODQA 2LJ4A 4DWSB 1O6IA 2WM0A 2ZR5A 1P5QA 1ROTA 4NZCA 4G50A 3KAGA 2VCDA 3O5JA 1ZBWA 3EY6A 3BMBA 3ARPA 5DIUA 2F21A 4KQZA 1JNTA 3TC5A 3O5DA 2XPBA 3RGCA 2LPVA 2DSVA 3KZ7A 1H0GA 4IPXA 5HW8A 4WKFA 2DT0A 2DG9A 3NI6A 4HARA 3WKZA 4DZ3A 1E9LA 1ZB5A 5GPRA 1FKTA 3UF8A 2ZQTA 1NMVA 1WB0A 1GPFA 1X6NA 1IX5A 1LJYA 4HBEA 1CTNA 2PI6A 2F4EA 5HWCA 4U86A 3B8SA 3ARRA 1NWRA 1KT0A 3CHFA 1ZL1A 2RUCA 3KACA 4DRHA 2WLZA 3O5LA 4JFJA 1ZBCA 1XHGA 4P8UA 4TNSA 1ITXA 1E44A 5DEZA 1WNOA 4BF8A 2K8IA 4ZS6A 4JFKA 2M2AA 3WD0A 4IT4A 5I98A 1LG1A 3O5PA 4P8XA 2JZVA 1NSGA 4LAXA 2DG3A 1LQ0A 2QF8A 2XP6A 1X6LA 2RSEA 2A3EA 1ZCNA 3O5FA 3WD1A 1KFWA 2PBCA 1YW5A 4MTVA 2KI3A 4NSBA 2ESCA 3CHCA 3O5QA 1LL4A 1J4HA 3RM4A 3CHDA 1LG2A 1FKGA 1U79A 4DWSD 1W9PA 3KAFA 2Q5AA 3ARSA 4TX0A 3NTPA 3ARUA 2PV1A 2DSUA 4G2PA 1QPLA 1B6CA 1KT1A 1W9VA 2DG4A 4MAVA 2MLYA 1FKRA 3IKGA 5HWBA 3O5IA 4LAVA 2Y78A 4XAKA 4W9QA 1H0IA 2XP9A 1WAWA 1EYMA 3MDYB 4ODPA 1GRJA 1D7IA 2PN0A 1HJWA 4GIVA 4R0XA 4W9PA 1FFQA 2VN1A 1BKFA 2ZR4A 5GQBA 4TW8A 4L3NA 1NH6A 3ALFA 4ODKA 4DRPA 4DRIA 2WK2A 1ZBKA 2P4VA 1J4IA 2OFNA 4URIA 4QZVB 5DIVA 3CHEA 1R9HA 1T11A 3ARXA 3RM8A 1D6OA 4ML4A 4Z2HA 3ALGA 1HKJA 4AY1A 1C9HA 1W9UA 3IK8A 1K9TA 1QPFA 1UR8A 3PR9A 4DIPA 2MLZA 4P8WA 2A3AA 2DT1A 1D2KA 3AS0A 4MNKA 4S3KA 2KR7A 2IF4A 4TW6A 3QOKA 1ROUA 2A3CA 1D7JA 3BXWA 5DO2A 3G6MA 4DROA 1FFRA 2F23A 3CZ8A 3KCEA 3CGMA 1BL4A 2ZQSA 1FAPA 2ZR6A 3UI6A 1TCOC 3AS1A 3ARYA 4ITZA 2XP8A 5BXJA 2XP3A 1E6RA 3B9DA 4ZPWR 2XP4A 4HBOA 2FKEA 1E6PA 2WLYA 3WD3A 4MGVA 2F2DA 2O9OA 3OOBA 4J4NA 3PRBA 1FJDA 2LKNA 3WL0A 2MF9A 3KABA 1YATA 4WJXA 4L72B 3O5GA 2RQSA 2DT3A 2PV2A 1W1YA 5HW6A 1EQ3A 1PINA 2ITKA 2YBTA 3FXYA 1NWSA 3VAWA 3B9EA 1EHNA 3CGNA 4O2TA 3TDBA 3ARVA 4TYOA 3TCZA 3PRDA 4Z2IA 3JYJA 5D75A 5HT1A 4ODLA 4ODRA 1FKJA 1L1PA 3RFWA 3KAHA 3RM9A 4KR0B 3WQVA 2AOSA 3ARWA 2MLXA 4LGXA 1FKHA 2PPPA 3ARQA 4LAYA 4UDMA 1NWTA 2G8ZA 1XRVA 5DITA 3RMEA 1Q6UA 3ARZA 4Z2JA 3UI4A 1FKFA 2ETNA 3I6CA 1N1AA 3B7XA 1Q6IA 3LUOA 2AWGA 4DRNA 3O5RA 1HJXA 4QT2A 3KAIA 3AROA 4Z2LA 4NNRA 3AQUA 5HUAA 1ZBVA 1J6YA 4U85A 2IUZA 4ZPTR 4WKHA 2KO7A 3OA5A 3O5KA 4R5EA 3WD4A 1JNEA 1GOIA 5J6EA 4DRQA 4DWSC 1E6ZA 5HKGA 1OWQA 3JXVA 4JFMA 4W5UA 4LAWA 2ZQVA 3IHZA 1Q6HA 5HTGA 1EDQA 4MNMA 4DRJA 3WQWA 1ZU8A 2OLHA 4W9OA 2N87A 1JCHB 1A7XA 1HJVA 3IKDA 4ZPVR 5GPGA 4DWSA 1D7HA 2DT2A 5B8IC 1EIBA 2EULA 3NRKA 4N19A 1NWUA 4S3JA 1M5YA 2YBUA 1Q1CA 2PPOA 4JFLA 2O92A 2RUDA 4JYSA 1F8AB 4ODMA 4PTMA 2KE0A 1FKBA 1LL6A 3H9RB 3GU0A 3B9AA 2RURA 2MNTA 3WL1A 1HKIA 1PBKA 1ZK6A 3UQIA 5JH8A 1E15A 2FDMA 4C02B 4MNLA 1HKKA 4IT6A 2L2SA 2A3BA 1LL7A 1E6NA 4WIWA 4DH0A 1JNSA 2LGOA 2ZQUA 1W26A 1NMWA 1OGBA 4GGQA 2M1IA 2MPHA 4P8VA 2UZ5A 2M08A
chains in the Genus database with same CATH topology
4MSPA 1SYTA 1QZ2A 1W1VA 1GUVA 4Q22A 3UQAA 4MPKA 5HBFA 3ARTA 3PRAA 2B31A 1J4RA 1VF8A 3AS2A 1HXVA 4WK9A 4ODOA 4Z2KA 4FN2A 1FKDA 3GPKA 4DRMA 2DSZA 1FKSA 1JVWA 1TFVA 3O5EA 1SR0A 1W1PA 3FAPA 3KADA 3JYMA 2DPEA 2PV3A 1OGGA 1RD6A 3WD2A 3W4RA 4WKAA 4QIBA 3O5MA 2XPAA 2G41A 3CH9A 1FKKA 4ODNA 1FD9A 4IQCA 4DZ2A 1UR9A 1F40A 2FAPA 3G6LA 3WH0A 4FAPA 4TW7A 4J4OA 1W1TA 4QT3A 3O5OA 3FY1A 4JFIA 5DF0A 4DT4A 2PPNA 5HW7A 3UI5A 3ODKA 4MNJA 4DRKA 1FKIA 3AS3A 2DSWA 3UQBA 4Z2GA 2KGJA 1Y0OA 2RUQA 2XP7A 4Q7NA 2KFWA 2D9FA 4U84A 1FKLA 4IQ2A 1JNDA 3WIJA 1HKMA 3PA7A 2XP5A 4ODQA 2LJ4A 4DWSB 1O6IA 2WM0A 2ZR5A 1P5QA 1ROTA 4NZCA 4G50A 3KAGA 2VCDA 3O5JA 1ZBWA 3EY6A 3ARPA 5DIUA 2F21A 4KQZA 1JNTA 3TC5A 3O5DA 2XPBA 3RGCA 2LPVA 2DSVA 3KZ7A 1H0GA 4IPXA 5HW8A 4WKFA 2DT0A 2DG9A 3NI6A 4HARA 3WKZA 4DZ3A 1E9LA 1ZB5A 5GPRA 1FKTA 3UF8A 2ZQTA 1NMVA 1WB0A 1GPFA 1X6NA 1IX5A 1LJYA 4HBEA 1CTNA 2PI6A 2F4EA 5HWCA 4U86A 3B8SA 3ARRA 1NWRA 1KT0A 3CHFA 1ZL1A 2RUCA 3KACA 4DRHA 2WLZA 3O5LA 4JFJA 1ZBCA 1XHGA 4P8UA 4TNSA 1ITXA 5DEZA 1WNOA 4BF8A 2K8IA 4ZS6A 4JFKA 2M2AA 3WD0A 4IT4A 5I98A 1LG1A 3O5PA 4P8XA 2JZVA 1NSGA 4LAXA 2DG3A 1LQ0A 2QF8A 2XP6A 1X6LA 2RSEA 2A3EA 1ZCNA 3O5FA 3WD1A 1KFWA 2PBCA 1YW5A 4MTVA 2KI3A 4NSBA 2ESCA 3CHCA 3O5QA 1LL4A 1J4HA 3RM4A 3CHDA 1LG2A 1FKGA 1U79A 4DWSD 1W9PA 3KAFA 2Q5AA 3ARSA 4TX0A 3NTPA 3ARUA 2PV1A 2DSUA 4G2PA 1QPLA 1B6CA 1KT1A 1W9VA 2DG4A 4MAVA 2MLYA 1FKRA 3IKGA 5HWBA 3O5IA 4LAVA 2Y78A 4XAKA 4W9QA 1H0IA 2XP9A 1WAWA 1EYMA 3MDYB 4ODPA 1D7IA 1HJWA 4GIVA 4R0XA 4W9PA 1FFQA 2VN1A 1BKFA 2ZR4A 5GQBA 4TW8A 4L3NA 1NH6A 3ALFA 4ODKA 4DRPA 4DRIA 2WK2A 1ZBKA 1J4IA 2OFNA 4URIA 4QZVB 5DIVA 3CHEA 1R9HA 1T11A 3ARXA 3RM8A 1D6OA 4ML4A 4Z2HA 3ALGA 1HKJA 4AY1A 1C9HA 1W9UA 3IK8A 1K9TA 1QPFA 1UR8A 3PR9A 4DIPA 2MLZA 4P8WA 2A3AA 2DT1A 1D2KA 3AS0A 4MNKA 4S3KA 2KR7A 2IF4A 4TW6A 3QOKA 1ROUA 2A3CA 1D7JA 3BXWA 5DO2A 3G6MA 4DROA 1FFRA 3CZ8A 3KCEA 3CGMA 1BL4A 2ZQSA 1FAPA 2ZR6A 3UI6A 1TCOC 3AS1A 3ARYA 4ITZA 2XP8A 5BXJA 2XP3A 1E6RA 3B9DA 4ZPWR 2XP4A 4HBOA 2FKEA 1E6PA 2WLYA 3WD3A 4MGVA 2F2DA 2O9OA 3OOBA 4J4NA 3PRBA 1FJDA 2LKNA 3WL0A 2MF9A 3KABA 1YATA 4WJXA 4L72B 3O5GA 2RQSA 2DT3A 2PV2A 1W1YA 5HW6A 1EQ3A 1PINA 2ITKA 2YBTA 3FXYA 1NWSA 3VAWA 3B9EA 1EHNA 3CGNA 4O2TA 3TDBA 3ARVA 4TYOA 3TCZA 3PRDA 4Z2IA 3JYJA 5D75A 5HT1A 4ODLA 4ODRA 1FKJA 1L1PA 3RFWA 3KAHA 3RM9A 4KR0B 3WQVA 2AOSA 3ARWA 2MLXA 4LGXA 1FKHA 2PPPA 3ARQA 4LAYA 1NWTA 2G8ZA 1XRVA 5DITA 3RMEA 1Q6UA 3ARZA 4Z2JA 3UI4A 1FKFA 3I6CA 1N1AA 3B7XA 1Q6IA 3LUOA 2AWGA 4DRNA 3O5RA 1HJXA 4QT2A 3KAIA 3AROA 4Z2LA 4NNRA 3AQUA 5HUAA 1ZBVA 1J6YA 4U85A 2IUZA 4ZPTR 4WKHA 2KO7A 3OA5A 3O5KA 4R5EA 3WD4A 1JNEA 1GOIA 5J6EA 4DRQA 4DWSC 1E6ZA 5HKGA 1OWQA 3JXVA 4JFMA 4W5UA 4LAWA 2ZQVA 3IHZA 1Q6HA 5HTGA 1EDQA 4MNMA 4DRJA 3WQWA 1ZU8A 2OLHA 4W9OA 2N87A 1A7XA 1HJVA 3IKDA 4ZPVR 5GPGA 4DWSA 1D7HA 2DT2A 5B8IC 1EIBA 3NRKA 4N19A 1NWUA 4S3JA 1M5YA 2YBUA 1Q1CA 2PPOA 4JFLA 2O92A 2RUDA 4JYSA 1F8AB 4ODMA 4PTMA 2KE0A 1FKBA 1LL6A 3H9RB 3B9AA 2RURA 2MNTA 3WL1A 1HKIA 1PBKA 1ZK6A 3UQIA 5JH8A 1E15A 2FDMA 4C02B 4MNLA 1HKKA 4IT6A 2L2SA 2A3BA 1LL7A 1E6NA 4WIWA 4DH0A 1JNSA 2LGOA 2ZQUA 1W26A 1NMWA 1OGBA 4GGQA 2M1IA 2MPHA 4P8VA 2UZ5A 2M08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5D A;  4ODK A;  4DRP A;  4MSP A;  2MLX A;  4DRI A;  1QZ2 A;  1FKH A;  2PPP A;  2XPB A;  4LAY A;  2LPV A;  3RGC A;  3KZ7 A;  3UQA A;  4IPX A;  5HW8 A;  1J4I A;  2OFN A;  2DG9 A;  1HXV A;  1J4R A;  5DIT A;  3NI6 A;  1Q6U A;  5DIV A;  4DZ3 A;  3UI4 A;  1FKF A;  4ODO A;  1R9H A;  3I6C A;  1T11 A;  1FKT A;  4FN2 A;  1N1A A;  2ZQT A;  3B7X A;  1Q6I A;  3UF8 A;  1FKD A;  1NMV A;  3GPK A;  1D6O A;  4DRM A;  3LUO A;  2AWG A;  4DRN A;  1FKS A;  3O5R A;  3IK8 A;  4QT2 A;  1QPF A;  3KAI A;  2F4E A;  1JVW A;  3O5E A;  4U86 A;  5HWC A;  4DIP A;  1KT0 A;  2MLZ A;  3FAP A;  4NNR A;  5HUA A;  2RUC A;  3KAC A;  3KAD A;  4U85 A;  3JYM A;  4DRH A;  1J6Y A;  2PV3 A;  2KR7 A;  2IF4 A;  2KO7 A;  4TW6 A;  1ROU A;  3O5L A;  1D7J A;  3O5K A;  4JFJ A;  5J6E A;  4DRQ A;  4DRO A;  5HKG A;  3JXV A;  3KCE A;  4JFM A;  4LAW A;  4QIB A;  2ZQV A;  3IHZ A;  3O5M A;  4TNS A;  1Q6H A;  5HTG A;  3CGM A;  2XPA A;  1BL4 A;  2ZQS A;  4DRJ A;  1FAP A;  4ODN A;  1FKK A;  2ZR6 A;  4W9O A;  2N87 A;  1TCO C;  2K8I A;  1FD9 A;  4IQC A;  3UI6 A;  1A7X A;  3IKD A;  5GPG A;  1D7H A;  2M2A A;  4JFK A;  4BF8 A;  4DZ2 A;  1F40 A;  2FAP A;  5B8I C;  4ITZ A;  2XP8 A;  5BXJ A;  5I98 A;  3WH0 A;  3O5P A;  2XP3 A;  2JZV A;  1NSG A;  4LAX A;  2DG3 A;  3NRK A;  4FAP A;  4N19 A;  4TW7 A;  4J4O A;  2M08 A;  2XP4 A;  4QT3 A;  3O5O A;  1M5Y A;  2XP6 A;  4JFI A;  4DT4 A;  2RSE A;  1ZCN A;  2PPN A;  5HW7 A;  2FKE A;  1Q1C A;  3ODK A;  3O5F A;  3UI5 A;  2PPO A;  4DRK A;  1FKI A;  4MGV A;  2PBC A;  4JFL A;  4TW8 A;  2F2D A;  3OOB A;  1YW5 A;  2RUD A;  4J4N A;  3PRB A;  4JYS A;  1F8A B;  4ODM A;  2KI3 A;  3TC5 A;  3UQB A;  2KGJ A;  1Y0O A;  1FJD A;  2LKN A;  2RUQ A;  2KE0 A;  1FKB A;  3O5Q A;  1J4H A;  2MF9 A;  2XP7 A;  3H9R B;  3KAB A;  2KFW A;  2D9F A;  4U84 A;  1YAT A;  1FKG A;  1U79 A;  2RUR A;  2MNT A;  3O5G A;  1PBK A;  2RQS A;  3KAF A;  2Q5A A;  1FKL A;  4TX0 A;  1ZK6 A;  4IQ2 A;  3NTP A;  3UQI A;  2PV1 A;  4G2P A;  1QPL A;  3PA7 A;  2PV2 A;  1B6C A;  1KT1 A;  2XP5 A;  4C02 B;  2DG4 A;  5HW6 A;  2MLY A;  4ODQ A;  1FKR A;  5DIU A;  1PIN A;  2ITK A;  3IKG A;  5HWB A;  2LJ4 A;  1EQ3 A;  3O5I A;  4LAV A;  2Y78 A;  3VAW A;  4W9Q A;  2ZR5 A;  1P5Q A;  2L2S A;  2XP9 A;  3CGN A;  1EYM A;  3MDY B;  4DH0 A;  1JNS A;  4O2T A;  2LGO A;  2ZQU A;  1ROT A;  4ODP A;  3TDB A;  4G50 A;  3KAG A;  1D7I A;  1W26 A;  4TYO A;  3TCZ A;  3PRD A;  4GIV A;  3JYJ A;  2VCD A;  5D75 A;  3O5J A;  5HT1 A;  4ODL A;  4R0X A;  3EY6 A;  4ODR A;  1NMW A;  2VN1 A;  4GGQ A;  1BKF A;  1FKJ A;  2M1I A;  4W9P A;  1L1P A;  2MPH A;  2ZR4 A;  2UZ5 A;  1C9H A;  2F21 A;  3RFW A;  3KAH A;  1JNT A; 
#chains in the Genus database with same CATH topology
 4MSP A;  1SYT A;  1QZ2 A;  1W1V A;  1GUV A;  4Q22 A;  3UQA A;  4MPK A;  2B5U B;  5HBF A;  3ART A;  3PRA A;  2B31 A;  1J4R A;  1VF8 A;  3AS2 A;  1HXV A;  4WK9 A;  4ODO A;  4Z2K A;  4FN2 A;  1FKD A;  3GPK A;  4DRM A;  2DSZ A;  1FKS A;  1JVW A;  1TFV A;  3EIP A;  1SR0 A;  3O5E A;  1W1P A;  3FAP A;  3KAD A;  3GTY X;  3JYM A;  2DPE A;  2PV3 A;  1OGG A;  1RD6 A;  3WD2 A;  3W4R A;  4WKA A;  4QIB A;  3O5M A;  2XPA A;  2G41 A;  3CH9 A;  1FKK A;  4ODN A;  1FD9 A;  4IQC A;  4DZ2 A;  1UR9 A;  1F40 A;  2FAP A;  3G6L A;  3WH0 A;  4FAP A;  4TW7 A;  4J4O A;  1W1T A;  4QT3 A;  3O5O A;  3FY1 A;  4JFI A;  5DF0 A;  4DT4 A;  2PPN A;  5HW7 A;  3UI5 A;  3ODK A;  4MNJ A;  4DRK A;  1FKI A;  3AS3 A;  2DSW A;  3UQB A;  4Z2G A;  2KGJ A;  1Y0O A;  2RUQ A;  2XP7 A;  4Q7N A;  2KFW A;  2D9F A;  4U84 A;  1FKL A;  4IQ2 A;  1JND A;  3WIJ A;  1HKM A;  3PA7 A;  2XP5 A;  4ODQ A;  2LJ4 A;  4DWS B;  1O6I A;  2WM0 A;  2ZR5 A;  1P5Q A;  1ROT A;  4NZC A;  4G50 A;  3KAG A;  2VCD A;  3O5J A;  1ZBW A;  3EY6 A;  3BMB A;  3ARP A;  5DIU A;  2F21 A;  4KQZ A;  1JNT A;  3TC5 A;  3O5D A;  2XPB A;  3RGC A;  2LPV A;  2DSV A;  3KZ7 A;  1H0G A;  4IPX A;  5HW8 A;  4WKF A;  2DT0 A;  2DG9 A;  3NI6 A;  4HAR A;  3WKZ A;  4DZ3 A;  1E9L A;  1ZB5 A;  5GPR A;  1FKT A;  3UF8 A;  2ZQT A;  1NMV A;  1WB0 A;  1GPF A;  1X6N A;  1IX5 A;  1LJY A;  4HBE A;  1CTN A;  2PI6 A;  2F4E A;  5HWC A;  4U86 A;  3B8S A;  3ARR A;  1NWR A;  1KT0 A;  3CHF A;  1ZL1 A;  2RUC A;  3KAC A;  4DRH A;  2WLZ A;  3O5L A;  4JFJ A;  1ZBC A;  1XHG A;  4P8U A;  4TNS A;  1ITX A;  1E44 A;  5DEZ A;  1WNO A;  4BF8 A;  2K8I A;  4ZS6 A;  4JFK A;  2M2A A;  3WD0 A;  4IT4 A;  5I98 A;  1LG1 A;  3O5P A;  4P8X A;  2JZV A;  1NSG A;  4LAX A;  2DG3 A;  1LQ0 A;  2QF8 A;  2XP6 A;  1X6L A;  2RSE A;  2A3E A;  1ZCN A;  3O5F A;  3WD1 A;  1KFW A;  2PBC A;  1YW5 A;  4MTV A;  2KI3 A;  4NSB A;  2ESC A;  3CHC A;  3O5Q A;  1LL4 A;  1J4H A;  3RM4 A;  3CHD A;  1LG2 A;  1FKG A;  1U79 A;  4DWS D;  1W9P A;  3KAF A;  2Q5A A;  3ARS A;  4TX0 A;  3NTP A;  3ARU A;  2PV1 A;  2DSU A;  4G2P A;  1QPL A;  1B6C A;  1KT1 A;  1W9V A;  2DG4 A;  4MAV A;  2MLY A;  1FKR A;  3IKG A;  5HWB A;  3O5I A;  4LAV A;  2Y78 A;  4XAK A;  4W9Q A;  1H0I A;  2XP9 A;  1WAW A;  1EYM A;  3MDY B;  4ODP A;  1GRJ A;  1D7I A;  2PN0 A;  1HJW A;  4GIV A;  4R0X A;  4W9P A;  1FFQ A;  2VN1 A;  1BKF A;  2ZR4 A;  5GQB A;  4TW8 A;  4L3N A;  1NH6 A;  3ALF A;  4ODK A;  4DRP A;  4DRI A;  2WK2 A;  1ZBK A;  2P4V A;  1J4I A;  2OFN A;  4URI A;  4QZV B;  5DIV A;  3CHE A;  1R9H A;  1T11 A;  3ARX A;  3RM8 A;  1D6O A;  4ML4 A;  4Z2H A;  3ALG A;  1HKJ A;  4AY1 A;  1C9H A;  1W9U A;  3IK8 A;  1K9T A;  1QPF A;  1UR8 A;  3PR9 A;  4DIP A;  2MLZ A;  4P8W A;  2A3A A;  2DT1 A;  1D2K A;  3AS0 A;  4MNK A;  4S3K A;  2KR7 A;  2IF4 A;  4TW6 A;  3QOK A;  1ROU A;  2A3C A;  1D7J A;  3BXW A;  5DO2 A;  3G6M A;  4DRO A;  1FFR A;  2F23 A;  3CZ8 A;  3KCE A;  3CGM A;  1BL4 A;  2ZQS A;  1FAP A;  2ZR6 A;  3UI6 A;  1TCO C;  3AS1 A;  3ARY A;  4ITZ A;  2XP8 A;  5BXJ A;  2XP3 A;  1E6R A;  3B9D A;  4ZPW R;  2XP4 A;  4HBO A;  2FKE A;  1E6P A;  2WLY A;  3WD3 A;  4MGV A;  2F2D A;  2O9O A;  3OOB A;  4J4N A;  3PRB A;  1FJD A;  2LKN A;  3WL0 A;  2MF9 A;  3KAB A;  1YAT A;  4WJX A;  4L72 B;  3O5G A;  2RQS A;  2DT3 A;  2PV2 A;  1W1Y A;  5HW6 A;  1EQ3 A;  1PIN A;  2ITK A;  2YBT A;  3FXY A;  1NWS A;  3VAW A;  3B9E A;  1EHN A;  3CGN A;  4O2T A;  3TDB A;  3ARV A;  4TYO A;  3TCZ A;  3PRD A;  4Z2I A;  3JYJ A;  5D75 A;  5HT1 A;  4ODL A;  4ODR A;  1FKJ A;  1L1P A;  3RFW A;  3KAH A;  3RM9 A;  4KR0 B;  3WQV A;  2AOS A;  3ARW A;  2MLX A;  4LGX A;  1FKH A;  2PPP A;  3ARQ A;  4LAY A;  4UDM A;  1NWT A;  2G8Z A;  1XRV A;  5DIT A;  3RME A;  1Q6U A;  3ARZ A;  4Z2J A;  3UI4 A;  1FKF A;  2ETN A;  3I6C A;  1N1A A;  3B7X A;  1Q6I A;  3LUO A;  2AWG A;  4DRN A;  3O5R A;  1HJX A;  4QT2 A;  3KAI A;  3ARO A;  4Z2L A;  4NNR A;  3AQU A;  5HUA A;  1ZBV A;  1J6Y A;  4U85 A;  2IUZ A;  4ZPT R;  4WKH A;  2KO7 A;  3OA5 A;  3O5K A;  4R5E A;  3WD4 A;  1JNE A;  1GOI A;  5J6E A;  4DRQ A;  4DWS C;  1E6Z A;  5HKG A;  1OWQ A;  3JXV A;  4JFM A;  4W5U A;  4LAW A;  2ZQV A;  3IHZ A;  1Q6H A;  5HTG A;  1EDQ A;  4MNM A;  4DRJ A;  3WQW A;  1ZU8 A;  2OLH A;  4W9O A;  2N87 A;  1JCH B;  1A7X A;  1HJV A;  3IKD A;  4ZPV R;  5GPG A;  4DWS A;  1D7H A;  2DT2 A;  5B8I C;  1EIB A;  2EUL A;  3NRK A;  4N19 A;  1NWU A;  4S3J A;  1M5Y A;  2YBU A;  1Q1C A;  2PPO A;  4JFL A;  2O92 A;  2RUD A;  4JYS A;  1F8A B;  4ODM A;  4PTM A;  2KE0 A;  1FKB A;  1LL6 A;  3H9R B;  3GU0 A;  3B9A A;  2RUR A;  2MNT A;  3WL1 A;  1HKI A;  1PBK A;  1ZK6 A;  3UQI A;  5JH8 A;  1E15 A;  2FDM A;  4C02 B;  4MNL A;  1HKK A;  4IT6 A;  2L2S A;  2A3B A;  1LL7 A;  1E6N A;  4WIW A;  4DH0 A;  1JNS A;  2LGO A;  2ZQU A;  1W26 A;  1NMW A;  1OGB A;  4GGQ A;  2M1I A;  2MPH A;  4P8V A;  2UZ5 A;  2M08 A; 
#chains in the Genus database with same CATH homology
 4MSP A;  1SYT A;  1QZ2 A;  1W1V A;  1GUV A;  4Q22 A;  3UQA A;  4MPK A;  5HBF A;  3ART A;  3PRA A;  2B31 A;  1J4R A;  1VF8 A;  3AS2 A;  1HXV A;  4WK9 A;  4ODO A;  4Z2K A;  4FN2 A;  1FKD A;  3GPK A;  4DRM A;  2DSZ A;  1FKS A;  1JVW A;  1TFV A;  3O5E A;  1SR0 A;  1W1P A;  3FAP A;  3KAD A;  3JYM A;  2DPE A;  2PV3 A;  1OGG A;  1RD6 A;  3WD2 A;  3W4R A;  4WKA A;  4QIB A;  3O5M A;  2XPA A;  2G41 A;  3CH9 A;  1FKK A;  4ODN A;  1FD9 A;  4IQC A;  4DZ2 A;  1UR9 A;  1F40 A;  2FAP A;  3G6L A;  3WH0 A;  4FAP A;  4TW7 A;  4J4O A;  1W1T A;  4QT3 A;  3O5O A;  3FY1 A;  4JFI A;  5DF0 A;  4DT4 A;  2PPN A;  5HW7 A;  3UI5 A;  3ODK A;  4MNJ A;  4DRK A;  1FKI A;  3AS3 A;  2DSW A;  3UQB A;  4Z2G A;  2KGJ A;  1Y0O A;  2RUQ A;  2XP7 A;  4Q7N A;  2KFW A;  2D9F A;  4U84 A;  1FKL A;  4IQ2 A;  1JND A;  3WIJ A;  1HKM A;  3PA7 A;  2XP5 A;  4ODQ A;  2LJ4 A;  4DWS B;  1O6I A;  2WM0 A;  2ZR5 A;  1P5Q A;  1ROT A;  4NZC A;  4G50 A;  3KAG A;  2VCD A;  3O5J A;  1ZBW A;  3EY6 A;  3ARP A;  5DIU A;  2F21 A;  4KQZ A;  1JNT A;  3TC5 A;  3O5D A;  2XPB A;  3RGC A;  2LPV A;  2DSV A;  3KZ7 A;  1H0G A;  4IPX A;  5HW8 A;  4WKF A;  2DT0 A;  2DG9 A;  3NI6 A;  4HAR A;  3WKZ A;  4DZ3 A;  1E9L A;  1ZB5 A;  5GPR A;  1FKT A;  3UF8 A;  2ZQT A;  1NMV A;  1WB0 A;  1GPF A;  1X6N A;  1IX5 A;  1LJY A;  4HBE A;  1CTN A;  2PI6 A;  2F4E A;  5HWC A;  4U86 A;  3B8S A;  3ARR A;  1NWR A;  1KT0 A;  3CHF A;  1ZL1 A;  2RUC A;  3KAC A;  4DRH A;  2WLZ A;  3O5L A;  4JFJ A;  1ZBC A;  1XHG A;  4P8U A;  4TNS A;  1ITX A;  5DEZ A;  1WNO A;  4BF8 A;  2K8I A;  4ZS6 A;  4JFK A;  2M2A A;  3WD0 A;  4IT4 A;  5I98 A;  1LG1 A;  3O5P A;  4P8X A;  2JZV A;  1NSG A;  4LAX A;  2DG3 A;  1LQ0 A;  2QF8 A;  2XP6 A;  1X6L A;  2RSE A;  2A3E A;  1ZCN A;  3O5F A;  3WD1 A;  1KFW A;  2PBC A;  1YW5 A;  4MTV A;  2KI3 A;  4NSB A;  2ESC A;  3CHC A;  3O5Q A;  1LL4 A;  1J4H A;  3RM4 A;  3CHD A;  1LG2 A;  1FKG A;  1U79 A;  4DWS D;  1W9P A;  3KAF A;  2Q5A A;  3ARS A;  4TX0 A;  3NTP A;  3ARU A;  2PV1 A;  2DSU A;  4G2P A;  1QPL A;  1B6C A;  1KT1 A;  1W9V A;  2DG4 A;  4MAV A;  2MLY A;  1FKR A;  3IKG A;  5HWB A;  3O5I A;  4LAV A;  2Y78 A;  4XAK A;  4W9Q A;  1H0I A;  2XP9 A;  1WAW A;  1EYM A;  3MDY B;  4ODP A;  1D7I A;  1HJW A;  4GIV A;  4R0X A;  4W9P A;  1FFQ A;  2VN1 A;  1BKF A;  2ZR4 A;  5GQB A;  4TW8 A;  4L3N A;  1NH6 A;  3ALF A;  4ODK A;  4DRP A;  4DRI A;  2WK2 A;  1ZBK A;  1J4I A;  2OFN A;  4URI A;  4QZV B;  5DIV A;  3CHE A;  1R9H A;  1T11 A;  3ARX A;  3RM8 A;  1D6O A;  4ML4 A;  4Z2H A;  3ALG A;  1HKJ A;  4AY1 A;  1C9H A;  1W9U A;  3IK8 A;  1K9T A;  1QPF A;  1UR8 A;  3PR9 A;  4DIP A;  2MLZ A;  4P8W A;  2A3A A;  2DT1 A;  1D2K A;  3AS0 A;  4MNK A;  4S3K A;  2KR7 A;  2IF4 A;  4TW6 A;  3QOK A;  1ROU A;  2A3C A;  1D7J A;  3BXW A;  5DO2 A;  3G6M A;  4DRO A;  1FFR A;  3CZ8 A;  3KCE A;  3CGM A;  1BL4 A;  2ZQS A;  1FAP A;  2ZR6 A;  3UI6 A;  1TCO C;  3AS1 A;  3ARY A;  4ITZ A;  2XP8 A;  5BXJ A;  2XP3 A;  1E6R A;  3B9D A;  4ZPW R;  2XP4 A;  4HBO A;  2FKE A;  1E6P A;  2WLY A;  3WD3 A;  4MGV A;  2F2D A;  2O9O A;  3OOB A;  4J4N A;  3PRB A;  1FJD A;  2LKN A;  3WL0 A;  2MF9 A;  3KAB A;  1YAT A;  4WJX A;  4L72 B;  3O5G A;  2RQS A;  2DT3 A;  2PV2 A;  1W1Y A;  5HW6 A;  1EQ3 A;  1PIN A;  2ITK A;  2YBT A;  3FXY A;  1NWS A;  3VAW A;  3B9E A;  1EHN A;  3CGN A;  4O2T A;  3TDB A;  3ARV A;  4TYO A;  3TCZ A;  3PRD A;  4Z2I A;  3JYJ A;  5D75 A;  5HT1 A;  4ODL A;  4ODR A;  1FKJ A;  1L1P A;  3RFW A;  3KAH A;  3RM9 A;  4KR0 B;  3WQV A;  2AOS A;  3ARW A;  2MLX A;  4LGX A;  1FKH A;  2PPP A;  3ARQ A;  4LAY A;  1NWT A;  2G8Z A;  1XRV A;  5DIT A;  3RME A;  1Q6U A;  3ARZ A;  4Z2J A;  3UI4 A;  1FKF A;  3I6C A;  1N1A A;  3B7X A;  1Q6I A;  3LUO A;  2AWG A;  4DRN A;  3O5R A;  1HJX A;  4QT2 A;  3KAI A;  3ARO A;  4Z2L A;  4NNR A;  3AQU A;  5HUA A;  1ZBV A;  1J6Y A;  4U85 A;  2IUZ A;  4ZPT R;  4WKH A;  2KO7 A;  3OA5 A;  3O5K A;  4R5E A;  3WD4 A;  1JNE A;  1GOI A;  5J6E A;  4DRQ A;  4DWS C;  1E6Z A;  5HKG A;  1OWQ A;  3JXV A;  4JFM A;  4W5U A;  4LAW A;  2ZQV A;  3IHZ A;  1Q6H A;  5HTG A;  1EDQ A;  4MNM A;  4DRJ A;  3WQW A;  1ZU8 A;  2OLH A;  4W9O A;  2N87 A;  1A7X A;  1HJV A;  3IKD A;  4ZPV R;  5GPG A;  4DWS A;  1D7H A;  2DT2 A;  5B8I C;  1EIB A;  3NRK A;  4N19 A;  1NWU A;  4S3J A;  1M5Y A;  2YBU A;  1Q1C A;  2PPO A;  4JFL A;  2O92 A;  2RUD A;  4JYS A;  1F8A B;  4ODM A;  4PTM A;  2KE0 A;  1FKB A;  1LL6 A;  3H9R B;  3B9A A;  2RUR A;  2MNT A;  3WL1 A;  1HKI A;  1PBK A;  1ZK6 A;  3UQI A;  5JH8 A;  1E15 A;  2FDM A;  4C02 B;  4MNL A;  1HKK A;  4IT6 A;  2L2S A;  2A3B A;  1LL7 A;  1E6N A;  4WIW A;  4DH0 A;  1JNS A;  2LGO A;  2ZQU A;  1W26 A;  1NMW A;  1OGB A;  4GGQ A;  2M1I A;  2MPH A;  4P8V A;  2UZ5 A;  2M08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...