2LGOA

Solution nmr structure of a fkbp-type peptidyl-prolyl cis-trans isomerase from giardia lamblia, seattle structural genomics center for infectious disease target gilaa.00840.a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
MAHHHHHHMGTLEAQTQGPGSMSAQLEKKVLTPGDGVTKPQAGKKVTVHYDGRFPDGKQFDSSRSRGKPFQFTLGAGEVIKGWDQGVATMTLGEKALFTIPYQLAYGERGYPPVIPPKATLVFEVELLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP
publication title Solution structure of a putative FKBP-type peptidyl-propyl cis-trans isomerase from Giardia lamblia.
pubmed doi rcsb
source organism Giardia lamblia
molecule tags Isomerase
total genus 22
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lgoA00
3O5IA 4ODRA 1BKFA 1FKHA 1EQ3A 1FKDA 3O5MA 3O5EA 2XP7A 2PPPA 2LJ4A 2F2DA 1D7HA 2L2SA 1FKSA 2PV3A 2ZR6A 4QT2A 2FAPA 2XP9A 1HXVA 5HW8A 2PV1A 5HT1A 3UQBA 2RUCA 2MLZA 4ODNA 2MLXA 5I98A 2PBCA 5HKGA 1FKKA 3H9RB 2IF4A 4DROA 2D9FA 2KGJA 2JZVA 3O5OA 3PRDA 4O2TA 4ODQA 3KACA 4ODPA 3RGCA 4DRHA 1A7XA 4TW8A 3O5LA 1U79A 2LPVA 3B7XA 1W26A 2VN1A 3VAWA 3JYMA 3TCZA 3IHZA 2Y78A 4J4NA 4TW7A 4DT4A 2ZQUA 4DRNA 3GPKA 4ODLA 1JNTA 1L1PA 2MPHA 5GPGA 5DIUA 1YW5A 5HTGA 3NRKA 1NSGA 3O5DA 4W9PA 3UQIA 1TCOC 2ITKA 3O5RA 1J6YA 3O5GA 1P5QA 1QZ2A 4ODOA 3UI5A 4QIBA 1FKBA 1ROUA 4DH0A 3IKDA 3KAIA 3KZ7A 1Q1CA 1QPFA 3FAPA 1ROTA 3CGNA 4U85A 5D75A 3RFWA 4FAPA 5DIVA 3IK8A 4IQCA 3IKGA 1D7IA 3UQAA 1M5YA 4DZ3A 4JFKA 1J4RA 2XP4A 3KAFA 4C02B 3KAHA 4JFJA 1D6OA 1QPLA 1PBKA 3LUOA 4IQ2A 2RQSA 4ODKA 4MGVA 1F8AB 4JFIA 1C9HA 2KR7A 2DG9A 4JYSA 2ZQTA 2XP8A 2F21A 3O5QA 3PA7A 1KT0A 3EY6A 1PINA 4DRMA 2ZQVA 1Q6UA 3KAGA 1R9HA 3O5FA 4LAWA 2N87A 4GGQA 2VCDA 4MSPA 1Q6IA 1Q6HA 3O5JA 4ITZA 1B6CA 1J4HA 4N19A 4TW6A 5HW6A 2LGOA 3NTPA 2RSEA 2M08A 4R0XA 4IPXA 2MLYA 4GIVA 3WH0A 1Y0OA 3CGMA 4W9QA 4DIPA 2M1IA 1KT1A 3JYJA 2ZQSA 3NI6A 2PPOA 4DRIA 4G2PA 2DG4A 2XPBA 1FKFA 4BF8A 2ZR4A 3MDYB 1T11A 4JFLA 1FJDA 3I6CA 4QT3A 4TNSA 2AWGA 1NMWA 2KI3A 2PPNA 4DRKA 4J4OA 2MF9A 1FKRA 2OFNA 1ZK6A 4U84A 5BXJA 2MNTA 1FAPA 2FKEA 1J4IA 2RUDA 4TX0A 1FKLA 5B8IC 1FKIA 3OOBA 4LAVA 2ZR5A 4LAXA 1FKTA 2RUQA 3JXVA 1ZCNA 1JVWA 3KABA 3PRBA 4W9OA 2UZ5A 1YATA 1JNSA 3ODKA 2K8IA 2DG3A 2XP6A 4DZ2A 4LAYA 1FKJA 2PV2A 3TC5A 1D7JA 1BL4A 4G50A 5HW7A 4DRQA 1EYMA 1F40A 2XPAA 1NMVA 3UI6A 3UF8A 4DRPA 5J6EA 3O5PA 5DITA 2KO7A 2RURA 3KADA 3UI4A 1FD9A 1N1AA 2KE0A 3KCEA 5HWBA 3O5KA 2M2AA 3TDBA 4DRJA 4NNRA 2KFWA 4FN2A 4JFMA 4TYOA 4U86A 5HUAA 2XP5A 2F4EA 1FKGA 4ODMA 2LKNA 5HWCA 2XP3A 2Q5AA
chains in the Genus database with same CATH superfamily
4ODRA 4ZPVR 1BKFA 3O5EA 1TFVA 4DWSB 2F2DA 4QT2A 4P8VA 1E6NA 2WK2A 2RUCA 2MLZA 4Z2GA 4S3KA 2A3AA 3H9RB 1ZBWA 2IF4A 2JZVA 3W4RA 4O2TA 1W9VA 1W1YA 1HKMA 4DRHA 4R5EA 1LG2A 4MNLA 2ZQUA 4DRNA 3B9AA 2DSUA 4MAVA 1JNTA 3WKZA 1L1PA 5DIUA 4Q22A 1HJWA 4ODOA 1K9TA 1ROUA 2P4VA 4DH0A 3KZ7A 1E9LA 3CGNA 3RFWA 2AOSA 1O6IA 5D75A 4FAPA 1ZBVA 4IQCA 3IKGA 3RM9A 4Z2IA 4DZ3A 1JNDA 1ZBCA 3RM8A 1W1TA 1W9UA 1D6OA 1QPLA 4IQ2A 4QIBA 2RQSA 2DG9A 1ZL1A 1KT0A 3EY6A 3RM4A 2ZQVA 3WD1A 1R9HA 2N87A 3ARQA 4GGQA 3WQWA 1B6CA 2RSEA 4IPXA 2MLYA 3WIJA 4DIPA 1WNOA 4NZCA 4G2PA 3FY1A 4Z2LA 1HJXA 3I6CA 4TNSA 1FJDA 3AS3A 4U84A 4MNKA 1JCHB 1FAPA 5BXJA 4TX0A 5B8IC 3OOBA 4LAVA 2ZR5A 5HBFA 2RUQA 3JXVA 4IT4A 3AROA 4L3NA 3G6MA 1FFRA 2DG3A 4LAYA 1FKJA 1BL4A 5HW7A 1F40A 4DRPA 2DT2A 2A3CA 2KO7A 2RURA 3KADA 1FD9A 1GUVA 3KCEA 2OLHA 3ARUA 4NNRA 4U86A 3CHEA 1NWRA 4HARA 4QT3A 3CH9A 3O5MA 2PPPA 2F23A 1GOIA 2L2SA 5GQBA 1HXVA 1W1PA 1LL4A 2WLZA 2PBCA 5HKGA 1E6ZA 3PRDA 4P8UA 3CHFA 3RGCA 2ETNA 1FFQA 3ARZA 4WIWA 4DWSC 4TW8A 3O5LA 1GPFA 3B7XA 3VAWA 3TCZA 2DT0A 2Y78A 4J4NA 4MNJA 4DT4A 3ALGA 1NSGA 3B9DA 3O5DA 4W9PA 1TCOC 2ITKA 4Z2KA 3WL0A 1LL6A 3IKDA 2O9OA 1QPFA 4WJXA 1ROTA 2B5UB 5DF0A 4P8XA 1E6PA 3PRAA 1J4RA 1ZU8A 4JYSA 2XP8A 3O5QA 3PA7A 1E15A 3KAGA 5DO2A 3O5FA 1OWQA 4N19A 4ITZA 4MPKA 2LGOA 3ARTA 1EDQA 3CHDA 3WH0A 4W9QA 2WM0A 3WD2A 5DEZA 2ZQSA 2PPOA 4DRIA 4XAKA 2ZR4A 2O92A 1T11A 3MDYB 4JFLA 2AWGA 2KI3A 1GRJA 2MF9A 2OFNA 1ZK6A 2YBTA 4L72B 2RUDA 3RMEA 1LQ0A 3ARPA 1FKTA 3ARWA 4ML4A 1LJYA 4URIA 1HJVA 2DSZA 1JNEA 4WKHA 4W5UA 3O5PA 1H0IA 2IUZA 5HUAA 2KE0A 4DRJA 2M2AA 2KFWA 4FN2A 2G41A 2ESCA 2XP5A 1FKGA 4ODMA 1CTNA 1EQ3A 1HKKA 1UR9A 3QOKA 1FKDA 2EULA 1D7HA 1FKSA 2ZR6A 2FAPA 1XHGA 5HW8A 2PV1A 2MLXA 4DROA 2D9FA 4ODQA 3B9EA 2QF8A 3BXWA 1A7XA 3FXYA 1U79A 4UDMA 2B31A 4TW7A 1IX5A 3GPKA 4ODLA 2MPHA 1ZB5A 5GPGA 5HTGA 3NRKA 1WAWA 3OA5A 1J6YA 3O5GA 1P5QA 1QZ2A 1VF8A 3UI5A 1EHNA 1Q1CA 4HBOA 2WLYA 3FAPA 3ARYA 5DIVA 3IK8A 1ZBKA 4KQZA 1D7IA 3UQAA 3PR9A 4JFKA 3KAFA 1OGGA 4ZPWR 1PBKA 4MGVA 4JFIA 2KR7A 1NWSA 2F21A 1PINA 4DRMA 1Q6UA 3GU0A 2YBUA 4LAWA 3WD4A 2VCDA 1Q6IA 3GTYX 3O5JA 1J4HA 2PI6A 1OGBA 4R0XA 4AY1A 4GIVA 1KT1A 3JYJA 2DG4A 1FKFA 4BF8A 4NSBA 1X6LA 2PPNA 1W1VA 4QZVB 3AS1A 2FKEA 2A3BA 4PTMA 1JVWA 4KR0B 1YATA 4P8WA 3WD0A 4DZ2A 1NWTA 2PV2A 1RD6A 1NH6A 1E44A 4G50A 1EYMA 1LG1A 2XPAA 3UF8A 3ARXA 5DITA 5I98A 1N1AA 5HWBA 3TDBA 4JFMA 2PN0A 3ARVA 3B8SA 2F4EA 4ZPTR 4WKFA 2XP3A 5HT1A 3O5IA 1FKHA 1LL7A 3EIPA 2DT3A 4Q7NA 3AS2A 2XP7A 1HKJA 2LJ4A 2G8ZA 2PV3A 2XP9A 3ARRA 3G6LA 3UQBA 4ODNA 4S3JA 1FKKA 1D2KA 2KGJA 3O5OA 3KACA 4ODPA 2DT1A 2LPVA 1W26A 2VN1A 3JYMA 3IHZA 3BMBA 4Z2JA 1XRVA 3ALFA 1YW5A 2FDMA 3UQIA 1SR0A 3O5RA 2DSWA 1FKBA 3AQUA 3KAIA 4U85A 2DSVA 1H0GA 1M5YA 1W9PA 3CHCA 2XP4A 4C02B 3KAHA 4JFJA 3LUOA 4ODKA 1F8AB 1C9HA 1ITXA 2ZQTA 4WKAA 4ZS6A 4MSPA 4TW6A 5HW6A 1Q6HA 1NWUA 3NTPA 2M08A 1EIBA 3WQVA 1Y0OA 3CGMA 2M1IA 3NI6A 2XPBA 1SYTA 1KFWA 4DRKA 1NMWA 4J4OA 1FKRA 4LGXA 2MNTA 4DWSA 1J4IA 4IT6A 1FKLA 2A3EA 4MTVA 1FKIA 4LAXA 1X6NA 4W9OA 3KABA 1ZCNA 3PRBA 4WK9A 2UZ5A 5JH8A 4DWSD 1JNSA 3ODKA 2K8IA 5GPRA 4MNMA 2XP6A 3TC5A 1D7JA 4DRQA 1UR8A 1NMVA 3AS0A 3UI6A 3WL1A 3WD3A 1E6RA 5J6EA 2DPEA 4HBEA 3UI4A 4Z2HA 3O5KA 3CZ8A 4TYOA 1HKIA 3ARSA 1WB0A 2LKNA 5HWCA 2Q5AA
chains in the Genus database with same CATH topology
4ODRA 4ZPVR 1BKFA 3O5EA 1TFVA 4DWSB 2F2DA 4QT2A 4P8VA 1E6NA 2WK2A 2RUCA 2MLZA 4Z2GA 4S3KA 2A3AA 3H9RB 1ZBWA 2IF4A 2JZVA 3W4RA 4O2TA 1W9VA 1W1YA 1HKMA 4DRHA 4R5EA 1LG2A 4MNLA 2ZQUA 4DRNA 3B9AA 2DSUA 4MAVA 1JNTA 3WKZA 1L1PA 5DIUA 4Q22A 1HJWA 4ODOA 1K9TA 1ROUA 4DH0A 3KZ7A 1E9LA 3CGNA 3RFWA 2AOSA 1O6IA 5D75A 4FAPA 1ZBVA 4IQCA 3IKGA 3RM9A 4Z2IA 4DZ3A 1JNDA 1ZBCA 3RM8A 1W1TA 1W9UA 1D6OA 1QPLA 4IQ2A 4QIBA 2RQSA 2DG9A 1ZL1A 1KT0A 3EY6A 3RM4A 2ZQVA 3WD1A 1R9HA 2N87A 3ARQA 4GGQA 3WQWA 1B6CA 2RSEA 4IPXA 2MLYA 3WIJA 4DIPA 1WNOA 4NZCA 4G2PA 3FY1A 4Z2LA 1HJXA 3I6CA 4TNSA 1FJDA 3AS3A 4U84A 4MNKA 5BXJA 1FAPA 4TX0A 5B8IC 3OOBA 4LAVA 2ZR5A 5HBFA 2RUQA 3JXVA 4IT4A 3AROA 4L3NA 3G6MA 1FFRA 2DG3A 4LAYA 1FKJA 1BL4A 5HW7A 1F40A 4DRPA 2DT2A 2A3CA 2KO7A 2RURA 3KADA 1FD9A 1GUVA 3KCEA 2OLHA 3ARUA 4NNRA 4U86A 3CHEA 1NWRA 4HARA 4QT3A 3CH9A 3O5MA 2PPPA 1GOIA 2L2SA 5GQBA 1HXVA 1W1PA 1LL4A 2WLZA 2PBCA 5HKGA 1E6ZA 3PRDA 4P8UA 3CHFA 3RGCA 1FFQA 3ARZA 4WIWA 4DWSC 4TW8A 3O5LA 1GPFA 3B7XA 3VAWA 3TCZA 2DT0A 2Y78A 4J4NA 4MNJA 4DT4A 3ALGA 1NSGA 3B9DA 3O5DA 4W9PA 1TCOC 2ITKA 4Z2KA 3WL0A 1LL6A 3IKDA 2O9OA 1QPFA 4WJXA 1ROTA 5DF0A 4P8XA 1E6PA 3PRAA 1J4RA 1ZU8A 4JYSA 2XP8A 3O5QA 3PA7A 1E15A 3KAGA 5DO2A 3O5FA 1OWQA 4N19A 4ITZA 4MPKA 2LGOA 3ARTA 1EDQA 3CHDA 3WH0A 4W9QA 2WM0A 3WD2A 5DEZA 2ZQSA 2PPOA 4DRIA 4XAKA 2ZR4A 2O92A 1T11A 3MDYB 4JFLA 2AWGA 2KI3A 2MF9A 2OFNA 1ZK6A 2YBTA 4L72B 2RUDA 3RMEA 1LQ0A 3ARPA 1FKTA 3ARWA 4ML4A 1LJYA 4URIA 1HJVA 2DSZA 1JNEA 4WKHA 4W5UA 3O5PA 1H0IA 2IUZA 5HUAA 2KE0A 4DRJA 2M2AA 2KFWA 4FN2A 2G41A 2ESCA 2XP5A 1FKGA 4ODMA 1CTNA 1EQ3A 1HKKA 1UR9A 3QOKA 1FKDA 1D7HA 1FKSA 2ZR6A 2FAPA 1XHGA 5HW8A 2PV1A 2MLXA 4DROA 2D9FA 4ODQA 3B9EA 2QF8A 3BXWA 1A7XA 3FXYA 1U79A 2B31A 4TW7A 1IX5A 3GPKA 4ODLA 2MPHA 1ZB5A 5GPGA 5HTGA 3NRKA 1WAWA 3OA5A 1J6YA 3O5GA 1P5QA 1QZ2A 1VF8A 3UI5A 1EHNA 1Q1CA 4HBOA 2WLYA 3FAPA 3ARYA 5DIVA 3IK8A 1ZBKA 4KQZA 1D7IA 3UQAA 3PR9A 4JFKA 3KAFA 1OGGA 4ZPWR 1PBKA 4MGVA 4JFIA 2KR7A 1NWSA 2F21A 1PINA 4DRMA 1Q6UA 2YBUA 4LAWA 3WD4A 2VCDA 1Q6IA 3O5JA 1J4HA 2PI6A 1OGBA 4R0XA 4AY1A 4GIVA 1KT1A 3JYJA 2DG4A 1FKFA 4BF8A 4NSBA 1X6LA 2PPNA 1W1VA 4QZVB 3AS1A 2FKEA 2A3BA 4PTMA 1JVWA 4KR0B 1YATA 4P8WA 3WD0A 4DZ2A 1NWTA 2PV2A 1RD6A 1NH6A 4G50A 1EYMA 1LG1A 2XPAA 3UF8A 3ARXA 5DITA 5I98A 1N1AA 5HWBA 3TDBA 4JFMA 3ARVA 3B8SA 2F4EA 4ZPTR 4WKFA 2XP3A 5HT1A 3O5IA 1FKHA 1LL7A 2DT3A 4Q7NA 3AS2A 2XP7A 1HKJA 2LJ4A 2G8ZA 2PV3A 2XP9A 3ARRA 3G6LA 3UQBA 4ODNA 4S3JA 1FKKA 1D2KA 2KGJA 3O5OA 3KACA 4ODPA 2DT1A 2LPVA 1W26A 2VN1A 3JYMA 3IHZA 4Z2JA 1XRVA 3ALFA 1YW5A 2FDMA 3UQIA 1SR0A 3O5RA 2DSWA 1FKBA 3AQUA 3KAIA 4U85A 2DSVA 1H0GA 1M5YA 1W9PA 3CHCA 2XP4A 4C02B 3KAHA 4JFJA 3LUOA 4ODKA 1F8AB 1C9HA 1ITXA 2ZQTA 4WKAA 4ZS6A 4MSPA 4TW6A 5HW6A 1Q6HA 1NWUA 3NTPA 2M08A 1EIBA 3WQVA 1Y0OA 3CGMA 2M1IA 3NI6A 2XPBA 1SYTA 1KFWA 4DRKA 1NMWA 4J4OA 1FKRA 4LGXA 2MNTA 4DWSA 1J4IA 4IT6A 1FKLA 2A3EA 4MTVA 1FKIA 4LAXA 1X6NA 4W9OA 3KABA 1ZCNA 3PRBA 4WK9A 2UZ5A 5JH8A 4DWSD 1JNSA 3ODKA 2K8IA 5GPRA 4MNMA 2XP6A 3TC5A 1D7JA 4DRQA 1UR8A 1NMVA 3AS0A 3UI6A 3WL1A 3WD3A 1E6RA 5J6EA 2DPEA 4HBEA 3UI4A 4Z2HA 3O5KA 3CZ8A 4TYOA 1HKIA 3ARSA 1WB0A 2LKNA 5HWCA 2Q5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5I A;  4ODR A;  1BKF A;  1FKH A;  1EQ3 A;  1FKD A;  3O5M A;  3O5E A;  2XP7 A;  2PPP A;  2LJ4 A;  2F2D A;  1D7H A;  2L2S A;  1FKS A;  2PV3 A;  2ZR6 A;  4QT2 A;  2FAP A;  2XP9 A;  1HXV A;  5HW8 A;  2PV1 A;  5HT1 A;  3UQB A;  2RUC A;  2MLZ A;  4ODN A;  2MLX A;  5I98 A;  2PBC A;  5HKG A;  1FKK A;  3H9R B;  2IF4 A;  4DRO A;  2D9F A;  2KGJ A;  2JZV A;  3O5O A;  3PRD A;  4O2T A;  4ODQ A;  3KAC A;  4ODP A;  3RGC A;  4DRH A;  1A7X A;  4TW8 A;  3O5L A;  1U79 A;  2LPV A;  3B7X A;  1W26 A;  2VN1 A;  3VAW A;  3JYM A;  3TCZ A;  3IHZ A;  2Y78 A;  4J4N A;  4TW7 A;  4DT4 A;  2ZQU A;  4DRN A;  3GPK A;  4ODL A;  1JNT A;  1L1P A;  2MPH A;  5GPG A;  5DIU A;  1YW5 A;  5HTG A;  3NRK A;  1NSG A;  3O5D A;  4W9P A;  3UQI A;  1TCO C;  2ITK A;  3O5R A;  1J6Y A;  3O5G A;  1P5Q A;  1QZ2 A;  4ODO A;  3UI5 A;  4QIB A;  1FKB A;  1ROU A;  4DH0 A;  3IKD A;  3KAI A;  3KZ7 A;  1Q1C A;  1QPF A;  3FAP A;  1ROT A;  3CGN A;  4U85 A;  5D75 A;  3RFW A;  4FAP A;  5DIV A;  3IK8 A;  4IQC A;  3IKG A;  1D7I A;  3UQA A;  1M5Y A;  4DZ3 A;  4JFK A;  1J4R A;  2XP4 A;  3KAF A;  4C02 B;  3KAH A;  4JFJ A;  1D6O A;  1QPL A;  1PBK A;  3LUO A;  4IQ2 A;  2RQS A;  4ODK A;  4MGV A;  1F8A B;  4JFI A;  1C9H A;  2KR7 A;  2DG9 A;  4JYS A;  2ZQT A;  2XP8 A;  2F21 A;  3O5Q A;  3PA7 A;  1KT0 A;  3EY6 A;  1PIN A;  4DRM A;  2ZQV A;  1Q6U A;  3KAG A;  1R9H A;  3O5F A;  4LAW A;  2N87 A;  4GGQ A;  2VCD A;  4MSP A;  1Q6I A;  1Q6H A;  3O5J A;  4ITZ A;  1B6C A;  1J4H A;  4N19 A;  4TW6 A;  5HW6 A;  2LGO A;  3NTP A;  2RSE A;  2M08 A;  4R0X A;  4IPX A;  2MLY A;  4GIV A;  3WH0 A;  1Y0O A;  3CGM A;  4W9Q A;  4DIP A;  2M1I A;  1KT1 A;  3JYJ A;  2ZQS A;  3NI6 A;  2PPO A;  4DRI A;  4G2P A;  2DG4 A;  2XPB A;  1FKF A;  4BF8 A;  2ZR4 A;  3MDY B;  1T11 A;  4JFL A;  1FJD A;  3I6C A;  4QT3 A;  4TNS A;  2AWG A;  1NMW A;  2KI3 A;  2PPN A;  4DRK A;  4J4O A;  2MF9 A;  1FKR A;  2OFN A;  1ZK6 A;  4U84 A;  5BXJ A;  2MNT A;  1FAP A;  2FKE A;  1J4I A;  2RUD A;  4TX0 A;  1FKL A;  5B8I C;  1FKI A;  3OOB A;  4LAV A;  2ZR5 A;  4LAX A;  1FKT A;  2RUQ A;  3JXV A;  1ZCN A;  1JVW A;  3KAB A;  3PRB A;  4W9O A;  2UZ5 A;  1YAT A;  1JNS A;  3ODK A;  2K8I A;  2DG3 A;  2XP6 A;  4DZ2 A;  4LAY A;  1FKJ A;  2PV2 A;  3TC5 A;  1D7J A;  1BL4 A;  4G50 A;  5HW7 A;  4DRQ A;  1EYM A;  1F40 A;  2XPA A;  1NMV A;  3UI6 A;  3UF8 A;  4DRP A;  5J6E A;  3O5P A;  5DIT A;  2KO7 A;  2RUR A;  3KAD A;  3UI4 A;  1FD9 A;  1N1A A;  2KE0 A;  3KCE A;  5HWB A;  3O5K A;  2M2A A;  3TDB A;  4DRJ A;  4NNR A;  2KFW A;  4FN2 A;  4JFM A;  4TYO A;  4U86 A;  5HUA A;  2XP5 A;  2F4E A;  1FKG A;  4ODM A;  2LKN A;  5HWC A;  2XP3 A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 4ODR A;  4ZPV R;  1BKF A;  3O5E A;  1TFV A;  4DWS B;  2F2D A;  4QT2 A;  4P8V A;  1E6N A;  2WK2 A;  2RUC A;  2MLZ A;  4Z2G A;  4S3K A;  2A3A A;  3H9R B;  1ZBW A;  2IF4 A;  2JZV A;  3W4R A;  4O2T A;  1W9V A;  1W1Y A;  1HKM A;  4DRH A;  4R5E A;  1LG2 A;  4MNL A;  2ZQU A;  4DRN A;  3B9A A;  2DSU A;  4MAV A;  1JNT A;  3WKZ A;  1L1P A;  5DIU A;  4Q22 A;  1HJW A;  4ODO A;  1K9T A;  1ROU A;  2P4V A;  4DH0 A;  3KZ7 A;  1E9L A;  3CGN A;  3RFW A;  2AOS A;  1O6I A;  5D75 A;  4FAP A;  1ZBV A;  4IQC A;  3IKG A;  3RM9 A;  4Z2I A;  4DZ3 A;  1JND A;  1ZBC A;  3RM8 A;  1W1T A;  1W9U A;  1D6O A;  1QPL A;  4IQ2 A;  4QIB A;  2RQS A;  2DG9 A;  1ZL1 A;  1KT0 A;  3EY6 A;  3RM4 A;  2ZQV A;  3WD1 A;  1R9H A;  2N87 A;  3ARQ A;  4GGQ A;  3WQW A;  1B6C A;  2RSE A;  4IPX A;  2MLY A;  3WIJ A;  4DIP A;  1WNO A;  4NZC A;  4G2P A;  3FY1 A;  4Z2L A;  1HJX A;  3I6C A;  4TNS A;  1FJD A;  3AS3 A;  4U84 A;  4MNK A;  1JCH B;  1FAP A;  5BXJ A;  4TX0 A;  5B8I C;  3OOB A;  4LAV A;  2ZR5 A;  5HBF A;  2RUQ A;  3JXV A;  4IT4 A;  3ARO A;  4L3N A;  3G6M A;  1FFR A;  2DG3 A;  4LAY A;  1FKJ A;  1BL4 A;  5HW7 A;  1F40 A;  4DRP A;  2DT2 A;  2A3C A;  2KO7 A;  2RUR A;  3KAD A;  1FD9 A;  1GUV A;  3KCE A;  2OLH A;  3ARU A;  4NNR A;  4U86 A;  3CHE A;  1NWR A;  4HAR A;  4QT3 A;  3CH9 A;  3O5M A;  2PPP A;  2F23 A;  1GOI A;  2L2S A;  5GQB A;  1HXV A;  1W1P A;  1LL4 A;  2WLZ A;  2PBC A;  5HKG A;  1E6Z A;  3PRD A;  4P8U A;  3CHF A;  3RGC A;  2ETN A;  1FFQ A;  3ARZ A;  4WIW A;  4DWS C;  4TW8 A;  3O5L A;  1GPF A;  3B7X A;  3VAW A;  3TCZ A;  2DT0 A;  2Y78 A;  4J4N A;  4MNJ A;  4DT4 A;  3ALG A;  1NSG A;  3B9D A;  3O5D A;  4W9P A;  1TCO C;  2ITK A;  4Z2K A;  3WL0 A;  1LL6 A;  3IKD A;  2O9O A;  1QPF A;  4WJX A;  1ROT A;  2B5U B;  5DF0 A;  4P8X A;  1E6P A;  3PRA A;  1J4R A;  1ZU8 A;  4JYS A;  2XP8 A;  3O5Q A;  3PA7 A;  1E15 A;  3KAG A;  5DO2 A;  3O5F A;  1OWQ A;  4N19 A;  4ITZ A;  4MPK A;  2LGO A;  3ART A;  1EDQ A;  3CHD A;  3WH0 A;  4W9Q A;  2WM0 A;  3WD2 A;  5DEZ A;  2ZQS A;  2PPO A;  4DRI A;  4XAK A;  2ZR4 A;  2O92 A;  1T11 A;  3MDY B;  4JFL A;  2AWG A;  2KI3 A;  1GRJ A;  2MF9 A;  2OFN A;  1ZK6 A;  2YBT A;  4L72 B;  2RUD A;  3RME A;  1LQ0 A;  3ARP A;  1FKT A;  3ARW A;  4ML4 A;  1LJY A;  4URI A;  1HJV A;  2DSZ A;  1JNE A;  4WKH A;  4W5U A;  3O5P A;  1H0I A;  2IUZ A;  5HUA A;  2KE0 A;  4DRJ A;  2M2A A;  2KFW A;  4FN2 A;  2G41 A;  2ESC A;  2XP5 A;  1FKG A;  4ODM A;  1CTN A;  1EQ3 A;  1HKK A;  1UR9 A;  3QOK A;  1FKD A;  2EUL A;  1D7H A;  1FKS A;  2ZR6 A;  2FAP A;  1XHG A;  5HW8 A;  2PV1 A;  2MLX A;  4DRO A;  2D9F A;  4ODQ A;  3B9E A;  2QF8 A;  3BXW A;  1A7X A;  3FXY A;  1U79 A;  4UDM A;  2B31 A;  4TW7 A;  1IX5 A;  3GPK A;  4ODL A;  2MPH A;  1ZB5 A;  5GPG A;  5HTG A;  3NRK A;  1WAW A;  3OA5 A;  1J6Y A;  3O5G A;  1P5Q A;  1QZ2 A;  1VF8 A;  3UI5 A;  1EHN A;  1Q1C A;  4HBO A;  2WLY A;  3FAP A;  3ARY A;  5DIV A;  3IK8 A;  1ZBK A;  4KQZ A;  1D7I A;  3UQA A;  3PR9 A;  4JFK A;  3KAF A;  1OGG A;  4ZPW R;  1PBK A;  4MGV A;  4JFI A;  2KR7 A;  1NWS A;  2F21 A;  1PIN A;  4DRM A;  1Q6U A;  3GU0 A;  2YBU A;  4LAW A;  3WD4 A;  2VCD A;  1Q6I A;  3GTY X;  3O5J A;  1J4H A;  2PI6 A;  1OGB A;  4R0X A;  4AY1 A;  4GIV A;  1KT1 A;  3JYJ A;  2DG4 A;  1FKF A;  4BF8 A;  4NSB A;  1X6L A;  2PPN A;  1W1V A;  4QZV B;  3AS1 A;  2FKE A;  2A3B A;  4PTM A;  1JVW A;  4KR0 B;  1YAT A;  4P8W A;  3WD0 A;  4DZ2 A;  1NWT A;  2PV2 A;  1RD6 A;  1NH6 A;  1E44 A;  4G50 A;  1EYM A;  1LG1 A;  2XPA A;  3UF8 A;  3ARX A;  5DIT A;  5I98 A;  1N1A A;  5HWB A;  3TDB A;  4JFM A;  2PN0 A;  3ARV A;  3B8S A;  2F4E A;  4ZPT R;  4WKF A;  2XP3 A;  5HT1 A;  3O5I A;  1FKH A;  1LL7 A;  3EIP A;  2DT3 A;  4Q7N A;  3AS2 A;  2XP7 A;  1HKJ A;  2LJ4 A;  2G8Z A;  2PV3 A;  2XP9 A;  3ARR A;  3G6L A;  3UQB A;  4ODN A;  4S3J A;  1FKK A;  1D2K A;  2KGJ A;  3O5O A;  3KAC A;  4ODP A;  2DT1 A;  2LPV A;  1W26 A;  2VN1 A;  3JYM A;  3IHZ A;  3BMB A;  4Z2J A;  1XRV A;  3ALF A;  1YW5 A;  2FDM A;  3UQI A;  1SR0 A;  3O5R A;  2DSW A;  1FKB A;  3AQU A;  3KAI A;  4U85 A;  2DSV A;  1H0G A;  1M5Y A;  1W9P A;  3CHC A;  2XP4 A;  4C02 B;  3KAH A;  4JFJ A;  3LUO A;  4ODK A;  1F8A B;  1C9H A;  1ITX A;  2ZQT A;  4WKA A;  4ZS6 A;  4MSP A;  4TW6 A;  5HW6 A;  1Q6H A;  1NWU A;  3NTP A;  2M08 A;  1EIB A;  3WQV A;  1Y0O A;  3CGM A;  2M1I A;  3NI6 A;  2XPB A;  1SYT A;  1KFW A;  4DRK A;  1NMW A;  4J4O A;  1FKR A;  4LGX A;  2MNT A;  4DWS A;  1J4I A;  4IT6 A;  1FKL A;  2A3E A;  4MTV A;  1FKI A;  4LAX A;  1X6N A;  4W9O A;  3KAB A;  1ZCN A;  3PRB A;  4WK9 A;  2UZ5 A;  5JH8 A;  4DWS D;  1JNS A;  3ODK A;  2K8I A;  5GPR A;  4MNM A;  2XP6 A;  3TC5 A;  1D7J A;  4DRQ A;  1UR8 A;  1NMV A;  3AS0 A;  3UI6 A;  3WL1 A;  3WD3 A;  1E6R A;  5J6E A;  2DPE A;  4HBE A;  3UI4 A;  4Z2H A;  3O5K A;  3CZ8 A;  4TYO A;  1HKI A;  3ARS A;  1WB0 A;  2LKN A;  5HWC A;  2Q5A A; 
#chains in the Genus database with same CATH homology
 4ODR A;  4ZPV R;  1BKF A;  3O5E A;  1TFV A;  4DWS B;  2F2D A;  4QT2 A;  4P8V A;  1E6N A;  2WK2 A;  2RUC A;  2MLZ A;  4Z2G A;  4S3K A;  2A3A A;  3H9R B;  1ZBW A;  2IF4 A;  2JZV A;  3W4R A;  4O2T A;  1W9V A;  1W1Y A;  1HKM A;  4DRH A;  4R5E A;  1LG2 A;  4MNL A;  2ZQU A;  4DRN A;  3B9A A;  2DSU A;  4MAV A;  1JNT A;  3WKZ A;  1L1P A;  5DIU A;  4Q22 A;  1HJW A;  4ODO A;  1K9T A;  1ROU A;  4DH0 A;  3KZ7 A;  1E9L A;  3CGN A;  3RFW A;  2AOS A;  1O6I A;  5D75 A;  4FAP A;  1ZBV A;  4IQC A;  3IKG A;  3RM9 A;  4Z2I A;  4DZ3 A;  1JND A;  1ZBC A;  3RM8 A;  1W1T A;  1W9U A;  1D6O A;  1QPL A;  4IQ2 A;  4QIB A;  2RQS A;  2DG9 A;  1ZL1 A;  1KT0 A;  3EY6 A;  3RM4 A;  2ZQV A;  3WD1 A;  1R9H A;  2N87 A;  3ARQ A;  4GGQ A;  3WQW A;  1B6C A;  2RSE A;  4IPX A;  2MLY A;  3WIJ A;  4DIP A;  1WNO A;  4NZC A;  4G2P A;  3FY1 A;  4Z2L A;  1HJX A;  3I6C A;  4TNS A;  1FJD A;  3AS3 A;  4U84 A;  4MNK A;  5BXJ A;  1FAP A;  4TX0 A;  5B8I C;  3OOB A;  4LAV A;  2ZR5 A;  5HBF A;  2RUQ A;  3JXV A;  4IT4 A;  3ARO A;  4L3N A;  3G6M A;  1FFR A;  2DG3 A;  4LAY A;  1FKJ A;  1BL4 A;  5HW7 A;  1F40 A;  4DRP A;  2DT2 A;  2A3C A;  2KO7 A;  2RUR A;  3KAD A;  1FD9 A;  1GUV A;  3KCE A;  2OLH A;  3ARU A;  4NNR A;  4U86 A;  3CHE A;  1NWR A;  4HAR A;  4QT3 A;  3CH9 A;  3O5M A;  2PPP A;  1GOI A;  2L2S A;  5GQB A;  1HXV A;  1W1P A;  1LL4 A;  2WLZ A;  2PBC A;  5HKG A;  1E6Z A;  3PRD A;  4P8U A;  3CHF A;  3RGC A;  1FFQ A;  3ARZ A;  4WIW A;  4DWS C;  4TW8 A;  3O5L A;  1GPF A;  3B7X A;  3VAW A;  3TCZ A;  2DT0 A;  2Y78 A;  4J4N A;  4MNJ A;  4DT4 A;  3ALG A;  1NSG A;  3B9D A;  3O5D A;  4W9P A;  1TCO C;  2ITK A;  4Z2K A;  3WL0 A;  1LL6 A;  3IKD A;  2O9O A;  1QPF A;  4WJX A;  1ROT A;  5DF0 A;  4P8X A;  1E6P A;  3PRA A;  1J4R A;  1ZU8 A;  4JYS A;  2XP8 A;  3O5Q A;  3PA7 A;  1E15 A;  3KAG A;  5DO2 A;  3O5F A;  1OWQ A;  4N19 A;  4ITZ A;  4MPK A;  2LGO A;  3ART A;  1EDQ A;  3CHD A;  3WH0 A;  4W9Q A;  2WM0 A;  3WD2 A;  5DEZ A;  2ZQS A;  2PPO A;  4DRI A;  4XAK A;  2ZR4 A;  2O92 A;  1T11 A;  3MDY B;  4JFL A;  2AWG A;  2KI3 A;  2MF9 A;  2OFN A;  1ZK6 A;  2YBT A;  4L72 B;  2RUD A;  3RME A;  1LQ0 A;  3ARP A;  1FKT A;  3ARW A;  4ML4 A;  1LJY A;  4URI A;  1HJV A;  2DSZ A;  1JNE A;  4WKH A;  4W5U A;  3O5P A;  1H0I A;  2IUZ A;  5HUA A;  2KE0 A;  4DRJ A;  2M2A A;  2KFW A;  4FN2 A;  2G41 A;  2ESC A;  2XP5 A;  1FKG A;  4ODM A;  1CTN A;  1EQ3 A;  1HKK A;  1UR9 A;  3QOK A;  1FKD A;  1D7H A;  1FKS A;  2ZR6 A;  2FAP A;  1XHG A;  5HW8 A;  2PV1 A;  2MLX A;  4DRO A;  2D9F A;  4ODQ A;  3B9E A;  2QF8 A;  3BXW A;  1A7X A;  3FXY A;  1U79 A;  2B31 A;  4TW7 A;  1IX5 A;  3GPK A;  4ODL A;  2MPH A;  1ZB5 A;  5GPG A;  5HTG A;  3NRK A;  1WAW A;  3OA5 A;  1J6Y A;  3O5G A;  1P5Q A;  1QZ2 A;  1VF8 A;  3UI5 A;  1EHN A;  1Q1C A;  4HBO A;  2WLY A;  3FAP A;  3ARY A;  5DIV A;  3IK8 A;  1ZBK A;  4KQZ A;  1D7I A;  3UQA A;  3PR9 A;  4JFK A;  3KAF A;  1OGG A;  4ZPW R;  1PBK A;  4MGV A;  4JFI A;  2KR7 A;  1NWS A;  2F21 A;  1PIN A;  4DRM A;  1Q6U A;  2YBU A;  4LAW A;  3WD4 A;  2VCD A;  1Q6I A;  3O5J A;  1J4H A;  2PI6 A;  1OGB A;  4R0X A;  4AY1 A;  4GIV A;  1KT1 A;  3JYJ A;  2DG4 A;  1FKF A;  4BF8 A;  4NSB A;  1X6L A;  2PPN A;  1W1V A;  4QZV B;  3AS1 A;  2FKE A;  2A3B A;  4PTM A;  1JVW A;  4KR0 B;  1YAT A;  4P8W A;  3WD0 A;  4DZ2 A;  1NWT A;  2PV2 A;  1RD6 A;  1NH6 A;  4G50 A;  1EYM A;  1LG1 A;  2XPA A;  3UF8 A;  3ARX A;  5DIT A;  5I98 A;  1N1A A;  5HWB A;  3TDB A;  4JFM A;  3ARV A;  3B8S A;  2F4E A;  4ZPT R;  4WKF A;  2XP3 A;  5HT1 A;  3O5I A;  1FKH A;  1LL7 A;  2DT3 A;  4Q7N A;  3AS2 A;  2XP7 A;  1HKJ A;  2LJ4 A;  2G8Z A;  2PV3 A;  2XP9 A;  3ARR A;  3G6L A;  3UQB A;  4ODN A;  4S3J A;  1FKK A;  1D2K A;  2KGJ A;  3O5O A;  3KAC A;  4ODP A;  2DT1 A;  2LPV A;  1W26 A;  2VN1 A;  3JYM A;  3IHZ A;  4Z2J A;  1XRV A;  3ALF A;  1YW5 A;  2FDM A;  3UQI A;  1SR0 A;  3O5R A;  2DSW A;  1FKB A;  3AQU A;  3KAI A;  4U85 A;  2DSV A;  1H0G A;  1M5Y A;  1W9P A;  3CHC A;  2XP4 A;  4C02 B;  3KAH A;  4JFJ A;  3LUO A;  4ODK A;  1F8A B;  1C9H A;  1ITX A;  2ZQT A;  4WKA A;  4ZS6 A;  4MSP A;  4TW6 A;  5HW6 A;  1Q6H A;  1NWU A;  3NTP A;  2M08 A;  1EIB A;  3WQV A;  1Y0O A;  3CGM A;  2M1I A;  3NI6 A;  2XPB A;  1SYT A;  1KFW A;  4DRK A;  1NMW A;  4J4O A;  1FKR A;  4LGX A;  2MNT A;  4DWS A;  1J4I A;  4IT6 A;  1FKL A;  2A3E A;  4MTV A;  1FKI A;  4LAX A;  1X6N A;  4W9O A;  3KAB A;  1ZCN A;  3PRB A;  4WK9 A;  2UZ5 A;  5JH8 A;  4DWS D;  1JNS A;  3ODK A;  2K8I A;  5GPR A;  4MNM A;  2XP6 A;  3TC5 A;  1D7J A;  4DRQ A;  1UR8 A;  1NMV A;  3AS0 A;  3UI6 A;  3WL1 A;  3WD3 A;  1E6R A;  5J6E A;  2DPE A;  4HBE A;  3UI4 A;  4Z2H A;  3O5K A;  3CZ8 A;  4TYO A;  1HKI A;  3ARS A;  1WB0 A;  2LKN A;  5HWC A;  2Q5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...