2LGPA

Solution structure of la45 from ldlr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
GSPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure, Dynamics, and Binding of the LA45 Module Pair of the Low-Density Lipoprotein Receptor Suggest an Important Role for LA4 in Ligand Release.
pubmed doi rcsb
molecule keywords Low-density lipoprotein receptor
molecule tags Protein binding
source organism Homo sapiens
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2lgpA01
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2lgpA02
1JRFA 1N7DA 1CR8A 2KNXA 1K7BA 2M7PA 2KNYA 1D2JA 2M0PA 1XFEA 2JM4A 1LDRA 2LGPA 2FYJA 2M96A 1D2LA 1LDLA 1J8EA 1F5YA 2FCWB 2FYLB 2I1PA
chains in the Genus database with same CATH superfamily
1JRFA 1N7DA 1CR8A 2KNXA 1K7BA 2M7PA 2KNYA 1D2JA 2M0PA 1XFEA 2JM4A 1LDRA 2LGPA 2FYJA 2M96A 1D2LA 1LDLA 1J8EA 1F5YA 2FCWB 2FYLB 2I1PA
chains in the Genus database with same CATH topology
1JRFA 1N7DA 1CR8A 2KNXA 1K7BA 2M7PA 2KNYA 1D2JA 2M0PA 1XFEA 2JM4A 1LDRA 2LGPA 2FYJA 2M96A 1D2LA 1LDLA 1J8EA 1F5YA 2FCWB 2FYLB 2I1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRF A;  1N7D A;  1CR8 A;  2KNX A;  1K7B A;  2M7P A;  2KNY A;  1D2J A;  2M0P A;  1XFE A;  2JM4 A;  1LDR A;  2LGP A;  2FYJ A;  2M96 A;  1D2L A;  1LDL A;  1J8E A;  1F5Y A;  2FCW B;  2FYL B;  2I1P A; 
#chains in the Genus database with same CATH topology
 1JRF A;  1N7D A;  1CR8 A;  2KNX A;  1K7B A;  2M7P A;  2KNY A;  1D2J A;  2M0P A;  1XFE A;  2JM4 A;  1LDR A;  2LGP A;  2FYJ A;  2M96 A;  1D2L A;  1LDL A;  1J8E A;  1F5Y A;  2FCW B;  2FYL B;  2I1P A; 
#chains in the Genus database with same CATH homology
 1JRF A;  1N7D A;  1CR8 A;  2KNX A;  1K7B A;  2M7P A;  2KNY A;  1D2J A;  2M0P A;  1XFE A;  2JM4 A;  1LDR A;  2LGP A;  2FYJ A;  2M96 A;  1D2L A;  1LDL A;  1J8E A;  1F5Y A;  2FCW B;  2FYL B;  2I1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...