2LGRA

Solution structure of human protein c6orf130, a putative macro domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
EASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orphan Macrodomain Protein (Human C6orf130) Is an O-Acyl-ADP-ribose Deacylase: SOLUTION STRUCTURE AND CATALYTIC PROPERTIES.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Uncharacterized protein C6orf130
total genus 41
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2lgrA01
2XD7A 1TXZA 3V45A 5CMSA 4GVWA 3V2BA 4ZY1A 3GQEA 2BFQA 1YD9A 3EWQA 3IIFA 4KYBA 3IIDA 1ZR3A 3Q6ZA 5FSVA 1LANA 3KR4A 1SPVA 4R7MA 5FSXA 3EWRA 4ABLA 1VHUA 1LCPA 5FSZA 2L8RA 3SIHA 3Q71A 4J5RA 3KZWA 2X47A 3SIIA 3GPQA 2ACFA 4ABKA 3T8WA 2FG1A 4ZX9A 3H8GA 3EWOA 4R76A 3JRUA 3KR5A 4ETJA 3H8EA 2EEEA 1LAPA 1BPNA 2EWBA 4R6TA 4GVVA 4ZYQA 5DUSA 1NJRA 4JLLA 4GUAA 5CB5A 4TU0A 3EJGA 1ZR5A 3EWPA 4J4ZA 5CBMA 3GPGA 3GPOA 3IJ3A 4UMLA 5HOLA 5AILA 3EJFA 3KQZA 3SIJA 4IQYA 2DX6A 3KQXA 3H8FA 2VRIA 3ETIA 5E3BA 4X2TA 5FSYA 4ESSA 1GYTA 4ETKA 5D8NA 4J5QA 5HIHA 2FXKA 4K3NA 4JGKA 3PEIA 1HJZA 3GQOA 1LAMA 4ZX8A 2FAVA 2AFCA 4KSIA 4J5SA 4ZI6A 4ZY2A 3EW5A 2J9AA 3VFQA 5FSUA 4D86A 1TY8A 4ZY0A 1BPMA 5CB3A 2BFRA 4JVVA 4JCAA 2LGRA 3EKEA 3JZTA 3SIGA 4K0CA 1BLLE
chains in the Genus database with same CATH superfamily
2XD7A 1TXZA 3V45A 5CMSA 4GVWA 3V2BA 4ZY1A 3GQEA 2BFQA 1YD9A 2JZEA 3EWQA 3IIFA 4KYBA 3IIDA 1ZR3A 3Q6ZA 5FSVA 1LANA 3KR4A 1SPVA 4R7MA 5FSXA 3EWRA 4ABLA 1VHUA 1LCPA 5FSZA 2L8RA 3SIHA 3Q71A 4J5RA 2WCTA 3KZWA 2X47A 3SIIA 3GPQA 2ACFA 4ABKA 3T8WA 2FG1A 4ZX9A 3H8GA 3EWOA 4R76A 3JRUA 3KR5A 4ETJA 3H8EA 2EEEA 1LAPA 1BPNA 2EWBA 4R6TA 4GVVA 4ZYQA 2W2GA 5DUSA 2KQVA 1NJRA 4JLLA 4GUAA 5CB5A 4TU0A 3EJGA 1ZR5A 3EWPA 4J4ZA 5CBMA 3GPGA 3GPOA 3IJ3A 4UMLA 5HOLA 5AILA 3EJFA 3KQZA 3SIJA 4IQYA 2DX6A 3KQXA 3H8FA 2VRIA 3ETIA 5E3BA 4X2TA 2JZFA 5FSYA 4ESSA 1GYTA 4ETKA 5D8NA 4J5QA 5HIHA 2FXKA 4K3NA 4JGKA 3PEIA 2JZDA 1HJZA 3GQOA 1LAMA 2RNKA 4ZX8A 2FAVA 2AFCA 4KSIA 4J5SA 4ZI6A 4ZY2A 3EW5A 2J9AA 3VFQA 5FSUA 4D86A 1TY8A 4ZY0A 1BPMA 5CB3A 2BFRA 4JVVA 4JCAA 2LGRA 3EKEA 3JZTA 3SIGA 4K0CA 1BLLE
chains in the Genus database with same CATH topology
2XD7A 1TXZA 3V45A 5CMSA 4GVWA 3V2BA 4ZY1A 3GQEA 2BFQA 1YD9A 3EWQA 3IIFA 4KYBA 3IIDA 1ZR3A 3Q6ZA 5FSVA 1LANA 3KR4A 1SPVA 4R7MA 5FSXA 3EWRA 4ABLA 1VHUA 1LCPA 5FSZA 2L8RA 3SIHA 3Q71A 4J5RA 3KZWA 2X47A 3SIIA 3GPQA 2ACFA 4ABKA 3T8WA 2FG1A 4ZX9A 3H8GA 3EWOA 4R76A 3JRUA 3KR5A 4ETJA 3H8EA 2EEEA 1LAPA 1BPNA 2EWBA 4R6TA 4GVVA 4ZYQA 5DUSA 1NJRA 4JLLA 4GUAA 5CB5A 4TU0A 3EJGA 1ZR5A 3EWPA 4J4ZA 5CBMA 3GPGA 3GPOA 3IJ3A 4UMLA 5HOLA 5AILA 3EJFA 3KQZA 3SIJA 4IQYA 2DX6A 3KQXA 3H8FA 2VRIA 3ETIA 5E3BA 4X2TA 5FSYA 4ESSA 1GYTA 4ETKA 5D8NA 4J5QA 5HIHA 2FXKA 4K3NA 4JGKA 3PEIA 1HJZA 3GQOA 1LAMA 4ZX8A 2FAVA 2AFCA 4KSIA 4J5SA 4ZI6A 4ZY2A 3EW5A 2J9AA 3VFQA 5FSUA 4D86A 1TY8A 4ZY0A 1BPMA 5CB3A 2BFRA 4JVVA 4JCAA 2LGRA 3EKEA 3JZTA 3SIGA 4K0CA 1BLLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD7 A;  1TXZ A;  3V45 A;  5CMS A;  4GVW A;  3V2B A;  4ZY1 A;  3GQE A;  2BFQ A;  1YD9 A;  3EWQ A;  3IIF A;  4KYB A;  3IID A;  1ZR3 A;  3Q6Z A;  5FSV A;  1LAN A;  3KR4 A;  1SPV A;  4R7M A;  5FSX A;  3EWR A;  4ABL A;  1VHU A;  1LCP A;  5FSZ A;  2L8R A;  3SIH A;  3Q71 A;  4J5R A;  3KZW A;  2X47 A;  3SII A;  3GPQ A;  2ACF A;  4ABK A;  3T8W A;  2FG1 A;  4ZX9 A;  3H8G A;  3EWO A;  4R76 A;  3JRU A;  3KR5 A;  4ETJ A;  3H8E A;  2EEE A;  1LAP A;  1BPN A;  2EWB A;  4R6T A;  4GVV A;  4ZYQ A;  5DUS A;  1NJR A;  4JLL A;  4GUA A;  5CB5 A;  4TU0 A;  3EJG A;  1ZR5 A;  3EWP A;  4J4Z A;  5CBM A;  3GPG A;  3GPO A;  3IJ3 A;  4UML A;  5HOL A;  5AIL A;  3EJF A;  3KQZ A;  3SIJ A;  4IQY A;  2DX6 A;  3KQX A;  3H8F A;  2VRI A;  3ETI A;  5E3B A;  4X2T A;  5FSY A;  4ESS A;  1GYT A;  4ETK A;  5D8N A;  4J5Q A;  5HIH A;  2FXK A;  4K3N A;  4JGK A;  3PEI A;  1HJZ A;  3GQO A;  1LAM A;  4ZX8 A;  2FAV A;  2AFC A;  4KSI A;  4J5S A;  4ZI6 A;  4ZY2 A;  3EW5 A;  2J9A A;  3VFQ A;  5FSU A;  4D86 A;  1TY8 A;  4ZY0 A;  1BPM A;  5CB3 A;  2BFR A;  4JVV A;  4JCA A;  2LGR A;  3EKE A;  3JZT A;  3SIG A;  4K0C A;  1BLL E; 
#chains in the Genus database with same CATH topology
 2XD7 A;  1TXZ A;  3V45 A;  5CMS A;  4GVW A;  3V2B A;  4ZY1 A;  3GQE A;  2BFQ A;  1YD9 A;  2JZE A;  3EWQ A;  3IIF A;  4KYB A;  3IID A;  1ZR3 A;  3Q6Z A;  5FSV A;  1LAN A;  3KR4 A;  1SPV A;  4R7M A;  5FSX A;  3EWR A;  4ABL A;  1VHU A;  1LCP A;  5FSZ A;  2L8R A;  3SIH A;  3Q71 A;  4J5R A;  2WCT A;  3KZW A;  2X47 A;  3SII A;  3GPQ A;  2ACF A;  4ABK A;  3T8W A;  2FG1 A;  4ZX9 A;  3H8G A;  3EWO A;  4R76 A;  3JRU A;  3KR5 A;  4ETJ A;  3H8E A;  2EEE A;  1LAP A;  1BPN A;  2EWB A;  4R6T A;  4GVV A;  4ZYQ A;  2W2G A;  5DUS A;  2KQV A;  1NJR A;  4JLL A;  4GUA A;  5CB5 A;  4TU0 A;  3EJG A;  1ZR5 A;  3EWP A;  4J4Z A;  5CBM A;  3GPG A;  3GPO A;  3IJ3 A;  4UML A;  5HOL A;  5AIL A;  3EJF A;  3KQZ A;  3SIJ A;  4IQY A;  2DX6 A;  3KQX A;  3H8F A;  2VRI A;  3ETI A;  5E3B A;  4X2T A;  2JZF A;  5FSY A;  4ESS A;  1GYT A;  4ETK A;  5D8N A;  4J5Q A;  5HIH A;  2FXK A;  4K3N A;  4JGK A;  3PEI A;  2JZD A;  1HJZ A;  3GQO A;  1LAM A;  2RNK A;  4ZX8 A;  2FAV A;  2AFC A;  4KSI A;  4J5S A;  4ZI6 A;  4ZY2 A;  3EW5 A;  2J9A A;  3VFQ A;  5FSU A;  4D86 A;  1TY8 A;  4ZY0 A;  1BPM A;  5CB3 A;  2BFR A;  4JVV A;  4JCA A;  2LGR A;  3EKE A;  3JZT A;  3SIG A;  4K0C A;  1BLL E; 
#chains in the Genus database with same CATH homology
 2XD7 A;  1TXZ A;  3V45 A;  5CMS A;  4GVW A;  3V2B A;  4ZY1 A;  3GQE A;  2BFQ A;  1YD9 A;  3EWQ A;  3IIF A;  4KYB A;  3IID A;  1ZR3 A;  3Q6Z A;  5FSV A;  1LAN A;  3KR4 A;  1SPV A;  4R7M A;  5FSX A;  3EWR A;  4ABL A;  1VHU A;  1LCP A;  5FSZ A;  2L8R A;  3SIH A;  3Q71 A;  4J5R A;  3KZW A;  2X47 A;  3SII A;  3GPQ A;  2ACF A;  4ABK A;  3T8W A;  2FG1 A;  4ZX9 A;  3H8G A;  3EWO A;  4R76 A;  3JRU A;  3KR5 A;  4ETJ A;  3H8E A;  2EEE A;  1LAP A;  1BPN A;  2EWB A;  4R6T A;  4GVV A;  4ZYQ A;  5DUS A;  1NJR A;  4JLL A;  4GUA A;  5CB5 A;  4TU0 A;  3EJG A;  1ZR5 A;  3EWP A;  4J4Z A;  5CBM A;  3GPG A;  3GPO A;  3IJ3 A;  4UML A;  5HOL A;  5AIL A;  3EJF A;  3KQZ A;  3SIJ A;  4IQY A;  2DX6 A;  3KQX A;  3H8F A;  2VRI A;  3ETI A;  5E3B A;  4X2T A;  5FSY A;  4ESS A;  1GYT A;  4ETK A;  5D8N A;  4J5Q A;  5HIH A;  2FXK A;  4K3N A;  4JGK A;  3PEI A;  1HJZ A;  3GQO A;  1LAM A;  4ZX8 A;  2FAV A;  2AFC A;  4KSI A;  4J5S A;  4ZI6 A;  4ZY2 A;  3EW5 A;  2J9A A;  3VFQ A;  5FSU A;  4D86 A;  1TY8 A;  4ZY0 A;  1BPM A;  5CB3 A;  2BFR A;  4JVV A;  4JCA A;  2LGR A;  3EKE A;  3JZT A;  3SIG A;  4K0C A;  1BLL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...