2LGYA

Ubiquitin-like domain from hoil-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title Solution structure of the E3 ligase HOIL-1 Ubl domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgyA00
4KSLC 4W9CA 3QQ8B 2JF5A 4EZLA 1IPGA 4MJSA 1L2NA 3O65B 5IA7A 1D3ZA 2JVCA 4WWOA 5C23A 2KXJA 1C1YB 2CHWA 3R66C 3KYDD 2REXA 1WI0A 3TBLD 3RT3B 4IW0A 2GMIC 3PLUA 5EDSA 2KDFB 2DYMA 3B08A 3L16A 3PLVA 3UGBB 1XQQA 2BPSA 2KLGA 4ANVA 3TCAA 2L0FA 2CU1A 2LI5A 3QIJA 2DENB 4BOZB 4JIOU 2AL6A 2IY1B 2R2QA 1WXVA 1GG3A 2ZCCA 3PPAA 2MQJA 4FULA 2GBJA 1XT9B 2JZ3B 3NHEB 3L54A 4KDIC 2LD9A 3APDA 2MSED 3DQVA 1UH6A 2KTRA 2N1VA 4MGZE 1Q5WB 2IO3B 1EF1A 2RR9A 4LCDE 3U7DA 4CYEA 2EKEC 4DBGA 4F8CB 1MG8A 1WH3A 2FCSA 4WAAA 1WJ6A 1S1QB 3OJ3A 1WZ3A 4IWOA 3ZNHB 4IC7B 3LJ3A 4EOYA 1SIFA 4NJ7A 4IM0A 2PE6B 3MTNB 4I6NB 2J7QB 3H9DA 2C9WB 4BOSC 4J6IA 1E5WA 2LWPA 4IWQA 3DBLI 4PYZA 3ZKJC 4ICUA 2IO2B 3ZW3A 2D2QA 4BKSA 3HM3A 2CR5A 4WJQA 4MEMA 3SHQA 1JRUA 3EC8A 2XK5A 1Q0WB 2CHZA 4GMVA 1R4MI 2LXAA 5KHOA 3QWZB 4WJNA 4E3CA 5C1ZA 1ZW7A 1J0GA 2BYFA 2Z0DB 3ONSA 5E6NA 2MLBA 3VUXA 4A3PA 2CKHB 1OQYA 2M4NA 1E7VA 4FADA 3M62B 4XX5A 1UELA 2DHZA 2KD0A 2NPTA 1WX8A 2KLCA 4NQKE 5J2RA 5BO4B 2CHXA 3ZVVA 2JWZA 3H7SA 4TQ0A 2NBWB 2BYEA 3HM6X 2FNJB 2Z0EB 4GDKB 2LVPA 1WE7A 4BBNF 4NJ6A 4ANWA 3ZNZB 1RFAA 4TV3A 1WY8A 1V86A 1YX5B 2KHWB 2FIFA 2MRPA 3JW0X 5JHAA 1EF5A 3PVLA 3TIXA 2NBVB 1WX7A 3L10B 3VUYA 2PPHA 3Q3FA 4GB9A 3L17A 2LXCA 1TBEA 3QAQA 3RCZA 1TTNA 3PZDA 3IG3A 3Q3JA 1K8RB 3DBRI 4G3XB 4M8NA 2KTFA 2UYZB 3R7QA 2AL3A 2PE9A 2NS5A 1OEYJ 4K7SA 3ZRCA 4GSWA 4AJWA 1V5TA 2KJRA 2LGXA 3ZLZA 3M3JA 2ASQA 2LGYA 4MGKE 2RSUA 3RUIB 5J18A 4K1RB 4AOFA 4TUUA 3VHTC 2DZKA 3CF6E 2BWES 4KZCA 2K8HA 4W9GA 3A9JB 2MBBB 4NNJB 2FCNA 3H7PB 3LDZE 5FR6A 1I42A 3V6EB 5AZFA 2L76A 3BINA 3DCGA 2QHOA 1V2YA 2KNBA 2GBRA 2KQSA 2N9XA 2OJRA 1P9DU 5CHWA 2FIDA 4JLCA 2HD5B 2D11A 2KX0A 2MCNB 1OGWA 3NY5A 3T8MA 3EHVA 4ZYNA 5LLIA 4KIKB 3S2AA 4A20A 3X23A 3U30A 2KANA 4W9JA 2J0KA 1LQBA 4HLEA 2L0TA 1WJNA 1H8CA 2N4FA 2G45B 1E90A 3GOEA 3QARA 4JL9A 4WJPA 3QK0A 2ZJDA 3DBHI 3V6CB 2KK8A 1L7YA 4PYUA 4GIVA 3PHWB 2GOWA 1J8CA 3DVNV 2FAZA 4BKSD 4ZRIA 2C5LC 4NAWB 2LRWA 4PS8A 2K1FA 3QJZA 2LUEA 1ZKHA 2IBIB 4E71A 1WR6E 3KH0A 5E6OA 4FA6A 1WGHA 1KOTA 3UQAA 3UQBA 1P3QU 3PRZA 4FJZA 2O2VB 3ML8A 3JVZX 2R2OA 3IFWB 5DPWA 3VH4B 1I35A 1Q1OA 1WM2A 3AXCA 3H6NA 3PS6A 1J19A 3RZWC 2BYVE 4GDLB 1RLFA 3TMPB 3AU4A 3ML9A 5LXHA 5DCNA 1A5RA 2ZPNA 2AYOB 5CHVC 2DYOA 1P0RA 1WXSA 1WGGA 5JZEB 2JXXA 4HWIB 1LXDA 1F9JA 5TR5A 1U4AA 3VXWA 3KYCD 3ZO5B 3N3KB 4M8MA 2A5UA 4FLHA 1UBIA 3K9OB 4OVUA 4ZDVA 5L95C 1WGYA 3APCA 3WAOA 3DVNU 1PQSA 3U8ZA 4HDOA 2HJ8A 2O6VA 3NS8A 1EUVB 4K81A 1WXMA 2MP2B 2PJHA 2IO1B 5GMVA 3PSEB 3RYTA 3JSVA 2KFKA 3R3MA 1UZXB 3M63B 1WMHB 3ZDMC 4FN2A 2KZRA 4IG7B 3K9PB 2L00B 2ZPYA 3TL5A 3PHXB 4DDGD 1WRDB 2LZ6A 4ANUA 3PREA 4IM2A 4W9DA 5D94A 3A1QB 2BKRB 2YVCA 4MGIE 3VAWA 3ZIMA 3VVWB 5CX3A 4DHZB 1XD3B 3KVFB 2KJ6A 2J0JA 4EFOA 1CMXB 2IYDB 3NOBA 4MJSB 4XZ4A 3ZUNA 4K7WA 3A9KA 4A3OA 3UIPB 5D2MB 5D6JB 1LM8B 4KDLB 3RD2A 1ZGUB 2LRUA 3IBEA 3P2BA 1VD2A 2ZCBA 2DZMA 2BKFA 3WAPA 5AEKB 4G50A 2JUOA 5G55A 3SDLC 2KFJA 2DX5B 1H4RA 5AZGA 4F1SA 4KZ0A 2MBHA 4HXDA 1KM7A 2LVOA 4W9IA 3QHTA 2NCNA 4GXBA 2KO3A 4TQ1A 3VTWA 2N9EB 3L08A 1RAXA 1OEYA 2N7EA 3A4RA 2IY0B 3AI5A 4HJKA 2JRHA 2KWUB 2KTRB 4I6PA 4MELA 1OTRB 4CO7A 3ZDTA 4WWNA 2K25A 3V61A 4HPLB 2WYQA 1T0YA 3HK0A 1P1AA 1G6JA 2M1MA 2NBUA 3HIZA 3ECIA 1HE8A 2WX0A 4FJVB 1S3SG 2MX2A 5CHFA 3WA0A 2BF8B 4HDQA 5IAAC 2KC2A 1WGRA 2G3QB 1X1MA 3NZSA 4YL8A 4MSMB 1WZ0A 3L0WB 2FCMA 5KHQA 2XK5B 3QA8A 2KJHB 4GN1A 3VQIA 2NR2A 1E8ZA 2Z59B 5AZHA 4B6WA 3ZNGC 2NPTB 1WGDA 2W9NA 4FJYA 3ALBA 4MDKE 3ZTCA 4JQWC 2KKCA 4BVUC 4WWPA 1WM3A 4LJOB 5D7GA 1KLVA 4AJYB 1V6EA 2O6VD 2RD0A 1UD7A 2CS4A 3QCAA 4LDTB 1P98A 2MBEA 3VTVA 1RRBA 4DDID 3L13A 2L7RA 4NPNA 1IP9A 2I1KA 2Y5BB 4AWJA 3KUDB 3D32A 3H1UA 1EO6A 1YQBA 2KVRA 4W9HA 4IM3A 1LFDA 1V49A 5DPSA 1FXTB 4K7UA 4RM8A 1NBFC 3SU8X 4FBJB 3B0AA 3CMMB 1ISNA 1SE9A 2KWCA 2AEHA 4EUTA 4G0NB 4MH0E 4ANXA 3ZTDA 3WANA 5JH5C 4GU2A 1WJ4A 2ZNVC 2C60A 4HCPB 3ENEA 3VH3B 1C3TA 2L8JA 1WX9A 4PS3A 4GGQA 1GJZA 4XC2A 2N1WA 4HPMB 1GUAB 2V3SA 2XBBC 3A1QA 4TKNA 4B95A 5L83A 2N7DA 2OOBB 1WFYA 3I3TB 2PEAA 4LDTD 4W9FA 4WJOA 3IHPC 1WIAA 3PRMB 2DZIA 4ASWC 3CSTA 2WDTB 4CHKA 2MBQA 2EMTA 1WJUA 3WIMA 2ZEQA 2WX1A 2D07B 4GOCA 4IUMB 3W1SA 1BT0A 1NI2A 2YLMA 1WF9A 2C7HA 2MW5A 1GNUA 3C0RB 3DOWA 4ZRKA 4KVGB 4EZJA 1V80A 2KMAA 4GDKA 3B1LX 2A4ZA 3VDZA 1QZEA 2DAFA 2G4DB 1GC6A 3PTFC 2KWVB 3X0WA 3PGEA 2DYBA 3JYUA 2M0XA 3SD5A 4DHJB 2KOXA 5E6PA 3HHMA 3W1YA 2FUHB 1SGHA 3GZNI 2JY6A 2KMCA 1E8WA 1YX6B 4II2B 2ZVOA 3VUWA 2HE7A 4NY0A 3VTUA 4EKUA 4M0WB 3DDCB 2ZZPB 4IWPA 4RM9A 2GBKA 1IYFA 3KUZA 4JGHB 5LXIB 2LJ5A 2M8SA 2RPQA 2KDEB 4KSKC 4MGYE 3RZFA 4BBNC 3N32A 2V4LA 1UGMA 2MA9B 3AU5A 4ZRJA 2C7MB 2M17A 4P7IA 2KC1A 1NDDA 3DVGX 3DBSA 2EMSA 3QC8B 3DVGY 4HVBA 2DZJA 5JHBA 1M94A 2B3AA 3T9LA 4HK2A 3BY4B 3ZNID 4F7ZA 3A9JA 4AUQC 2G4SA 4KV2A 2KQ7A 2JPHA 3H7PA 1V9JA 2DAJA 4DHJD 1VCBA 1R4NI 2JT4B 5HKHA 3UF8A 1WYWB 2IO0B 3EFUA 4RMAA 1TGZB 3NZUA 3WALA 4KIKA 1Z2MA 4PS7A 4URKA 2O6VB 4B9KA 2IZVB 2I1JA 2HTHA 3KW5B 3JSVB 2KFKB 3MJWA 2K39A 5G2NA 2UWQA 4W9LA 3R7RA 1V5OA 4OVVA 2KDBA 2NVUI 4W9KA 4MM3A 2GBNA 2BGFA 2MBOA 2FCQA 4DHZE 4DXAB 1YD8U 2D10A 3M95A 3V60A 4NAWA 2D3GA 3PRPB 3EECA 3VFKA 3V62A 3UIOB 3RULA 3W1SC 3A9KB 4AP4C 4BKGA 1YIWA 2JZZA 3A33B 2JRIB 1Y8RC 3OLMD 3A4SC 5CTRC 3ZRFA 4DWFA 2O2VA 5J17A 3QX1A 2L3ZA 1V81A 2LGDA 4BKTA 1UBQA 4II3B 1TZ1A 1WXAA 4EZKA 4W9EA 1WR1A 2ZNVB 3MHSD 2BWFA 2V1YA 2C7NB 1Z5SB 2VRRB 3UINB 4MSQB 4GDLA 4NQLB 5DPTA 2KN5A 2LVQA 2GBMA 2K8BA 4EEWA 4E74A 3AULA 3PT2B 1E8XA 2K6DB 4I6LB 2KDIA 2XEWA 2L05A 4LJPB 5DPRA 4FHKA 1GC7A 1YJ1A 4WQOB 2KX3A 3IVFA 4DK5A 3TJPA 1E7UA 2MWSB 3CSFA 4N9F4 4X57B 1KJTA 2AWTA 2MP2A 2WWZA 3PV1A 1WE6A 3OAWA 1AARA 3DPDA 4ICVA 1WMHA 3N30A 4BFRA 2N9PC 1E8YA 3WAMA 3OJ4B 4FHJA 2ZVNA 2J0MA 2K8CA 3APFA 4HCNB 2RGFA 2K6QA 4G11A 2LASA 3KUCB
chains in the Genus database with same CATH superfamily
4W9CA 1IPGA 1L2NA 4P1CC 2NTTA 4WWOA 2KXJA 3RI7C 3RT3B 3L16A 1XQQA 3TCAA 2W55A 1WGKA 2CU1A 2LI5A 3Q3OC 1RWSA 3NUHB 2Q5WD 1YMHE 3EFCA 1WXVA 3PPAA 2ZCCA 2JZ3B 3L54A 3DQVA 2KTRA 2N1VA 1Q5WB 2RR9A 2EKEC 1C9FA 3OJ3A 1WZ3A 4IWOA 4NJCA 4EOYA 3NVVA 1E5WA 4IWQA 4PYZA 3ZKJC 2D2QA 2WXIA 4WJQA 2DLBA 1Q0WB 3GP7A 5KHOA 4GMVA 2LXAA 4M01A 4WJNA 4E3CA 5C1ZA 3DHIC 2Z0DB 5IOIA 2NPTA 2KD0A 2JZPA 2V3PA 5J2RA 2CHXA 3KQ4A 2JWZA 3H7SA 1L0YB 2NBWB 2OJWA 2BW2A 2Z0EB 1BXTA 2FIFA 3JW0X 3AEGB 1EF5A 3BIID 2LHEA 4K3BA 3L17A 1KH0A 2LXCA 3AH7A 1ESFA 1TTNA 3IG3A 4M8NA 2UYZB 5HI1A 2PE9A 4OZAA 3ZRCA 1N60A 1ZUD2 3ZLZA 2LGYA 3KWLA 3ZJTA 2IDYA 3VHTC 4Q2JA 3AEAB 2KT7A 3V6EB 4KX6B 2QHOA 2KNBA 2GBRA 2HD5B 2MCNB 1OGWA 4A90A 1LQBA 1F2RC 2L32A 1ET9A 4WJPA 3QK0A 1J7BA 1TKEA 1FMAD 4MM3B 2JX5A 3PHWB 2GOWA 1J8CA 2FAZA 1K51A 2LRWA 3QJZA 1ZKHA 2IBIB 1KOTA 4C80A 3UQAA 4FJZA 1L6VA 1VJKA 1MVKA 5DPWA 3VH4B 2KMMA 1J19A 3RZWC 1NYQA 2W3SA 5CHVC 1WXSA 5JZEB 2E3TA 4JPSA 2M0AA 1U4AA 3VXWA 3ZO5B 3N3KB 1C4AA 5L95C 1WGYA 3U8ZA 4HDOA 2O6VA 1WXMA 2MP2B 2IO1B 5GMVA 3RYTA 1UZXB 2WXLA 2K0PA 2X8XX 3ZDMC 3K9PB 5EE9A 3DHHC 2ZPYA 5IO9A 3PHXB 3PREA 4W9DA 4EFOA 2IYDB 4FXCA 2INNE 5D6JB 2MJ3A 3L4PA 2UU7A 3MJ5A 3P2BA 2ZCBA 2DZMA 2BKFA 5AEKB 2JUOA 5G55A 4OZCA 3FILA 1KM7A 2ON8A 1STEA 3QHTA 4TQ1A 2N9EB 1RAXA 2N7EA 3A4RA 1CK1A 3OG5A 2KTRB 4XDDA 2K25A 1JWUD 1T0YA 1D6EC 2NBUA 2RMMA 1HE8A 2WX0A 1TS4A 2MX2A 2WNMA 2D3AA 2JQRB 3NZSA 4YL8A 3QA8A 1SXTA 4RF1A 1SE4A 1DOIA 2NPTB 3ALBA 4C00A 4RGNA 4BVUC 2KKCA 2KDMA 4XWWA 2O6VD 5T8IA 3BVMA 4LDTB 1E7PB 1ZXHA 3Q8BA 1P7EA 3D32A 2KVRA 1L0VB 4L1BA 4OVZA 1IGDA 4W9HA 4K7UA 1FIQA 3Q8AA 1J7AA 3BVZA 1ISNA 1SE9A 3V3XA 5JH5C 3WANA 4GU2A 1WJ4A 4HCPB 2N1WA 2V3SA 4TKNA 1V97A 4NAMA 2GLSA 1FXAA 4W9FA 4WJOA 4PT5A 1WIAA 3PRMB 2DZIA 2GB1A 4ASWC 3CSTA 2D5GA 4WWMA 2EMTA 1WJUA 4GOCA 3W1SA 1R7SA 2YLMA 2MW5A 1YNTE 3C0RB 4QAYA 1V8CA 3MC9A 3BVGA 4GDKA 3X0WA 3PGEA 2DYBA 2M0XA 1TJEA 4HKZE 3ZXRA 1WWTA 1YX6B 4II2B 1JWAD 2ZVOA 1QQRA 3DDCB 4IWPA 5LXIB 2AQ3B 3RNFC 3RZFA 5EE3A 4BBNC 1XO3A 3AU5A 4ZRJA 2M17A 1EU3A 3DVGY 2DZJA 2B3AA 1L5PA 3BY4B 4AUQC 4KV2A 1V9JA 1T3QA 3UF8A 3Q6BA 2IO0B 4RMAA 1TGZB 2O6VB 2I1JA 1ZPSA 2JYTA 2HTHA 4RGTA 1D5ZC 2MBOA 2FCQA 5BMIA 3V60A 3DBLB 4HKQA 3RULA 2HJ1A 4IKGA 4AP4C 1YIWA 1J7CA 3OLMD 1FCLA 2LGDA 1KTKA 4EZKA 1WR1A 2G1EA 2C7NB 3FILB 3UINB 1Q10A 4NQLB 4AQ7A 2GBMA 4OW0A 3AE3B 3PT2B 3P4RB 1E8XA 2K6DB 2KAJA 3GS2A 2Y5CA 1JWBD 2H88B 4AS1A 4WQOB 4N59A 1PDXA 2GI9A 1OFFA 1E7UA 2WXOA 2LGIA 1FD6A 3RNAC 2WWZA 3DBRB 1AARA 4ICVA 1GPXA 2PTLA 1VRAB 4HEA1 1EU4A 1WMHA 4YTPB 4BFRA 2N9PC 3OJ4B 4HCNB 4J3OD 2QSDA 1AWDA 2Y5PA 2INPE 3O65B 5IA7A 1D3ZA 2JVCA 5G5GA 5C23A 1C1YB 2H89B 2WS3B 2DYMA 2QCZA 2BPSA 2RPVA 1JCKB 5EE0A 2L0FA 4OZBA 3QIJA 3P63A 2DENB 2MJDA 2AL6A 2IY1B 2R2QA 3R2IA 2MQJA 2GBJA 3NHEB 4KDIC 1IGCA 3DBHB 3APDA 2MSED 4LCDE 2MH7A 1MG8A 1WH3A 1WJ6A 1S1QB 2WXGA 3AE9B 4NJ7A 2C9WB 1TZOA 3DBLI 1FXIA 2WHIA 4BKSA 2IO2B 3EC8A 1FNVA 3ZJUA 3RNEC 3QWZB 1ZW7A 1J0GA 3EGRA 2MLBA 2CKHB 2M4NA 4FADA 4US8A 3M62B 4XX5A 1WX8A 2KLCA 4NQKE 1GOZA 1NEKB 2IGHA 4TQ0A 1T0QC 4YT0B 1JQ4A 4GDKB 4BAXA 4BBNF 3HUIA 3ZNZB 1RFAA 3O13A 1WY8A 1I7HA 2MRPA 3IAM1 5JHAA 3PVLA 3IXSA 2IJ0A 2PPHA 3Q2AC 3Q3FA 1B9RA 1TBEA 4XE0A 3PZDA 3DBRI 4G3XB 2AL3A 2NS5A 2XNAC 1OEYJ 4K7SA 1UGJA 2KJRA 5C3JB 2ASQA 2DBYA 4MGKE 4K1RB 4AOFA 2BB5A 3ZGZA 1JALA 2BQQA 3CF6E 1XEEA 2K8HA 3LDZE 4US9A 1UWXA 2L76A 3BINA 2N9XA 1EWCA 2OJRA 1P9DU 2AQ1B 2KX0A 4JLCA 5LLIA 3S2AA 2KANA 3W5VB 1TKYA 1MG4A 2G45B 3NVWA 3GOEA 4JL9A 2SEBD 3DBHI 3C19A 3V6CB 3AV8A 4BKSD 4ZRIA 3Q69A 3T3OA 2B76B 3R8BA 2QIEB 3AEEB 4JWSC 4B0EA 4FA6A 2JWUA 1P3QU 3PRZA 3N20C 2N7JA 3AEDB 3ZYYX 4LNKA 1I35A 3NG0A 3H6NA 3PS6A 4JX1C 2WLBA 1RLFA 3TMPB 3ML9A 5C2TB 3FAHA 3NVYA 2ZPNA 1BUIC 4ITKA 2DYOA 1P0RA 4RCOA 1SF0A 2W54A 1LXDA 1F9JA 2E6XA 3P42A 2A5UA 1UBIA 3K9OB 4HRSA 4ZDVA 3APCA 1PQSA 3SFDB 4ARIA 3N9YC 1FEHA 3W5UB 2V0GA 4YSXB 1WMHB 4FN2A 4IG7B 4C4VA 3TEXA 2X38A 4DDGD 2LZ6A 2NTSA 3SR6A 5D94A 3VAWA 2YVCA 2BTEA 4DHZB 5CX3A 3KVFB 4A3OA 4K7WA 5D2MB 1LM8B 1ZGUB 2LRUA 1VD2A 3WAPA 2KFJA 5AZGA 1CQVA 4F1SA 1DOXA 2MBHA 2KN4A 3L08A 4RNAA 2N9LA 2MJEA 3ZDTA 4YSZB 2WXQA 1P1AA 2M1MA 3ECIA 1TKGA 4FJVB 2WGSA 2HTME 2KC2A 2N9KA 1X1MA 1N62A 2FCMA 2KJHB 3MHZA 3VQIA 1GB1A 5MPOA 2W9NA 4FJYA 3N1ZC 4MDKE 3ZTCA 5BMGA 4WWPA 1WM3A 4YXDB 2N0SB 1V6EA 1UD7A 2CS4A 2BB6A 1YQ4B 3MFGA 3AN1A 3HRDD 3KUDB 1VZ6A 3E9SA 1K52A 1UUPA 4C56C 1FXTB 4RM8A 1GAQB 3IT4B 2PW9A 1IUEA 4DXFA 4G0NB 3ZTDA 5TSSA 3ENEA 4XC2A 1HTOA 4HPMB 1YOVB 3I3TB 1QOFA 4LDTD 3WIMA 2BS3B 2ZEQA 1FCCC 3BK2A 1NI2A 3B9JA 1WF9A 3DOWA 2JSVX 4KVGB 2DAFA 2G4DB 1GC6A 1MPEA 3SD5A 1ZDVA 2KOXA 3HHMA 3W1YA 1SGHA 3I5JC 2KMCA 1QOBA 3P1MA 3VUWA 4EE2A 2ZZPB 4RM9A 2LJ5A 2JXTA 4KSKC 2KDEB 1TIFA 4P7IA 2WDQB 3N1XC 1FFUA 4HVBA 5JHBA 3T9LA 3A9JA 2WDRB 3H7PA 2DAJA 1VCBA 2JT4B 1PGXA 3PZ7A 2WXFA 1WYWB 1E0ZA 4NZLB 2I38A 4KIKA 4URKA 3AE2B 2IZVB 3DWGC 3AE7B 3VR9B 3Q3NC 2WXKA 3LXFA 3MJWA 2UWQA 4W9LA 1V5OA 4OVVA 2L52A 4C4VB 2GBNA 2BGFA 1CJEA 3PO0A 2K22A 4DHZE 2QEJC 4DXAB 1YD8U 3M95A 2ACZB 2W3RA 5H92C 2LUMA 3VFKA 3UIOB 3W1SC 5IKCM 4BKGA 1A70A 1WYGA 3A33B 2KVZA 3A4SC 5CTRC 2O2VA 1PUTA 1FM0D 1FNUA 4H2AA 5J17A 4BKTA 1UBQA 1E6EB 2V4IB 2ZNVB 2BWFA 2V1YA 1Z5SB 1SSNA 4EEWA 1JROA 4GLSC 3R2TA 4FHKA 3TJPA 1VLBA 2WXHA 1TS5A 3CSFA 4X57B 1K50A 1LO5D 3PV1A 2RDGA 4FHJA 3UI3A 2K8CA 2Y3AA 3P4SB 4UDUC 3RPFC 1M4VA 3A1QA 2K6QA 4ANWA 1Y56A 4KSLC 3QQ8B 4MJSA 2CHWA 3R66C 2REXA 2GRIA 3TBLD 4IW0A 3PLUA 5EDSA 2KDFB 3AE1B 3B08A 1N6ZA 4ANVA 4RGMA 4DXGA 3AMZA 4BOZB 2K3UA 1GG3A 3I9V1 4KKJA 5BYRA 1XT9B 1D5MC 1RYJA 4DBGA 4CYEA 4P6VF 2J42A 2PKOA 3ZNHB 1XLNA 2J52A 4IM0A 4I6NB 3H9DA 4J6IA 2LWPA 1XLPA 1XCQL 3NVZA 3NZ3A 4N58A 3HM3A 4RGOS 3SHQA 1JRUA 1T0SC 3C8YA 1QT9A 4LNOA 3U52E 3ONSA 5E6NA 1AYFA 3VUXA 2V9HA 4A3PA 2QDFA 1KLUD 5I4DA 1OQYA 1GB4A 2NMQA 1CZPA 5BO4B 2IPKD 5LNK1 3ZVVA 4YTNB 2BYEA 3DWMA 3HM6X 5GXGB 2LVPA 2ICIA 2D3CA 2KHWB 1YX5B 3W9CB 3TIXA 2NBVB 1WX7A 3L10B 5AUIA 4MACA 3TUOA 1K8RB 2KTFA 1DGJA 4GSWA 2LGXA 3M3JA 4ZYSA 2RSUA 5J18A 4TUUA 2PLPA 2DZKA 2BWES 3A9JB 2MBBB 4NNJB 2IGGA 2FCNA 3H7PB 1I42A 4OHJA 2WP9B 1YJIA 1V2YA 4LK0M 3PZ8A 3T8MA 3NY5A 3T3NA 2WXNA 2YEPF 3EHVA 3RN9C 4KIKB 4A20A 3U30A 2J0KA 1HQRD 3MP9A 1H8CA 1SE3A 1E90A 1I4GA 1FPYA 1N63A 2KQ4X 2KK8A 1L7YA 4PYUA 4GIVA 3DVNV 2C5LC 2VZKB 4PS8A 2K1FA 2LUEA 1ET6A 4ZRQA 4E71A 1WR6E 5E6OA 1WGHA 1V1OA 2KWDA 3UQBA 3IT6B 2O2VB 2WXJA 3ML8A 3JVZX 3CIRB 3IFWB 1Q1OA 3P4PB 3AM9A 2ZW1A 5LXHA 2AYOB 4LNNA 4PK1A 4HWIB 5IN7A 1EWYC 5HHDG 2BYTA 3WAOA 3DVNU 2HJ8A 3NS8A 3BZDB 2SAKA 1OQQA 2PJHA 3PSEB 5E6JA 3JSVA 3R3MA 2BS2B 3AE4B 3M63B 1D5XC 3Q8FA 2L00B 3HVZA 3TL5A 1WRDB 4ANUA 4IM2A 2BVCA 3A1QB 3ZIMA 3B2GA 3VVWB 2KJ6A 1CMXB 4MJSB 2CU3A 4XZ4A 3ZUNA 3A9KA 2YEPB 4KGSA 4KDLB 3IBEA 1KRHA 2ZW0A 1SBBB 4G50A 3SDLC 1TT5B 2DX5B 1H4RA 4HXDA 2LVOA 4GXBA 3VTWA 1T5XD 2V3NA 1SEBD 2IY0B 4HJKA 2JRHA 3BK1A 1ROEA 4I6PA 4CO7A 5FR3A 4WWNA 4M02A 1LGRA 4HPLB 4USAA 2WYQA 1F77A 3GZNB 3KWVA 3HK0A 4ZHPA 1BMLC 3V05A 3HIZA 3U4EG 1S3SG 5CHFA 4HDQA 2BF8B 2PVOD 5IAAC 1UF0A 2G3QB 1WZ0A 1YJJA 3U2SC 2NR2A 1E8ZA 2W82A 1L6UA 4B0MA 1FNWA 5D7GA 3MC0B 3I63C 2RDHA 1P98A 3L13A 2L7RA 1IP9A 2R61A 3LB8C 5G5HA 1L4ZB 4A6QA 1LFDA 3SU8X 4FBJB 1NBFC 5H8YE 3AE6B 3B0AA 3CMMB 1SJED 4A9AA 2AEHA 4MH0E 4ANXA 3IAS1 2ZNVC 1C3TA 3VH3B 1QLBB 2L8JA 4PS3A 3CWIA 1GJZA 3TEWA 1GUAB 5L83A 2N7DA 2OOBB 1K53A 1WRIA 3IHPC 2INCC 2WDTB 4CHKA 2MBQA 4M00A 4IUMB 2C7HA 1VZ8A 1GNUA 5FKAC 3Q14C 3ZQ4A 1V80A 2KMAA 4XWTA 2A4ZA 3NRZA 1QZEA 3PTFC 3JYUA 4DHJB 5E6PA 1C4PA 2FUHB 3GZNI 1QKZA 2JY6A 2G9HD 1E8WA 1I4QA 3B2FA 3VTUA 3FKYA 1QOAA 4D2KA 2M8SA 1UWMA 2RPQA 4MGYE 1FFVA 1MHXA 3N32A 2WQYB 2C7MB 2KC1A 1JMLA 1NDDA 2OHFA 3DVGX 3Q8EA 3DBSA 3QC8B 1VDVA 1VZ7A 4F7ZA 2MEKA 2G4SA 3TEZA 1F1HA 2EKIA 2J53A 2RDBC 3TEYA 3NZUA 3WALA 4B9KA 2BBCA 2HDEA 3KW5B 3JSVB 2LJIA 2K39A 2M19A 1NVID 2NVUI 2WXMA 4W9KA 1PYWD 2KACA 2WXPA 4NAWA 3PRPB 3EECA 3RMKC 3V62A 2QC8A 3A9KB 2AQ2B 1HA5A 2JZZA 2JRIB 1Y8RC 1R4MB 4DWFA 2LFIA 3QX1A 2L3ZA 1V81A 1TZ1A 1WXAA 4W9EA 5BYQA 1C76A 4RH6A 4GDLA 1MI0A 2K8BA 3NS1A 1SJHD 4I6LB 2KDIA 4BZAA 1YN4A 2KX3A 2JU6X 1B1ZA 2MWSB 3VR8B 3EUB2 1RFKA 3WCQA 1WE6A 3OAWA 3DPDA 3HVDA 2ZVNA 2J0MA 3APFA 4KGRA 4O1NA 2RGFA 1I4PA 2JYEA 3KH0A 1XLOA 2LASA 4IOIE 2JF5A 4EZLA 2I2YA 1AW7A 3BYTB 3KYDD 4TMAB 1WI0A 4ZHOA 2GMIC 3PLVA 3UGBB 2KLGA 3J9CA 4JIOU 1L4DB 4FULA 4K3CA 1KF6B 2LD9A 1UH6A 4P16A 1PGAA 4MGZE 4HJGE 2IO3B 1EF1A 3U7DA 4F8CB 2FCSA 4WAAA 4A55A 1KFYB 1F52A 4IC7B 3LJ3A 2LEKA 1SIFA 2LHDA 2PE6B 3MTNB 2J7QB 4BOSC 3RFZB 4ICUA 3ZW3A 2CR5A 4KKIA 4MEMA 1XXGA 2XK5A 2CHZA 1R4MI 2BYFA 1XF5L 1E7VA 2VH1A 2PMVA 1UELA 2DHZA 1E9MA 2OEDA 3ZJVA 2FNJB 1WE7A 1FRDA 4NJ6A 4ZRPA 5HG2A 4TV3A 1F0ZA 1V86A 3RNBC 1TS3A 1YN3A 3VUYA 4GB9A 4WH4A 3QAQA 4P1BC 3RCZA 1TS2A 1OQRA 3Q3JA 4LNFA 4WIPA 3R7QA 4YWGG 1NI3A 2DNFA 4AJWA 1V5TA 2PIAA 3E56A 5D3IB 1QF6A 1WXQA 2KYWA 4WURA 1ZP0B 3RUIB 4A8XC 4S17A 2K9XA 2ONQA 4KZCA 3MC8A 4W9GA 5FR6A 4N6EB 5AZFA 4R3DA 1JWSD 3ETRA 3DCGA 2KQSA 3AEFB 4XGAB 5CHWA 2FIDA 2D11A 3W2DA 1FRRA 5JXVA 4ZYNA 3X23A 1TY0A 4W9JA 4HLEA 2L0TA 1ZE3D 1WJNA 2N4FA 3QARA 1IBXA 1EM7A 2ZJDA 3GE3C 1E10A 1I4HA 4NAWB 5FK9C 4M0WA 2R2OA 4KGTA 1ZOYB 1WM2A 3AXCA 1HEZE 2BYVE 4GDLB 3AU4A 1A5RA 5DCNA 1TY2A 4RF0A 4WQMA 1WGGA 1HTQA 4L2YA 2JXXA 5TR5A 3BYYB 3KYCD 4M8MA 2VZKD 4FLHA 1TYGB 4OVUA 2WU2B 1V1PA 1SIJA 1L0XB 1EUVB 4K81A 1MJDA 2DWQA 1I4XA 2KFKA 4C7ZA 2Z8LA 2KZRA 1SB3C 1N5XA 3SFEB 2BKRB 4LNIA 4MGIE 1XD3B 1ZXIA 2J0JA 3RNCC 3NOBA 4MH8A 2AX5A 3AECB 3UIPB 1UNSA 1AN8A 3RD2A 5BYSA 3NJTA 1MHHE 3AEBB 1T6BX 2BT6A 2XN9C 1YQ3B 4KZ0A 3VRAB 4W9IA 1HZ5A 2NCNA 1ZDXA 2KO3A 2MHJA 1FO4A 3EA6A 3ZXVA 1OEYA 3AI5A 3H8HA 2KWUB 4MELA 1OTRB 3V61A 3FC4A 3DHGC 1DYQA 1G6JA 1HZ6A 4JE3B 3WA0A 4C7YA 2FBWB 3ABVB 1WGRA 2PVGC 4MSMB 3L0WB 3N1YC 5KHQA 2XK5B 3OWEB 4GN1A 2INDC 3AB5A 2QMTA 4JWUC 1PFDA 1N61A 2Z59B 5AZHA 4B6WA 3ZNGC 4HROA 1XLQA 4CQNA 1WGDA 4RFBA 3P4QB 3RNGC 1R4NB 4JQWC 1KLVA 4LJOB 4AJYB 4ARCA 2RD0A 4YSYB 3QCAA 5D3DA 2MBEA 3VTVA 1RRBA 4DDID 4NPNA 2I1KA 2Y5BB 4AWJA 3TSSA 4IDIA 1WSPA 3H1UA 1YN5A 2BS4B 1EO6A 1YQBA 1C77A 4ZOHC 3KLSX 4IM3A 1V49A 5DPSA 4S0RA 2KWCA 4EUTA 2VH2A 5BMHA 2C60A 2FE8A 1WX9A 4GGQA 1C78A 1MFWA 2QILA 1C4CA 1P7FA 2XBBC 4B95A 1PGBA 1WFYA 2PEAA 1VR9A 2L1AA 1JW9D 2WX1A 2D07B 1BT0A 4DQOC 3SEBA 1KLGD 1SE2A 2WXRA 4LTUA 4ZRKA 4EZJA 3AE8B 1IBXB 3AE5B 3B1LX 3VDZA 3I57A 2KWVB 1T0RC 2LGSA 4YTMB 2L83A 2HE7A 4NY0A 1F2RI 4EKUA 4M0WB 1HXYD 2GBKA 4WAFA 1IYFA 2FUG1 3KUZA 4JGHB 4XYCA 4LLGM 3LYYA 2V4LA 1N5WA 1UGMA 2LMCA 2MA9B 2WU5B 2EMSA 1M94A 4HK2A 3ZNID 2KQ7A 2JPHA 4DHJD 1R4NI 1C79A 4MT5A 5HKHA 4XDCA 3EFUA 1V1PB 1DOYA 5AUKA 1QILA 1Z2MA 4PS7A 2CJNA 2WDVB 1JRPA 3U7ZA 2KFKB 5G2NA 3R7RA 4TSSA 3GB1A 2KDBA 1ENFA 3URYA 4MM3A 3Q3MC 2QJLA 2D10A 3BWUD 2D3GA 1ACCA 3VRBB 5EE1A 3ZRFA 1QOGA 4II3B 1NENB 4REZA 3MHSD 4HPPA 2VRRB 4MSQB 4L23A 5DPTA 2KN5A 2LVQA 1XCTL 1NYRA 4E74A 3AULA 2TSSA 2D3BA 1RM6C 2XEWA 2L05A 4LJPB 2EELA 5DPRA 1GC7A 1YJ1A 3IVFA 4DK5A 2CJOA 4N9F4 2J4XA 1KJTA 2AWTA 2MP2A 2IGDA 1JWMD 3N30A 2K5PA 1E8YA 3WAMA 4ACFA 5IP4D 1D4BA 1I4RA 3GE8C 2M56B 5HFYA 4G11A 3Q8CA 3KUCB
chains in the Genus database with same CATH topology
4KSLC 4W9CA 3QQ8B 2JF5A 4EZLA 1IPGA 4MJSA 1L2NA 3O65B 5IA7A 1D3ZA 2JVCA 4WWOA 5C23A 2KXJA 1C1YB 2CHWA 3R66C 3KYDD 2REXA 1WI0A 3TBLD 3RT3B 4IW0A 2GMIC 3PLUA 5EDSA 2KDFB 2DYMA 3B08A 3L16A 3PLVA 3UGBB 1XQQA 2BPSA 2KLGA 4ANVA 3TCAA 2L0FA 2CU1A 2LI5A 3QIJA 2DENB 4BOZB 4JIOU 2AL6A 2IY1B 2R2QA 1WXVA 1GG3A 2ZCCA 3PPAA 2MQJA 4FULA 2GBJA 1XT9B 2JZ3B 3NHEB 3L54A 4KDIC 2LD9A 3APDA 2MSED 3DQVA 1UH6A 2KTRA 2N1VA 4MGZE 1Q5WB 2IO3B 1EF1A 2RR9A 4LCDE 3U7DA 4CYEA 2EKEC 4DBGA 4F8CB 1MG8A 1WH3A 2FCSA 4WAAA 1WJ6A 1S1QB 3OJ3A 1WZ3A 4IWOA 3ZNHB 4IC7B 3LJ3A 4EOYA 1SIFA 4NJ7A 4IM0A 2PE6B 3MTNB 4I6NB 2J7QB 3H9DA 2C9WB 4BOSC 4J6IA 1E5WA 2LWPA 4IWQA 3DBLI 4PYZA 3ZKJC 4ICUA 2IO2B 3ZW3A 2D2QA 4BKSA 3HM3A 2CR5A 4WJQA 4MEMA 3SHQA 1JRUA 3EC8A 2XK5A 1Q0WB 2CHZA 4GMVA 1R4MI 2LXAA 5KHOA 3QWZB 4WJNA 4E3CA 5C1ZA 1ZW7A 1J0GA 2BYFA 2Z0DB 3ONSA 5E6NA 2MLBA 3VUXA 4A3PA 2CKHB 1OQYA 2M4NA 1E7VA 4FADA 3M62B 4XX5A 1UELA 2DHZA 2KD0A 2NPTA 1WX8A 2KLCA 4NQKE 5J2RA 5BO4B 2CHXA 3ZVVA 2JWZA 3H7SA 4TQ0A 2NBWB 2BYEA 3HM6X 2FNJB 2Z0EB 4GDKB 2LVPA 1WE7A 4BBNF 4NJ6A 4ANWA 3ZNZB 1RFAA 4TV3A 1WY8A 1V86A 1YX5B 2KHWB 2FIFA 2MRPA 3JW0X 5JHAA 1EF5A 3PVLA 3TIXA 2NBVB 1WX7A 3L10B 3VUYA 2PPHA 3Q3FA 4GB9A 3L17A 2LXCA 1TBEA 3QAQA 3RCZA 1TTNA 3PZDA 3IG3A 3Q3JA 1K8RB 3DBRI 4G3XB 4M8NA 2KTFA 2UYZB 3R7QA 2AL3A 2PE9A 2NS5A 1OEYJ 4K7SA 3ZRCA 4GSWA 4AJWA 1V5TA 2KJRA 2LGXA 3ZLZA 3M3JA 2ASQA 2LGYA 4MGKE 2RSUA 3RUIB 5J18A 4K1RB 4AOFA 4TUUA 3VHTC 2DZKA 3CF6E 2BWES 4KZCA 2K8HA 4W9GA 3A9JB 2MBBB 4NNJB 2FCNA 3H7PB 3LDZE 5FR6A 1I42A 3V6EB 5AZFA 2L76A 3BINA 3DCGA 2QHOA 1V2YA 2KNBA 2GBRA 2KQSA 2N9XA 2OJRA 1P9DU 5CHWA 2FIDA 4JLCA 2HD5B 2D11A 2KX0A 2MCNB 1OGWA 3NY5A 3T8MA 3EHVA 4ZYNA 5LLIA 4KIKB 3S2AA 4A20A 3X23A 3U30A 2KANA 4W9JA 2J0KA 1LQBA 4HLEA 2L0TA 1WJNA 1H8CA 2N4FA 2G45B 1E90A 3GOEA 3QARA 4JL9A 4WJPA 3QK0A 2ZJDA 3DBHI 3V6CB 2KK8A 1L7YA 4PYUA 4GIVA 3PHWB 2GOWA 1J8CA 3DVNV 2FAZA 4BKSD 4ZRIA 2C5LC 4NAWB 2LRWA 4PS8A 2K1FA 3QJZA 2LUEA 1ZKHA 2IBIB 4E71A 1WR6E 3KH0A 5E6OA 4FA6A 1WGHA 1KOTA 3UQAA 3UQBA 1P3QU 3PRZA 4FJZA 2O2VB 3ML8A 3JVZX 2R2OA 3IFWB 5DPWA 3VH4B 1I35A 1Q1OA 1WM2A 3AXCA 3H6NA 3PS6A 1J19A 3RZWC 2BYVE 4GDLB 1RLFA 3TMPB 3AU4A 3ML9A 5LXHA 5DCNA 1A5RA 2ZPNA 2AYOB 5CHVC 2DYOA 1P0RA 1WXSA 1WGGA 5JZEB 2JXXA 4HWIB 1LXDA 1F9JA 5TR5A 1U4AA 3VXWA 3KYCD 3ZO5B 3N3KB 4M8MA 2A5UA 4FLHA 1UBIA 3K9OB 4OVUA 4ZDVA 5L95C 1WGYA 3APCA 3WAOA 3DVNU 1PQSA 3U8ZA 4HDOA 2HJ8A 2O6VA 3NS8A 1EUVB 4K81A 1WXMA 2MP2B 2PJHA 2IO1B 5GMVA 3PSEB 3RYTA 3JSVA 2KFKA 3R3MA 1UZXB 3M63B 1WMHB 3ZDMC 4FN2A 2KZRA 4IG7B 3K9PB 2L00B 2ZPYA 3TL5A 3PHXB 4DDGD 1WRDB 2LZ6A 4ANUA 3PREA 4IM2A 4W9DA 5D94A 3A1QB 2BKRB 2YVCA 4MGIE 3VAWA 3ZIMA 3VVWB 5CX3A 4DHZB 1XD3B 3KVFB 2KJ6A 2J0JA 4EFOA 1CMXB 2IYDB 3NOBA 4MJSB 4XZ4A 3ZUNA 4K7WA 3A9KA 4A3OA 3UIPB 5D2MB 5D6JB 1LM8B 4KDLB 3RD2A 1ZGUB 2LRUA 3IBEA 3P2BA 1VD2A 2ZCBA 2DZMA 2BKFA 3WAPA 5AEKB 4G50A 2JUOA 5G55A 3SDLC 2KFJA 2DX5B 1H4RA 5AZGA 4F1SA 4KZ0A 2MBHA 4HXDA 1KM7A 2LVOA 4W9IA 3QHTA 2NCNA 4GXBA 2KO3A 4TQ1A 3VTWA 2N9EB 3L08A 1RAXA 1OEYA 2N7EA 3A4RA 2IY0B 3AI5A 4HJKA 2JRHA 2KWUB 2KTRB 4I6PA 4MELA 1OTRB 4CO7A 3ZDTA 4WWNA 2K25A 3V61A 4HPLB 2WYQA 1T0YA 3HK0A 1P1AA 1G6JA 2M1MA 2NBUA 3HIZA 3ECIA 1HE8A 2WX0A 4FJVB 1S3SG 2MX2A 5CHFA 3WA0A 2BF8B 4HDQA 5IAAC 2KC2A 1WGRA 2G3QB 1X1MA 3NZSA 4YL8A 4MSMB 1WZ0A 3L0WB 2FCMA 5KHQA 2XK5B 3QA8A 2KJHB 4GN1A 3VQIA 2NR2A 1E8ZA 2Z59B 5AZHA 4B6WA 3ZNGC 2NPTB 1WGDA 2W9NA 4FJYA 3ALBA 4MDKE 3ZTCA 4JQWC 2KKCA 4BVUC 4WWPA 1WM3A 4LJOB 5D7GA 1KLVA 4AJYB 1V6EA 2O6VD 2RD0A 1UD7A 2CS4A 3QCAA 4LDTB 1P98A 2MBEA 3VTVA 1RRBA 4DDID 3L13A 2L7RA 4NPNA 1IP9A 2I1KA 2Y5BB 4AWJA 3KUDB 3D32A 3H1UA 1EO6A 1YQBA 2KVRA 4W9HA 4IM3A 1LFDA 1V49A 5DPSA 1FXTB 4K7UA 4RM8A 1NBFC 3SU8X 4FBJB 3B0AA 3CMMB 1ISNA 1SE9A 2KWCA 2AEHA 4EUTA 4G0NB 4MH0E 4ANXA 3ZTDA 3WANA 5JH5C 4GU2A 1WJ4A 2ZNVC 2C60A 4HCPB 3ENEA 3VH3B 1C3TA 2L8JA 1WX9A 4PS3A 4GGQA 1GJZA 4XC2A 2N1WA 4HPMB 1GUAB 2V3SA 2XBBC 3A1QA 4TKNA 4B95A 5L83A 2N7DA 2OOBB 1WFYA 3I3TB 2PEAA 4LDTD 4W9FA 4WJOA 3IHPC 1WIAA 3PRMB 2DZIA 4ASWC 3CSTA 2WDTB 4CHKA 2MBQA 2EMTA 1WJUA 3WIMA 2ZEQA 2WX1A 2D07B 4GOCA 4IUMB 3W1SA 1BT0A 1NI2A 2YLMA 1WF9A 2C7HA 2MW5A 1GNUA 3C0RB 3DOWA 4ZRKA 4KVGB 4EZJA 1V80A 2KMAA 4GDKA 3B1LX 2A4ZA 3VDZA 1QZEA 2DAFA 2G4DB 1GC6A 3PTFC 2KWVB 3X0WA 3PGEA 2DYBA 3JYUA 2M0XA 3SD5A 4DHJB 2KOXA 5E6PA 3HHMA 3W1YA 2FUHB 1SGHA 3GZNI 2JY6A 2KMCA 1E8WA 1YX6B 4II2B 2ZVOA 3VUWA 2HE7A 4NY0A 3VTUA 4EKUA 4M0WB 3DDCB 2ZZPB 4IWPA 4RM9A 2GBKA 1IYFA 3KUZA 4JGHB 5LXIB 2LJ5A 2M8SA 2RPQA 2KDEB 4KSKC 4MGYE 3RZFA 4BBNC 3N32A 2V4LA 1UGMA 2MA9B 3AU5A 4ZRJA 2C7MB 2M17A 4P7IA 2KC1A 1NDDA 3DVGX 3DBSA 2EMSA 3QC8B 3DVGY 4HVBA 2DZJA 5JHBA 1M94A 2B3AA 3T9LA 4HK2A 3BY4B 3ZNID 4F7ZA 3A9JA 4AUQC 2G4SA 4KV2A 2KQ7A 2JPHA 3H7PA 1V9JA 2DAJA 4DHJD 1VCBA 1R4NI 2JT4B 5HKHA 3UF8A 1WYWB 2IO0B 3EFUA 4RMAA 1TGZB 3NZUA 3WALA 4KIKA 1Z2MA 4PS7A 4URKA 2O6VB 4B9KA 2IZVB 2I1JA 2HTHA 3KW5B 3JSVB 2KFKB 3MJWA 2K39A 5G2NA 2UWQA 4W9LA 3R7RA 1V5OA 4OVVA 2KDBA 2NVUI 4W9KA 4MM3A 2GBNA 2BGFA 2MBOA 2FCQA 4DHZE 4DXAB 1YD8U 2D10A 3M95A 3V60A 4NAWA 2D3GA 3PRPB 3EECA 3VFKA 3V62A 3UIOB 3RULA 3W1SC 3A9KB 4AP4C 4BKGA 1YIWA 2JZZA 3A33B 2JRIB 1Y8RC 3OLMD 3A4SC 5CTRC 3ZRFA 4DWFA 2O2VA 5J17A 3QX1A 2L3ZA 1V81A 2LGDA 4BKTA 1UBQA 4II3B 1TZ1A 1WXAA 4EZKA 4W9EA 1WR1A 2ZNVB 3MHSD 2BWFA 2V1YA 2C7NB 1Z5SB 2VRRB 3UINB 4MSQB 4GDLA 4NQLB 5DPTA 2KN5A 2LVQA 2GBMA 2K8BA 4EEWA 4E74A 3AULA 3PT2B 1E8XA 2K6DB 4I6LB 2KDIA 2XEWA 2L05A 4LJPB 5DPRA 4FHKA 1GC7A 1YJ1A 4WQOB 2KX3A 3IVFA 4DK5A 3TJPA 1E7UA 2MWSB 3CSFA 4N9F4 4X57B 1KJTA 2AWTA 2MP2A 2WWZA 3PV1A 1WE6A 3OAWA 1AARA 3DPDA 4ICVA 1WMHA 3N30A 4BFRA 2N9PC 1E8YA 3WAMA 3OJ4B 4FHJA 2ZVNA 2J0MA 2K8CA 3APFA 4HCNB 2RGFA 2K6QA 4G11A 2LASA 3KUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSL C;  4W9C A;  3QQ8 B;  2JF5 A;  4EZL A;  1IPG A;  4MJS A;  1L2N A;  3O65 B;  5IA7 A;  1D3Z A;  2JVC A;  4WWO A;  5C23 A;  2KXJ A;  1C1Y B;  2CHW A;  3R66 C;  3KYD D;  2REX A;  1WI0 A;  3TBL D;  3RT3 B;  4IW0 A;  2GMI C;  3PLU A;  5EDS A;  2KDF B;  2DYM A;  3B08 A;  3L16 A;  3PLV A;  3UGB B;  1XQQ A;  2BPS A;  2KLG A;  4ANV A;  3TCA A;  2L0F A;  2CU1 A;  2LI5 A;  3QIJ A;  2DEN B;  4BOZ B;  4JIO U;  2AL6 A;  2IY1 B;  2R2Q A;  1WXV A;  1GG3 A;  2ZCC A;  3PPA A;  2MQJ A;  4FUL A;  2GBJ A;  1XT9 B;  2JZ3 B;  3NHE B;  3L54 A;  4KDI C;  2LD9 A;  3APD A;  2MSE D;  3DQV A;  1UH6 A;  2KTR A;  2N1V A;  4MGZ E;  1Q5W B;  2IO3 B;  1EF1 A;  2RR9 A;  4LCD E;  3U7D A;  4CYE A;  2EKE C;  4DBG A;  4F8C B;  1MG8 A;  1WH3 A;  2FCS A;  4WAA A;  1WJ6 A;  1S1Q B;  3OJ3 A;  1WZ3 A;  4IWO A;  3ZNH B;  4IC7 B;  3LJ3 A;  4EOY A;  1SIF A;  4NJ7 A;  4IM0 A;  2PE6 B;  3MTN B;  4I6N B;  2J7Q B;  3H9D A;  2C9W B;  4BOS C;  4J6I A;  1E5W A;  2LWP A;  4IWQ A;  3DBL I;  4PYZ A;  3ZKJ C;  4ICU A;  2IO2 B;  3ZW3 A;  2D2Q A;  4BKS A;  3HM3 A;  2CR5 A;  4WJQ A;  4MEM A;  3SHQ A;  1JRU A;  3EC8 A;  2XK5 A;  1Q0W B;  2CHZ A;  4GMV A;  1R4M I;  2LXA A;  5KHO A;  3QWZ B;  4WJN A;  4E3C A;  5C1Z A;  1ZW7 A;  1J0G A;  2BYF A;  2Z0D B;  3ONS A;  5E6N A;  2MLB A;  3VUX A;  4A3P A;  2CKH B;  1OQY A;  2M4N A;  1E7V A;  4FAD A;  3M62 B;  4XX5 A;  1UEL A;  2DHZ A;  2KD0 A;  2NPT A;  1WX8 A;  2KLC A;  4NQK E;  5J2R A;  5BO4 B;  2CHX A;  3ZVV A;  2JWZ A;  3H7S A;  4TQ0 A;  2NBW B;  2BYE A;  3HM6 X;  2FNJ B;  2Z0E B;  4GDK B;  2LVP A;  1WE7 A;  4BBN F;  4NJ6 A;  4ANW A;  3ZNZ B;  1RFA A;  4TV3 A;  1WY8 A;  1V86 A;  1YX5 B;  2KHW B;  2FIF A;  2MRP A;  3JW0 X;  5JHA A;  1EF5 A;  3PVL A;  3TIX A;  2NBV B;  1WX7 A;  3L10 B;  3VUY A;  2PPH A;  3Q3F A;  4GB9 A;  3L17 A;  2LXC A;  1TBE A;  3QAQ A;  3RCZ A;  1TTN A;  3PZD A;  3IG3 A;  3Q3J A;  1K8R B;  3DBR I;  4G3X B;  4M8N A;  2KTF A;  2UYZ B;  3R7Q A;  2AL3 A;  2PE9 A;  2NS5 A;  1OEY J;  4K7S A;  3ZRC A;  4GSW A;  4AJW A;  1V5T A;  2KJR A;  2LGX A;  3ZLZ A;  3M3J A;  2ASQ A;  2LGY A;  4MGK E;  2RSU A;  3RUI B;  5J18 A;  4K1R B;  4AOF A;  4TUU A;  3VHT C;  2DZK A;  3CF6 E;  2BWE S;  4KZC A;  2K8H A;  4W9G A;  3A9J B;  2MBB B;  4NNJ B;  2FCN A;  3H7P B;  3LDZ E;  5FR6 A;  1I42 A;  3V6E B;  5AZF A;  2L76 A;  3BIN A;  3DCG A;  2QHO A;  1V2Y A;  2KNB A;  2GBR A;  2KQS A;  2N9X A;  2OJR A;  1P9D U;  5CHW A;  2FID A;  4JLC A;  2HD5 B;  2D11 A;  2KX0 A;  2MCN B;  1OGW A;  3NY5 A;  3T8M A;  3EHV A;  4ZYN A;  5LLI A;  4KIK B;  3S2A A;  4A20 A;  3X23 A;  3U30 A;  2KAN A;  4W9J A;  2J0K A;  1LQB A;  4HLE A;  2L0T A;  1WJN A;  1H8C A;  2N4F A;  2G45 B;  1E90 A;  3GOE A;  3QAR A;  4JL9 A;  4WJP A;  3QK0 A;  2ZJD A;  3DBH I;  3V6C B;  2KK8 A;  1L7Y A;  4PYU A;  4GIV A;  3PHW B;  2GOW A;  1J8C A;  3DVN V;  2FAZ A;  4BKS D;  4ZRI A;  2C5L C;  4NAW B;  2LRW A;  4PS8 A;  2K1F A;  3QJZ A;  2LUE A;  1ZKH A;  2IBI B;  4E71 A;  1WR6 E;  3KH0 A;  5E6O A;  4FA6 A;  1WGH A;  1KOT A;  3UQA A;  3UQB A;  1P3Q U;  3PRZ A;  4FJZ A;  2O2V B;  3ML8 A;  3JVZ X;  2R2O A;  3IFW B;  5DPW A;  3VH4 B;  1I35 A;  1Q1O A;  1WM2 A;  3AXC A;  3H6N A;  3PS6 A;  1J19 A;  3RZW C;  2BYV E;  4GDL B;  1RLF A;  3TMP B;  3AU4 A;  3ML9 A;  5LXH A;  5DCN A;  1A5R A;  2ZPN A;  2AYO B;  5CHV C;  2DYO A;  1P0R A;  1WXS A;  1WGG A;  5JZE B;  2JXX A;  4HWI B;  1LXD A;  1F9J A;  5TR5 A;  1U4A A;  3VXW A;  3KYC D;  3ZO5 B;  3N3K B;  4M8M A;  2A5U A;  4FLH A;  1UBI A;  3K9O B;  4OVU A;  4ZDV A;  5L95 C;  1WGY A;  3APC A;  3WAO A;  3DVN U;  1PQS A;  3U8Z A;  4HDO A;  2HJ8 A;  2O6V A;  3NS8 A;  1EUV B;  4K81 A;  1WXM A;  2MP2 B;  2PJH A;  2IO1 B;  5GMV A;  3PSE B;  3RYT A;  3JSV A;  2KFK A;  3R3M A;  1UZX B;  3M63 B;  1WMH B;  3ZDM C;  4FN2 A;  2KZR A;  4IG7 B;  3K9P B;  2L00 B;  2ZPY A;  3TL5 A;  3PHX B;  4DDG D;  1WRD B;  2LZ6 A;  4ANU A;  3PRE A;  4IM2 A;  4W9D A;  5D94 A;  3A1Q B;  2BKR B;  2YVC A;  4MGI E;  3VAW A;  3ZIM A;  3VVW B;  5CX3 A;  4DHZ B;  1XD3 B;  3KVF B;  2KJ6 A;  2J0J A;  4EFO A;  1CMX B;  2IYD B;  3NOB A;  4MJS B;  4XZ4 A;  3ZUN A;  4K7W A;  3A9K A;  4A3O A;  3UIP B;  5D2M B;  5D6J B;  1LM8 B;  4KDL B;  3RD2 A;  1ZGU B;  2LRU A;  3IBE A;  3P2B A;  1VD2 A;  2ZCB A;  2DZM A;  2BKF A;  3WAP A;  5AEK B;  4G50 A;  2JUO A;  5G55 A;  3SDL C;  2KFJ A;  2DX5 B;  1H4R A;  5AZG A;  4F1S A;  4KZ0 A;  2MBH A;  4HXD A;  1KM7 A;  2LVO A;  4W9I A;  3QHT A;  2NCN A;  4GXB A;  2KO3 A;  4TQ1 A;  3VTW A;  2N9E B;  3L08 A;  1RAX A;  1OEY A;  2N7E A;  3A4R A;  2IY0 B;  3AI5 A;  4HJK A;  2JRH A;  2KWU B;  2KTR B;  4I6P A;  4MEL A;  1OTR B;  4CO7 A;  3ZDT A;  4WWN A;  2K25 A;  3V61 A;  4HPL B;  2WYQ A;  1T0Y A;  3HK0 A;  1P1A A;  1G6J A;  2M1M A;  2NBU A;  3HIZ A;  3ECI A;  1HE8 A;  2WX0 A;  4FJV B;  1S3S G;  2MX2 A;  5CHF A;  3WA0 A;  2BF8 B;  4HDQ A;  5IAA C;  2KC2 A;  1WGR A;  2G3Q B;  1X1M A;  3NZS A;  4YL8 A;  4MSM B;  1WZ0 A;  3L0W B;  2FCM A;  5KHQ A;  2XK5 B;  3QA8 A;  2KJH B;  4GN1 A;  3VQI A;  2NR2 A;  1E8Z A;  2Z59 B;  5AZH A;  4B6W A;  3ZNG C;  2NPT B;  1WGD A;  2W9N A;  4FJY A;  3ALB A;  4MDK E;  3ZTC A;  4JQW C;  2KKC A;  4BVU C;  4WWP A;  1WM3 A;  4LJO B;  5D7G A;  1KLV A;  4AJY B;  1V6E A;  2O6V D;  2RD0 A;  1UD7 A;  2CS4 A;  3QCA A;  4LDT B;  1P98 A;  2MBE A;  3VTV A;  1RRB A;  4DDI D;  3L13 A;  2L7R A;  4NPN A;  1IP9 A;  2I1K A;  2Y5B B;  4AWJ A;  3KUD B;  3D32 A;  3H1U A;  1EO6 A;  1YQB A;  2KVR A;  4W9H A;  4IM3 A;  1LFD A;  1V49 A;  5DPS A;  1FXT B;  4K7U A;  4RM8 A;  1NBF C;  3SU8 X;  4FBJ B;  3B0A A;  3CMM B;  1ISN A;  1SE9 A;  2KWC A;  2AEH A;  4EUT A;  4G0N B;  4MH0 E;  4ANX A;  3ZTD A;  3WAN A;  5JH5 C;  4GU2 A;  1WJ4 A;  2ZNV C;  2C60 A;  4HCP B;  3ENE A;  3VH3 B;  1C3T A;  2L8J A;  1WX9 A;  4PS3 A;  4GGQ A;  1GJZ A;  4XC2 A;  2N1W A;  4HPM B;  1GUA B;  2V3S A;  2XBB C;  3A1Q A;  4TKN A;  4B95 A;  5L83 A;  2N7D A;  2OOB B;  1WFY A;  3I3T B;  2PEA A;  4LDT D;  4W9F A;  4WJO A;  3IHP C;  1WIA A;  3PRM B;  2DZI A;  4ASW C;  3CST A;  2WDT B;  4CHK A;  2MBQ A;  2EMT A;  1WJU A;  3WIM A;  2ZEQ A;  2WX1 A;  2D07 B;  4GOC A;  4IUM B;  3W1S A;  1BT0 A;  1NI2 A;  2YLM A;  1WF9 A;  2C7H A;  2MW5 A;  1GNU A;  3C0R B;  3DOW A;  4ZRK A;  4KVG B;  4EZJ A;  1V80 A;  2KMA A;  4GDK A;  3B1L X;  2A4Z A;  3VDZ A;  1QZE A;  2DAF A;  2G4D B;  1GC6 A;  3PTF C;  2KWV B;  3X0W A;  3PGE A;  2DYB A;  3JYU A;  2M0X A;  3SD5 A;  4DHJ B;  2KOX A;  5E6P A;  3HHM A;  3W1Y A;  2FUH B;  1SGH A;  3GZN I;  2JY6 A;  2KMC A;  1E8W A;  1YX6 B;  4II2 B;  2ZVO A;  3VUW A;  2HE7 A;  4NY0 A;  3VTU A;  4EKU A;  4M0W B;  3DDC B;  2ZZP B;  4IWP A;  4RM9 A;  2GBK A;  1IYF A;  3KUZ A;  4JGH B;  5LXI B;  2LJ5 A;  2M8S A;  2RPQ A;  2KDE B;  4KSK C;  4MGY E;  3RZF A;  4BBN C;  3N32 A;  2V4L A;  1UGM A;  2MA9 B;  3AU5 A;  4ZRJ A;  2C7M B;  2M17 A;  4P7I A;  2KC1 A;  1NDD A;  3DVG X;  3DBS A;  2EMS A;  3QC8 B;  3DVG Y;  4HVB A;  2DZJ A;  5JHB A;  1M94 A;  2B3A A;  3T9L A;  4HK2 A;  3BY4 B;  3ZNI D;  4F7Z A;  3A9J A;  4AUQ C;  2G4S A;  4KV2 A;  2KQ7 A;  2JPH A;  3H7P A;  1V9J A;  2DAJ A;  4DHJ D;  1VCB A;  1R4N I;  2JT4 B;  5HKH A;  3UF8 A;  1WYW B;  2IO0 B;  3EFU A;  4RMA A;  1TGZ B;  3NZU A;  3WAL A;  4KIK A;  1Z2M A;  4PS7 A;  4URK A;  2O6V B;  4B9K A;  2IZV B;  2I1J A;  2HTH A;  3KW5 B;  3JSV B;  2KFK B;  3MJW A;  2K39 A;  5G2N A;  2UWQ A;  4W9L A;  3R7R A;  1V5O A;  4OVV A;  2KDB A;  2NVU I;  4W9K A;  4MM3 A;  2GBN A;  2BGF A;  2MBO A;  2FCQ A;  4DHZ E;  4DXA B;  1YD8 U;  2D10 A;  3M95 A;  3V60 A;  4NAW A;  2D3G A;  3PRP B;  3EEC A;  3VFK A;  3V62 A;  3UIO B;  3RUL A;  3W1S C;  3A9K B;  4AP4 C;  4BKG A;  1YIW A;  2JZZ A;  3A33 B;  2JRI B;  1Y8R C;  3OLM D;  3A4S C;  5CTR C;  3ZRF A;  4DWF A;  2O2V A;  5J17 A;  3QX1 A;  2L3Z A;  1V81 A;  2LGD A;  4BKT A;  1UBQ A;  4II3 B;  1TZ1 A;  1WXA A;  4EZK A;  4W9E A;  1WR1 A;  2ZNV B;  3MHS D;  2BWF A;  2V1Y A;  2C7N B;  1Z5S B;  2VRR B;  3UIN B;  4MSQ B;  4GDL A;  4NQL B;  5DPT A;  2KN5 A;  2LVQ A;  2GBM A;  2K8B A;  4EEW A;  4E74 A;  3AUL A;  3PT2 B;  1E8X A;  2K6D B;  4I6L B;  2KDI A;  2XEW A;  2L05 A;  4LJP B;  5DPR A;  4FHK A;  1GC7 A;  1YJ1 A;  4WQO B;  2KX3 A;  3IVF A;  4DK5 A;  3TJP A;  1E7U A;  2MWS B;  3CSF A;  4N9F 4;  4X57 B;  1KJT A;  2AWT A;  2MP2 A;  2WWZ A;  3PV1 A;  1WE6 A;  3OAW A;  1AAR A;  3DPD A;  4ICV A;  1WMH A;  3N30 A;  4BFR A;  2N9P C;  1E8Y A;  3WAM A;  3OJ4 B;  4FHJ A;  2ZVN A;  2J0M A;  2K8C A;  3APF A;  4HCN B;  2RGF A;  2K6Q A;  4G11 A;  2LAS A;  3KUC B; 
#chains in the Genus database with same CATH topology
 4W9C A;  1IPG A;  1L2N A;  4P1C C;  2NTT A;  4WWO A;  2KXJ A;  3RI7 C;  3RT3 B;  3L16 A;  1XQQ A;  3TCA A;  2W55 A;  1WGK A;  2CU1 A;  2LI5 A;  3Q3O C;  1RWS A;  3NUH B;  2Q5W D;  1YMH E;  3EFC A;  1WXV A;  3PPA A;  2ZCC A;  2JZ3 B;  3L54 A;  3DQV A;  2KTR A;  2N1V A;  1Q5W B;  2RR9 A;  2EKE C;  1C9F A;  3OJ3 A;  1WZ3 A;  4IWO A;  4NJC A;  4EOY A;  3NVV A;  1E5W A;  4IWQ A;  4PYZ A;  3ZKJ C;  2D2Q A;  2WXI A;  4WJQ A;  2DLB A;  1Q0W B;  3GP7 A;  5KHO A;  4GMV A;  2LXA A;  4M01 A;  4WJN A;  4E3C A;  5C1Z A;  3DHI C;  2Z0D B;  5IOI A;  2NPT A;  2KD0 A;  2JZP A;  2V3P A;  5J2R A;  2CHX A;  3KQ4 A;  2JWZ A;  3H7S A;  1L0Y B;  2NBW B;  2OJW A;  2BW2 A;  2Z0E B;  1BXT A;  2FIF A;  3JW0 X;  3AEG B;  1EF5 A;  3BII D;  2LHE A;  4K3B A;  3L17 A;  1KH0 A;  2LXC A;  3AH7 A;  1ESF A;  1TTN A;  3IG3 A;  4M8N A;  2UYZ B;  5HI1 A;  2PE9 A;  4OZA A;  3ZRC A;  1N60 A;  1ZUD 2;  3ZLZ A;  2LGY A;  3KWL A;  3ZJT A;  2IDY A;  3VHT C;  4Q2J A;  3AEA B;  2KT7 A;  3V6E B;  4KX6 B;  2QHO A;  2KNB A;  2GBR A;  2HD5 B;  2MCN B;  1OGW A;  4A90 A;  1LQB A;  1F2R C;  2L32 A;  1ET9 A;  4WJP A;  3QK0 A;  1J7B A;  1TKE A;  1FMA D;  4MM3 B;  2JX5 A;  3PHW B;  2GOW A;  1J8C A;  2FAZ A;  1K51 A;  2LRW A;  3QJZ A;  1ZKH A;  2IBI B;  1KOT A;  4C80 A;  3UQA A;  4FJZ A;  1L6V A;  1VJK A;  1MVK A;  5DPW A;  3VH4 B;  2KMM A;  1J19 A;  3RZW C;  1NYQ A;  2W3S A;  5CHV C;  1WXS A;  5JZE B;  2E3T A;  4JPS A;  2M0A A;  1U4A A;  3VXW A;  3ZO5 B;  3N3K B;  1C4A A;  5L95 C;  1WGY A;  3U8Z A;  4HDO A;  2O6V A;  1WXM A;  2MP2 B;  2IO1 B;  5GMV A;  3RYT A;  1UZX B;  2WXL A;  2K0P A;  2X8X X;  3ZDM C;  3K9P B;  5EE9 A;  3DHH C;  2ZPY A;  5IO9 A;  3PHX B;  3PRE A;  4W9D A;  4EFO A;  2IYD B;  4FXC A;  2INN E;  5D6J B;  2MJ3 A;  3L4P A;  2UU7 A;  3MJ5 A;  3P2B A;  2ZCB A;  2DZM A;  2BKF A;  5AEK B;  2JUO A;  5G55 A;  4OZC A;  3FIL A;  1KM7 A;  2ON8 A;  1STE A;  3QHT A;  4TQ1 A;  2N9E B;  1RAX A;  2N7E A;  3A4R A;  1CK1 A;  3OG5 A;  2KTR B;  4XDD A;  2K25 A;  1JWU D;  1T0Y A;  1D6E C;  2NBU A;  2RMM A;  1HE8 A;  2WX0 A;  1TS4 A;  2MX2 A;  2WNM A;  2D3A A;  2JQR B;  3NZS A;  4YL8 A;  3QA8 A;  1SXT A;  4RF1 A;  1SE4 A;  1DOI A;  2NPT B;  3ALB A;  4C00 A;  4RGN A;  4BVU C;  2KKC A;  2KDM A;  4XWW A;  2O6V D;  5T8I A;  3BVM A;  4LDT B;  1E7P B;  1ZXH A;  3Q8B A;  1P7E A;  3D32 A;  2KVR A;  1L0V B;  4L1B A;  4OVZ A;  1IGD A;  4W9H A;  4K7U A;  1FIQ A;  3Q8A A;  1J7A A;  3BVZ A;  1ISN A;  1SE9 A;  3V3X A;  5JH5 C;  3WAN A;  4GU2 A;  1WJ4 A;  4HCP B;  2N1W A;  2V3S A;  4TKN A;  1V97 A;  4NAM A;  2GLS A;  1FXA A;  4W9F A;  4WJO A;  4PT5 A;  1WIA A;  3PRM B;  2DZI A;  2GB1 A;  4ASW C;  3CST A;  2D5G A;  4WWM A;  2EMT A;  1WJU A;  4GOC A;  3W1S A;  1R7S A;  2YLM A;  2MW5 A;  1YNT E;  3C0R B;  4QAY A;  1V8C A;  3MC9 A;  3BVG A;  4GDK A;  3X0W A;  3PGE A;  2DYB A;  2M0X A;  1TJE A;  4HKZ E;  3ZXR A;  1WWT A;  1YX6 B;  4II2 B;  1JWA D;  2ZVO A;  1QQR A;  3DDC B;  4IWP A;  5LXI B;  2AQ3 B;  3RNF C;  3RZF A;  5EE3 A;  4BBN C;  1XO3 A;  3AU5 A;  4ZRJ A;  2M17 A;  1EU3 A;  3DVG Y;  2DZJ A;  2B3A A;  1L5P A;  3BY4 B;  4AUQ C;  4KV2 A;  1V9J A;  1T3Q A;  3UF8 A;  3Q6B A;  2IO0 B;  4RMA A;  1TGZ B;  2O6V B;  2I1J A;  1ZPS A;  2JYT A;  2HTH A;  4RGT A;  1D5Z C;  2MBO A;  2FCQ A;  5BMI A;  3V60 A;  3DBL B;  4HKQ A;  3RUL A;  2HJ1 A;  4IKG A;  4AP4 C;  1YIW A;  1J7C A;  3OLM D;  1FCL A;  2LGD A;  1KTK A;  4EZK A;  1WR1 A;  2G1E A;  2C7N B;  3FIL B;  3UIN B;  1Q10 A;  4NQL B;  4AQ7 A;  2GBM A;  4OW0 A;  3AE3 B;  3PT2 B;  3P4R B;  1E8X A;  2K6D B;  2KAJ A;  3GS2 A;  2Y5C A;  1JWB D;  2H88 B;  4AS1 A;  4WQO B;  4N59 A;  1PDX A;  2GI9 A;  1OFF A;  1E7U A;  2WXO A;  2LGI A;  1FD6 A;  3RNA C;  2WWZ A;  3DBR B;  1AAR A;  4ICV A;  1GPX A;  2PTL A;  1VRA B;  4HEA 1;  1EU4 A;  1WMH A;  4YTP B;  4BFR A;  2N9P C;  3OJ4 B;  4HCN B;  4J3O D;  2QSD A;  1AWD A;  2Y5P A;  2INP E;  3O65 B;  5IA7 A;  1D3Z A;  2JVC A;  5G5G A;  5C23 A;  1C1Y B;  2H89 B;  2WS3 B;  2DYM A;  2QCZ A;  2BPS A;  2RPV A;  1JCK B;  5EE0 A;  2L0F A;  4OZB A;  3QIJ A;  3P63 A;  2DEN B;  2MJD A;  2AL6 A;  2IY1 B;  2R2Q A;  3R2I A;  2MQJ A;  2GBJ A;  3NHE B;  4KDI C;  1IGC A;  3DBH B;  3APD A;  2MSE D;  4LCD E;  2MH7 A;  1MG8 A;  1WH3 A;  1WJ6 A;  1S1Q B;  2WXG A;  3AE9 B;  4NJ7 A;  2C9W B;  1TZO A;  3DBL I;  1FXI A;  2WHI A;  4BKS A;  2IO2 B;  3EC8 A;  1FNV A;  3ZJU A;  3RNE C;  3QWZ B;  1ZW7 A;  1J0G A;  3EGR A;  2MLB A;  2CKH B;  2M4N A;  4FAD A;  4US8 A;  3M62 B;  4XX5 A;  1WX8 A;  2KLC A;  4NQK E;  1GOZ A;  1NEK B;  2IGH A;  4TQ0 A;  1T0Q C;  4YT0 B;  1JQ4 A;  4GDK B;  4BAX A;  4BBN F;  3HUI A;  3ZNZ B;  1RFA A;  3O13 A;  1WY8 A;  1I7H A;  2MRP A;  3IAM 1;  5JHA A;  3PVL A;  3IXS A;  2IJ0 A;  2PPH A;  3Q2A C;  3Q3F A;  1B9R A;  1TBE A;  4XE0 A;  3PZD A;  3DBR I;  4G3X B;  2AL3 A;  2NS5 A;  2XNA C;  1OEY J;  4K7S A;  1UGJ A;  2KJR A;  5C3J B;  2ASQ A;  2DBY A;  4MGK E;  4K1R B;  4AOF A;  2BB5 A;  3ZGZ A;  1JAL A;  2BQQ A;  3CF6 E;  1XEE A;  2K8H A;  3LDZ E;  4US9 A;  1UWX A;  2L76 A;  3BIN A;  2N9X A;  1EWC A;  2OJR A;  1P9D U;  2AQ1 B;  2KX0 A;  4JLC A;  5LLI A;  3S2A A;  2KAN A;  3W5V B;  1TKY A;  1MG4 A;  2G45 B;  3NVW A;  3GOE A;  4JL9 A;  2SEB D;  3DBH I;  3C19 A;  3V6C B;  3AV8 A;  4BKS D;  4ZRI A;  3Q69 A;  3T3O A;  2B76 B;  3R8B A;  2QIE B;  3AEE B;  4JWS C;  4B0E A;  4FA6 A;  2JWU A;  1P3Q U;  3PRZ A;  3N20 C;  2N7J A;  3AED B;  3ZYY X;  4LNK A;  1I35 A;  3NG0 A;  3H6N A;  3PS6 A;  4JX1 C;  2WLB A;  1RLF A;  3TMP B;  3ML9 A;  5C2T B;  3FAH A;  3NVY A;  2ZPN A;  1BUI C;  4ITK A;  2DYO A;  1P0R A;  4RCO A;  1SF0 A;  2W54 A;  1LXD A;  1F9J A;  2E6X A;  3P42 A;  2A5U A;  1UBI A;  3K9O B;  4HRS A;  4ZDV A;  3APC A;  1PQS A;  3SFD B;  4ARI A;  3N9Y C;  1FEH A;  3W5U B;  2V0G A;  4YSX B;  1WMH B;  4FN2 A;  4IG7 B;  4C4V A;  3TEX A;  2X38 A;  4DDG D;  2LZ6 A;  2NTS A;  3SR6 A;  5D94 A;  3VAW A;  2YVC A;  2BTE A;  4DHZ B;  5CX3 A;  3KVF B;  4A3O A;  4K7W A;  5D2M B;  1LM8 B;  1ZGU B;  2LRU A;  1VD2 A;  3WAP A;  2KFJ A;  5AZG A;  1CQV A;  4F1S A;  1DOX A;  2MBH A;  2KN4 A;  3L08 A;  4RNA A;  2N9L A;  2MJE A;  3ZDT A;  4YSZ B;  2WXQ A;  1P1A A;  2M1M A;  3ECI A;  1TKG A;  4FJV B;  2WGS A;  2HTM E;  2KC2 A;  2N9K A;  1X1M A;  1N62 A;  2FCM A;  2KJH B;  3MHZ A;  3VQI A;  1GB1 A;  5MPO A;  2W9N A;  4FJY A;  3N1Z C;  4MDK E;  3ZTC A;  5BMG A;  4WWP A;  1WM3 A;  4YXD B;  2N0S B;  1V6E A;  1UD7 A;  2CS4 A;  2BB6 A;  1YQ4 B;  3MFG A;  3AN1 A;  3HRD D;  3KUD B;  1VZ6 A;  3E9S A;  1K52 A;  1UUP A;  4C56 C;  1FXT B;  4RM8 A;  1GAQ B;  3IT4 B;  2PW9 A;  1IUE A;  4DXF A;  4G0N B;  3ZTD A;  5TSS A;  3ENE A;  4XC2 A;  1HTO A;  4HPM B;  1YOV B;  3I3T B;  1QOF A;  4LDT D;  3WIM A;  2BS3 B;  2ZEQ A;  1FCC C;  3BK2 A;  1NI2 A;  3B9J A;  1WF9 A;  3DOW A;  2JSV X;  4KVG B;  2DAF A;  2G4D B;  1GC6 A;  1MPE A;  3SD5 A;  1ZDV A;  2KOX A;  3HHM A;  3W1Y A;  1SGH A;  3I5J C;  2KMC A;  1QOB A;  3P1M A;  3VUW A;  4EE2 A;  2ZZP B;  4RM9 A;  2LJ5 A;  2JXT A;  4KSK C;  2KDE B;  1TIF A;  4P7I A;  2WDQ B;  3N1X C;  1FFU A;  4HVB A;  5JHB A;  3T9L A;  3A9J A;  2WDR B;  3H7P A;  2DAJ A;  1VCB A;  2JT4 B;  1PGX A;  3PZ7 A;  2WXF A;  1WYW B;  1E0Z A;  4NZL B;  2I38 A;  4KIK A;  4URK A;  3AE2 B;  2IZV B;  3DWG C;  3AE7 B;  3VR9 B;  3Q3N C;  2WXK A;  3LXF A;  3MJW A;  2UWQ A;  4W9L A;  1V5O A;  4OVV A;  2L52 A;  4C4V B;  2GBN A;  2BGF A;  1CJE A;  3PO0 A;  2K22 A;  4DHZ E;  2QEJ C;  4DXA B;  1YD8 U;  3M95 A;  2ACZ B;  2W3R A;  5H92 C;  2LUM A;  3VFK A;  3UIO B;  3W1S C;  5IKC M;  4BKG A;  1A70 A;  1WYG A;  3A33 B;  2KVZ A;  3A4S C;  5CTR C;  2O2V A;  1PUT A;  1FM0 D;  1FNU A;  4H2A A;  5J17 A;  4BKT A;  1UBQ A;  1E6E B;  2V4I B;  2ZNV B;  2BWF A;  2V1Y A;  1Z5S B;  1SSN A;  4EEW A;  1JRO A;  4GLS C;  3R2T A;  4FHK A;  3TJP A;  1VLB A;  2WXH A;  1TS5 A;  3CSF A;  4X57 B;  1K50 A;  1LO5 D;  3PV1 A;  2RDG A;  4FHJ A;  3UI3 A;  2K8C A;  2Y3A A;  3P4S B;  4UDU C;  3RPF C;  1M4V A;  3A1Q A;  2K6Q A;  4ANW A;  1Y56 A;  4KSL C;  3QQ8 B;  4MJS A;  2CHW A;  3R66 C;  2REX A;  2GRI A;  3TBL D;  4IW0 A;  3PLU A;  5EDS A;  2KDF B;  3AE1 B;  3B08 A;  1N6Z A;  4ANV A;  4RGM A;  4DXG A;  3AMZ A;  4BOZ B;  2K3U A;  1GG3 A;  3I9V 1;  4KKJ A;  5BYR A;  1XT9 B;  1D5M C;  1RYJ A;  4DBG A;  4CYE A;  4P6V F;  2J42 A;  2PKO A;  3ZNH B;  1XLN A;  2J52 A;  4IM0 A;  4I6N B;  3H9D A;  4J6I A;  2LWP A;  1XLP A;  1XCQ L;  3NVZ A;  3NZ3 A;  4N58 A;  3HM3 A;  4RGO S;  3SHQ A;  1JRU A;  1T0S C;  3C8Y A;  1QT9 A;  4LNO A;  3U52 E;  3ONS A;  5E6N A;  1AYF A;  3VUX A;  2V9H A;  4A3P A;  2QDF A;  1KLU D;  5I4D A;  1OQY A;  1GB4 A;  2NMQ A;  1CZP A;  5BO4 B;  2IPK D;  5LNK 1;  3ZVV A;  4YTN B;  2BYE A;  3DWM A;  3HM6 X;  5GXG B;  2LVP A;  2ICI A;  2D3C A;  2KHW B;  1YX5 B;  3W9C B;  3TIX A;  2NBV B;  1WX7 A;  3L10 B;  5AUI A;  4MAC A;  3TUO A;  1K8R B;  2KTF A;  1DGJ A;  4GSW A;  2LGX A;  3M3J A;  4ZYS A;  2RSU A;  5J18 A;  4TUU A;  2PLP A;  2DZK A;  2BWE S;  3A9J B;  2MBB B;  4NNJ B;  2IGG A;  2FCN A;  3H7P B;  1I42 A;  4OHJ A;  2WP9 B;  1YJI A;  1V2Y A;  4LK0 M;  3PZ8 A;  3T8M A;  3NY5 A;  3T3N A;  2WXN A;  2YEP F;  3EHV A;  3RN9 C;  4KIK B;  4A20 A;  3U30 A;  2J0K A;  1HQR D;  3MP9 A;  1H8C A;  1SE3 A;  1E90 A;  1I4G A;  1FPY A;  1N63 A;  2KQ4 X;  2KK8 A;  1L7Y A;  4PYU A;  4GIV A;  3DVN V;  2C5L C;  2VZK B;  4PS8 A;  2K1F A;  2LUE A;  1ET6 A;  4ZRQ A;  4E71 A;  1WR6 E;  5E6O A;  1WGH A;  1V1O A;  2KWD A;  3UQB A;  3IT6 B;  2O2V B;  2WXJ A;  3ML8 A;  3JVZ X;  3CIR B;  3IFW B;  1Q1O A;  3P4P B;  3AM9 A;  2ZW1 A;  5LXH A;  2AYO B;  4LNN A;  4PK1 A;  4HWI B;  5IN7 A;  1EWY C;  5HHD G;  2BYT A;  3WAO A;  3DVN U;  2HJ8 A;  3NS8 A;  3BZD B;  2SAK A;  1OQQ A;  2PJH A;  3PSE B;  5E6J A;  3JSV A;  3R3M A;  2BS2 B;  3AE4 B;  3M63 B;  1D5X C;  3Q8F A;  2L00 B;  3HVZ A;  3TL5 A;  1WRD B;  4ANU A;  4IM2 A;  2BVC A;  3A1Q B;  3ZIM A;  3B2G A;  3VVW B;  2KJ6 A;  1CMX B;  4MJS B;  2CU3 A;  4XZ4 A;  3ZUN A;  3A9K A;  2YEP B;  4KGS A;  4KDL B;  3IBE A;  1KRH A;  2ZW0 A;  1SBB B;  4G50 A;  3SDL C;  1TT5 B;  2DX5 B;  1H4R A;  4HXD A;  2LVO A;  4GXB A;  3VTW A;  1T5X D;  2V3N A;  1SEB D;  2IY0 B;  4HJK A;  2JRH A;  3BK1 A;  1ROE A;  4I6P A;  4CO7 A;  5FR3 A;  4WWN A;  4M02 A;  1LGR A;  4HPL B;  4USA A;  2WYQ A;  1F77 A;  3GZN B;  3KWV A;  3HK0 A;  4ZHP A;  1BML C;  3V05 A;  3HIZ A;  3U4E G;  1S3S G;  5CHF A;  4HDQ A;  2BF8 B;  2PVO D;  5IAA C;  1UF0 A;  2G3Q B;  1WZ0 A;  1YJJ A;  3U2S C;  2NR2 A;  1E8Z A;  2W82 A;  1L6U A;  4B0M A;  1FNW A;  5D7G A;  3MC0 B;  3I63 C;  2RDH A;  1P98 A;  3L13 A;  2L7R A;  1IP9 A;  2R61 A;  3LB8 C;  5G5H A;  1L4Z B;  4A6Q A;  1LFD A;  3SU8 X;  4FBJ B;  1NBF C;  5H8Y E;  3AE6 B;  3B0A A;  3CMM B;  1SJE D;  4A9A A;  2AEH A;  4MH0 E;  4ANX A;  3IAS 1;  2ZNV C;  1C3T A;  3VH3 B;  1QLB B;  2L8J A;  4PS3 A;  3CWI A;  1GJZ A;  3TEW A;  1GUA B;  5L83 A;  2N7D A;  2OOB B;  1K53 A;  1WRI A;  3IHP C;  2INC C;  2WDT B;  4CHK A;  2MBQ A;  4M00 A;  4IUM B;  2C7H A;  1VZ8 A;  1GNU A;  5FKA C;  3Q14 C;  3ZQ4 A;  1V80 A;  2KMA A;  4XWT A;  2A4Z A;  3NRZ A;  1QZE A;  3PTF C;  3JYU A;  4DHJ B;  5E6P A;  1C4P A;  2FUH B;  3GZN I;  1QKZ A;  2JY6 A;  2G9H D;  1E8W A;  1I4Q A;  3B2F A;  3VTU A;  3FKY A;  1QOA A;  4D2K A;  2M8S A;  1UWM A;  2RPQ A;  4MGY E;  1FFV A;  1MHX A;  3N32 A;  2WQY B;  2C7M B;  2KC1 A;  1JML A;  1NDD A;  2OHF A;  3DVG X;  3Q8E A;  3DBS A;  3QC8 B;  1VDV A;  1VZ7 A;  4F7Z A;  2MEK A;  2G4S A;  3TEZ A;  1F1H A;  2EKI A;  2J53 A;  2RDB C;  3TEY A;  3NZU A;  3WAL A;  4B9K A;  2BBC A;  2HDE A;  3KW5 B;  3JSV B;  2LJI A;  2K39 A;  2M19 A;  1NVI D;  2NVU I;  2WXM A;  4W9K A;  1PYW D;  2KAC A;  2WXP A;  4NAW A;  3PRP B;  3EEC A;  3RMK C;  3V62 A;  2QC8 A;  3A9K B;  2AQ2 B;  1HA5 A;  2JZZ A;  2JRI B;  1Y8R C;  1R4M B;  4DWF A;  2LFI A;  3QX1 A;  2L3Z A;  1V81 A;  1TZ1 A;  1WXA A;  4W9E A;  5BYQ A;  1C76 A;  4RH6 A;  4GDL A;  1MI0 A;  2K8B A;  3NS1 A;  1SJH D;  4I6L B;  2KDI A;  4BZA A;  1YN4 A;  2KX3 A;  2JU6 X;  1B1Z A;  2MWS B;  3VR8 B;  3EUB 2;  1RFK A;  3WCQ A;  1WE6 A;  3OAW A;  3DPD A;  3HVD A;  2ZVN A;  2J0M A;  3APF A;  4KGR A;  4O1N A;  2RGF A;  1I4P A;  2JYE A;  3KH0 A;  1XLO A;  2LAS A;  4IOI E;  2JF5 A;  4EZL A;  2I2Y A;  1AW7 A;  3BYT B;  3KYD D;  4TMA B;  1WI0 A;  4ZHO A;  2GMI C;  3PLV A;  3UGB B;  2KLG A;  3J9C A;  4JIO U;  1L4D B;  4FUL A;  4K3C A;  1KF6 B;  2LD9 A;  1UH6 A;  4P16 A;  1PGA A;  4MGZ E;  4HJG E;  2IO3 B;  1EF1 A;  3U7D A;  4F8C B;  2FCS A;  4WAA A;  4A55 A;  1KFY B;  1F52 A;  4IC7 B;  3LJ3 A;  2LEK A;  1SIF A;  2LHD A;  2PE6 B;  3MTN B;  2J7Q B;  4BOS C;  3RFZ B;  4ICU A;  3ZW3 A;  2CR5 A;  4KKI A;  4MEM A;  1XXG A;  2XK5 A;  2CHZ A;  1R4M I;  2BYF A;  1XF5 L;  1E7V A;  2VH1 A;  2PMV A;  1UEL A;  2DHZ A;  1E9M A;  2OED A;  3ZJV A;  2FNJ B;  1WE7 A;  1FRD A;  4NJ6 A;  4ZRP A;  5HG2 A;  4TV3 A;  1F0Z A;  1V86 A;  3RNB C;  1TS3 A;  1YN3 A;  3VUY A;  4GB9 A;  4WH4 A;  3QAQ A;  4P1B C;  3RCZ A;  1TS2 A;  1OQR A;  3Q3J A;  4LNF A;  4WIP A;  3R7Q A;  4YWG G;  1NI3 A;  2DNF A;  4AJW A;  1V5T A;  2PIA A;  3E56 A;  5D3I B;  1QF6 A;  1WXQ A;  2KYW A;  4WUR A;  1ZP0 B;  3RUI B;  4A8X C;  4S17 A;  2K9X A;  2ONQ A;  4KZC A;  3MC8 A;  4W9G A;  5FR6 A;  4N6E B;  5AZF A;  4R3D A;  1JWS D;  3ETR A;  3DCG A;  2KQS A;  3AEF B;  4XGA B;  5CHW A;  2FID A;  2D11 A;  3W2D A;  1FRR A;  5JXV A;  4ZYN A;  3X23 A;  1TY0 A;  4W9J A;  4HLE A;  2L0T A;  1ZE3 D;  1WJN A;  2N4F A;  3QAR A;  1IBX A;  1EM7 A;  2ZJD A;  3GE3 C;  1E10 A;  1I4H A;  4NAW B;  5FK9 C;  4M0W A;  2R2O A;  4KGT A;  1ZOY B;  1WM2 A;  3AXC A;  1HEZ E;  2BYV E;  4GDL B;  3AU4 A;  1A5R A;  5DCN A;  1TY2 A;  4RF0 A;  4WQM A;  1WGG A;  1HTQ A;  4L2Y A;  2JXX A;  5TR5 A;  3BYY B;  3KYC D;  4M8M A;  2VZK D;  4FLH A;  1TYG B;  4OVU A;  2WU2 B;  1V1P A;  1SIJ A;  1L0X B;  1EUV B;  4K81 A;  1MJD A;  2DWQ A;  1I4X A;  2KFK A;  4C7Z A;  2Z8L A;  2KZR A;  1SB3 C;  1N5X A;  3SFE B;  2BKR B;  4LNI A;  4MGI E;  1XD3 B;  1ZXI A;  2J0J A;  3RNC C;  3NOB A;  4MH8 A;  2AX5 A;  3AEC B;  3UIP B;  1UNS A;  1AN8 A;  3RD2 A;  5BYS A;  3NJT A;  1MHH E;  3AEB B;  1T6B X;  2BT6 A;  2XN9 C;  1YQ3 B;  4KZ0 A;  3VRA B;  4W9I A;  1HZ5 A;  2NCN A;  1ZDX A;  2KO3 A;  2MHJ A;  1FO4 A;  3EA6 A;  3ZXV A;  1OEY A;  3AI5 A;  3H8H A;  2KWU B;  4MEL A;  1OTR B;  3V61 A;  3FC4 A;  3DHG C;  1DYQ A;  1G6J A;  1HZ6 A;  4JE3 B;  3WA0 A;  4C7Y A;  2FBW B;  3ABV B;  1WGR A;  2PVG C;  4MSM B;  3L0W B;  3N1Y C;  5KHQ A;  2XK5 B;  3OWE B;  4GN1 A;  2IND C;  3AB5 A;  2QMT A;  4JWU C;  1PFD A;  1N61 A;  2Z59 B;  5AZH A;  4B6W A;  3ZNG C;  4HRO A;  1XLQ A;  4CQN A;  1WGD A;  4RFB A;  3P4Q B;  3RNG C;  1R4N B;  4JQW C;  1KLV A;  4LJO B;  4AJY B;  4ARC A;  2RD0 A;  4YSY B;  3QCA A;  5D3D A;  2MBE A;  3VTV A;  1RRB A;  4DDI D;  4NPN A;  2I1K A;  2Y5B B;  4AWJ A;  3TSS A;  4IDI A;  1WSP A;  3H1U A;  1YN5 A;  2BS4 B;  1EO6 A;  1YQB A;  1C77 A;  4ZOH C;  3KLS X;  4IM3 A;  1V49 A;  5DPS A;  4S0R A;  2KWC A;  4EUT A;  2VH2 A;  5BMH A;  2C60 A;  2FE8 A;  1WX9 A;  4GGQ A;  1C78 A;  1MFW A;  2QIL A;  1C4C A;  1P7F A;  2XBB C;  4B95 A;  1PGB A;  1WFY A;  2PEA A;  1VR9 A;  2L1A A;  1JW9 D;  2WX1 A;  2D07 B;  1BT0 A;  4DQO C;  3SEB A;  1KLG D;  1SE2 A;  2WXR A;  4LTU A;  4ZRK A;  4EZJ A;  3AE8 B;  1IBX B;  3AE5 B;  3B1L X;  3VDZ A;  3I57 A;  2KWV B;  1T0R C;  2LGS A;  4YTM B;  2L83 A;  2HE7 A;  4NY0 A;  1F2R I;  4EKU A;  4M0W B;  1HXY D;  2GBK A;  4WAF A;  1IYF A;  2FUG 1;  3KUZ A;  4JGH B;  4XYC A;  4LLG M;  3LYY A;  2V4L A;  1N5W A;  1UGM A;  2LMC A;  2MA9 B;  2WU5 B;  2EMS A;  1M94 A;  4HK2 A;  3ZNI D;  2KQ7 A;  2JPH A;  4DHJ D;  1R4N I;  1C79 A;  4MT5 A;  5HKH A;  4XDC A;  3EFU A;  1V1P B;  1DOY A;  5AUK A;  1QIL A;  1Z2M A;  4PS7 A;  2CJN A;  2WDV B;  1JRP A;  3U7Z A;  2KFK B;  5G2N A;  3R7R A;  4TSS A;  3GB1 A;  2KDB A;  1ENF A;  3URY A;  4MM3 A;  3Q3M C;  2QJL A;  2D10 A;  3BWU D;  2D3G A;  1ACC A;  3VRB B;  5EE1 A;  3ZRF A;  1QOG A;  4II3 B;  1NEN B;  4REZ A;  3MHS D;  4HPP A;  2VRR B;  4MSQ B;  4L23 A;  5DPT A;  2KN5 A;  2LVQ A;  1XCT L;  1NYR A;  4E74 A;  3AUL A;  2TSS A;  2D3B A;  1RM6 C;  2XEW A;  2L05 A;  4LJP B;  2EEL A;  5DPR A;  1GC7 A;  1YJ1 A;  3IVF A;  4DK5 A;  2CJO A;  4N9F 4;  2J4X A;  1KJT A;  2AWT A;  2MP2 A;  2IGD A;  1JWM D;  3N30 A;  2K5P A;  1E8Y A;  3WAM A;  4ACF A;  5IP4 D;  1D4B A;  1I4R A;  3GE8 C;  2M56 B;  5HFY A;  4G11 A;  3Q8C A;  3KUC B; 
#chains in the Genus database with same CATH homology
 4KSL C;  4W9C A;  3QQ8 B;  2JF5 A;  4EZL A;  1IPG A;  4MJS A;  1L2N A;  3O65 B;  5IA7 A;  1D3Z A;  2JVC A;  4WWO A;  5C23 A;  2KXJ A;  1C1Y B;  2CHW A;  3R66 C;  3KYD D;  2REX A;  1WI0 A;  3TBL D;  3RT3 B;  4IW0 A;  2GMI C;  3PLU A;  5EDS A;  2KDF B;  2DYM A;  3B08 A;  3L16 A;  3PLV A;  3UGB B;  1XQQ A;  2BPS A;  2KLG A;  4ANV A;  3TCA A;  2L0F A;  2CU1 A;  2LI5 A;  3QIJ A;  2DEN B;  4BOZ B;  4JIO U;  2AL6 A;  2IY1 B;  2R2Q A;  1WXV A;  1GG3 A;  2ZCC A;  3PPA A;  2MQJ A;  4FUL A;  2GBJ A;  1XT9 B;  2JZ3 B;  3NHE B;  3L54 A;  4KDI C;  2LD9 A;  3APD A;  2MSE D;  3DQV A;  1UH6 A;  2KTR A;  2N1V A;  4MGZ E;  1Q5W B;  2IO3 B;  1EF1 A;  2RR9 A;  4LCD E;  3U7D A;  4CYE A;  2EKE C;  4DBG A;  4F8C B;  1MG8 A;  1WH3 A;  2FCS A;  4WAA A;  1WJ6 A;  1S1Q B;  3OJ3 A;  1WZ3 A;  4IWO A;  3ZNH B;  4IC7 B;  3LJ3 A;  4EOY A;  1SIF A;  4NJ7 A;  4IM0 A;  2PE6 B;  3MTN B;  4I6N B;  2J7Q B;  3H9D A;  2C9W B;  4BOS C;  4J6I A;  1E5W A;  2LWP A;  4IWQ A;  3DBL I;  4PYZ A;  3ZKJ C;  4ICU A;  2IO2 B;  3ZW3 A;  2D2Q A;  4BKS A;  3HM3 A;  2CR5 A;  4WJQ A;  4MEM A;  3SHQ A;  1JRU A;  3EC8 A;  2XK5 A;  1Q0W B;  2CHZ A;  4GMV A;  1R4M I;  2LXA A;  5KHO A;  3QWZ B;  4WJN A;  4E3C A;  5C1Z A;  1ZW7 A;  1J0G A;  2BYF A;  2Z0D B;  3ONS A;  5E6N A;  2MLB A;  3VUX A;  4A3P A;  2CKH B;  1OQY A;  2M4N A;  1E7V A;  4FAD A;  3M62 B;  4XX5 A;  1UEL A;  2DHZ A;  2KD0 A;  2NPT A;  1WX8 A;  2KLC A;  4NQK E;  5J2R A;  5BO4 B;  2CHX A;  3ZVV A;  2JWZ A;  3H7S A;  4TQ0 A;  2NBW B;  2BYE A;  3HM6 X;  2FNJ B;  2Z0E B;  4GDK B;  2LVP A;  1WE7 A;  4BBN F;  4NJ6 A;  4ANW A;  3ZNZ B;  1RFA A;  4TV3 A;  1WY8 A;  1V86 A;  1YX5 B;  2KHW B;  2FIF A;  2MRP A;  3JW0 X;  5JHA A;  1EF5 A;  3PVL A;  3TIX A;  2NBV B;  1WX7 A;  3L10 B;  3VUY A;  2PPH A;  3Q3F A;  4GB9 A;  3L17 A;  2LXC A;  1TBE A;  3QAQ A;  3RCZ A;  1TTN A;  3PZD A;  3IG3 A;  3Q3J A;  1K8R B;  3DBR I;  4G3X B;  4M8N A;  2KTF A;  2UYZ B;  3R7Q A;  2AL3 A;  2PE9 A;  2NS5 A;  1OEY J;  4K7S A;  3ZRC A;  4GSW A;  4AJW A;  1V5T A;  2KJR A;  2LGX A;  3ZLZ A;  3M3J A;  2ASQ A;  2LGY A;  4MGK E;  2RSU A;  3RUI B;  5J18 A;  4K1R B;  4AOF A;  4TUU A;  3VHT C;  2DZK A;  3CF6 E;  2BWE S;  4KZC A;  2K8H A;  4W9G A;  3A9J B;  2MBB B;  4NNJ B;  2FCN A;  3H7P B;  3LDZ E;  5FR6 A;  1I42 A;  3V6E B;  5AZF A;  2L76 A;  3BIN A;  3DCG A;  2QHO A;  1V2Y A;  2KNB A;  2GBR A;  2KQS A;  2N9X A;  2OJR A;  1P9D U;  5CHW A;  2FID A;  4JLC A;  2HD5 B;  2D11 A;  2KX0 A;  2MCN B;  1OGW A;  3NY5 A;  3T8M A;  3EHV A;  4ZYN A;  5LLI A;  4KIK B;  3S2A A;  4A20 A;  3X23 A;  3U30 A;  2KAN A;  4W9J A;  2J0K A;  1LQB A;  4HLE A;  2L0T A;  1WJN A;  1H8C A;  2N4F A;  2G45 B;  1E90 A;  3GOE A;  3QAR A;  4JL9 A;  4WJP A;  3QK0 A;  2ZJD A;  3DBH I;  3V6C B;  2KK8 A;  1L7Y A;  4PYU A;  4GIV A;  3PHW B;  2GOW A;  1J8C A;  3DVN V;  2FAZ A;  4BKS D;  4ZRI A;  2C5L C;  4NAW B;  2LRW A;  4PS8 A;  2K1F A;  3QJZ A;  2LUE A;  1ZKH A;  2IBI B;  4E71 A;  1WR6 E;  3KH0 A;  5E6O A;  4FA6 A;  1WGH A;  1KOT A;  3UQA A;  3UQB A;  1P3Q U;  3PRZ A;  4FJZ A;  2O2V B;  3ML8 A;  3JVZ X;  2R2O A;  3IFW B;  5DPW A;  3VH4 B;  1I35 A;  1Q1O A;  1WM2 A;  3AXC A;  3H6N A;  3PS6 A;  1J19 A;  3RZW C;  2BYV E;  4GDL B;  1RLF A;  3TMP B;  3AU4 A;  3ML9 A;  5LXH A;  5DCN A;  1A5R A;  2ZPN A;  2AYO B;  5CHV C;  2DYO A;  1P0R A;  1WXS A;  1WGG A;  5JZE B;  2JXX A;  4HWI B;  1LXD A;  1F9J A;  5TR5 A;  1U4A A;  3VXW A;  3KYC D;  3ZO5 B;  3N3K B;  4M8M A;  2A5U A;  4FLH A;  1UBI A;  3K9O B;  4OVU A;  4ZDV A;  5L95 C;  1WGY A;  3APC A;  3WAO A;  3DVN U;  1PQS A;  3U8Z A;  4HDO A;  2HJ8 A;  2O6V A;  3NS8 A;  1EUV B;  4K81 A;  1WXM A;  2MP2 B;  2PJH A;  2IO1 B;  5GMV A;  3PSE B;  3RYT A;  3JSV A;  2KFK A;  3R3M A;  1UZX B;  3M63 B;  1WMH B;  3ZDM C;  4FN2 A;  2KZR A;  4IG7 B;  3K9P B;  2L00 B;  2ZPY A;  3TL5 A;  3PHX B;  4DDG D;  1WRD B;  2LZ6 A;  4ANU A;  3PRE A;  4IM2 A;  4W9D A;  5D94 A;  3A1Q B;  2BKR B;  2YVC A;  4MGI E;  3VAW A;  3ZIM A;  3VVW B;  5CX3 A;  4DHZ B;  1XD3 B;  3KVF B;  2KJ6 A;  2J0J A;  4EFO A;  1CMX B;  2IYD B;  3NOB A;  4MJS B;  4XZ4 A;  3ZUN A;  4K7W A;  3A9K A;  4A3O A;  3UIP B;  5D2M B;  5D6J B;  1LM8 B;  4KDL B;  3RD2 A;  1ZGU B;  2LRU A;  3IBE A;  3P2B A;  1VD2 A;  2ZCB A;  2DZM A;  2BKF A;  3WAP A;  5AEK B;  4G50 A;  2JUO A;  5G55 A;  3SDL C;  2KFJ A;  2DX5 B;  1H4R A;  5AZG A;  4F1S A;  4KZ0 A;  2MBH A;  4HXD A;  1KM7 A;  2LVO A;  4W9I A;  3QHT A;  2NCN A;  4GXB A;  2KO3 A;  4TQ1 A;  3VTW A;  2N9E B;  3L08 A;  1RAX A;  1OEY A;  2N7E A;  3A4R A;  2IY0 B;  3AI5 A;  4HJK A;  2JRH A;  2KWU B;  2KTR B;  4I6P A;  4MEL A;  1OTR B;  4CO7 A;  3ZDT A;  4WWN A;  2K25 A;  3V61 A;  4HPL B;  2WYQ A;  1T0Y A;  3HK0 A;  1P1A A;  1G6J A;  2M1M A;  2NBU A;  3HIZ A;  3ECI A;  1HE8 A;  2WX0 A;  4FJV B;  1S3S G;  2MX2 A;  5CHF A;  3WA0 A;  2BF8 B;  4HDQ A;  5IAA C;  2KC2 A;  1WGR A;  2G3Q B;  1X1M A;  3NZS A;  4YL8 A;  4MSM B;  1WZ0 A;  3L0W B;  2FCM A;  5KHQ A;  2XK5 B;  3QA8 A;  2KJH B;  4GN1 A;  3VQI A;  2NR2 A;  1E8Z A;  2Z59 B;  5AZH A;  4B6W A;  3ZNG C;  2NPT B;  1WGD A;  2W9N A;  4FJY A;  3ALB A;  4MDK E;  3ZTC A;  4JQW C;  2KKC A;  4BVU C;  4WWP A;  1WM3 A;  4LJO B;  5D7G A;  1KLV A;  4AJY B;  1V6E A;  2O6V D;  2RD0 A;  1UD7 A;  2CS4 A;  3QCA A;  4LDT B;  1P98 A;  2MBE A;  3VTV A;  1RRB A;  4DDI D;  3L13 A;  2L7R A;  4NPN A;  1IP9 A;  2I1K A;  2Y5B B;  4AWJ A;  3KUD B;  3D32 A;  3H1U A;  1EO6 A;  1YQB A;  2KVR A;  4W9H A;  4IM3 A;  1LFD A;  1V49 A;  5DPS A;  1FXT B;  4K7U A;  4RM8 A;  1NBF C;  3SU8 X;  4FBJ B;  3B0A A;  3CMM B;  1ISN A;  1SE9 A;  2KWC A;  2AEH A;  4EUT A;  4G0N B;  4MH0 E;  4ANX A;  3ZTD A;  3WAN A;  5JH5 C;  4GU2 A;  1WJ4 A;  2ZNV C;  2C60 A;  4HCP B;  3ENE A;  3VH3 B;  1C3T A;  2L8J A;  1WX9 A;  4PS3 A;  4GGQ A;  1GJZ A;  4XC2 A;  2N1W A;  4HPM B;  1GUA B;  2V3S A;  2XBB C;  3A1Q A;  4TKN A;  4B95 A;  5L83 A;  2N7D A;  2OOB B;  1WFY A;  3I3T B;  2PEA A;  4LDT D;  4W9F A;  4WJO A;  3IHP C;  1WIA A;  3PRM B;  2DZI A;  4ASW C;  3CST A;  2WDT B;  4CHK A;  2MBQ A;  2EMT A;  1WJU A;  3WIM A;  2ZEQ A;  2WX1 A;  2D07 B;  4GOC A;  4IUM B;  3W1S A;  1BT0 A;  1NI2 A;  2YLM A;  1WF9 A;  2C7H A;  2MW5 A;  1GNU A;  3C0R B;  3DOW A;  4ZRK A;  4KVG B;  4EZJ A;  1V80 A;  2KMA A;  4GDK A;  3B1L X;  2A4Z A;  3VDZ A;  1QZE A;  2DAF A;  2G4D B;  1GC6 A;  3PTF C;  2KWV B;  3X0W A;  3PGE A;  2DYB A;  3JYU A;  2M0X A;  3SD5 A;  4DHJ B;  2KOX A;  5E6P A;  3HHM A;  3W1Y A;  2FUH B;  1SGH A;  3GZN I;  2JY6 A;  2KMC A;  1E8W A;  1YX6 B;  4II2 B;  2ZVO A;  3VUW A;  2HE7 A;  4NY0 A;  3VTU A;  4EKU A;  4M0W B;  3DDC B;  2ZZP B;  4IWP A;  4RM9 A;  2GBK A;  1IYF A;  3KUZ A;  4JGH B;  5LXI B;  2LJ5 A;  2M8S A;  2RPQ A;  2KDE B;  4KSK C;  4MGY E;  3RZF A;  4BBN C;  3N32 A;  2V4L A;  1UGM A;  2MA9 B;  3AU5 A;  4ZRJ A;  2C7M B;  2M17 A;  4P7I A;  2KC1 A;  1NDD A;  3DVG X;  3DBS A;  2EMS A;  3QC8 B;  3DVG Y;  4HVB A;  2DZJ A;  5JHB A;  1M94 A;  2B3A A;  3T9L A;  4HK2 A;  3BY4 B;  3ZNI D;  4F7Z A;  3A9J A;  4AUQ C;  2G4S A;  4KV2 A;  2KQ7 A;  2JPH A;  3H7P A;  1V9J A;  2DAJ A;  4DHJ D;  1VCB A;  1R4N I;  2JT4 B;  5HKH A;  3UF8 A;  1WYW B;  2IO0 B;  3EFU A;  4RMA A;  1TGZ B;  3NZU A;  3WAL A;  4KIK A;  1Z2M A;  4PS7 A;  4URK A;  2O6V B;  4B9K A;  2IZV B;  2I1J A;  2HTH A;  3KW5 B;  3JSV B;  2KFK B;  3MJW A;  2K39 A;  5G2N A;  2UWQ A;  4W9L A;  3R7R A;  1V5O A;  4OVV A;  2KDB A;  2NVU I;  4W9K A;  4MM3 A;  2GBN A;  2BGF A;  2MBO A;  2FCQ A;  4DHZ E;  4DXA B;  1YD8 U;  2D10 A;  3M95 A;  3V60 A;  4NAW A;  2D3G A;  3PRP B;  3EEC A;  3VFK A;  3V62 A;  3UIO B;  3RUL A;  3W1S C;  3A9K B;  4AP4 C;  4BKG A;  1YIW A;  2JZZ A;  3A33 B;  2JRI B;  1Y8R C;  3OLM D;  3A4S C;  5CTR C;  3ZRF A;  4DWF A;  2O2V A;  5J17 A;  3QX1 A;  2L3Z A;  1V81 A;  2LGD A;  4BKT A;  1UBQ A;  4II3 B;  1TZ1 A;  1WXA A;  4EZK A;  4W9E A;  1WR1 A;  2ZNV B;  3MHS D;  2BWF A;  2V1Y A;  2C7N B;  1Z5S B;  2VRR B;  3UIN B;  4MSQ B;  4GDL A;  4NQL B;  5DPT A;  2KN5 A;  2LVQ A;  2GBM A;  2K8B A;  4EEW A;  4E74 A;  3AUL A;  3PT2 B;  1E8X A;  2K6D B;  4I6L B;  2KDI A;  2XEW A;  2L05 A;  4LJP B;  5DPR A;  4FHK A;  1GC7 A;  1YJ1 A;  4WQO B;  2KX3 A;  3IVF A;  4DK5 A;  3TJP A;  1E7U A;  2MWS B;  3CSF A;  4N9F 4;  4X57 B;  1KJT A;  2AWT A;  2MP2 A;  2WWZ A;  3PV1 A;  1WE6 A;  3OAW A;  1AAR A;  3DPD A;  4ICV A;  1WMH A;  3N30 A;  4BFR A;  2N9P C;  1E8Y A;  3WAM A;  3OJ4 B;  4FHJ A;  2ZVN A;  2J0M A;  2K8C A;  3APF A;  4HCN B;  2RGF A;  2K6Q A;  4G11 A;  2LAS A;  3KUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...