2LGYA

Ubiquitin-like domain from hoil-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E3 ligase HOIL-1 Ubl domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgyA00
2JZZA 4W9EA 4EZLA 2UWQA 3UIOB 2YLMA 4MDKE 4KVGB 3MHSD 4BFRA 4GU2A 4EFOA 2QHOA 2FNJB 5C1ZA 1WGRA 1I42A 2A5UA 2G4DB 3ML8A 1RLFA 4CYEA 2IY0B 1R4NI 3OJ4B 3BY4B 3ONSA 1EF5A 1WGDA 3Q3FA 3VH3B 3ZKJC 5C23A 3L08A 4FJVB 4DWFA 2BWFA 3D32A 1RAXA 4AP4C 2W9NA 1EUVB 4IWPA 5E6NA 2N1WA 2HTHA 5GMVA 2NR2A 3HM3A 1V86A 4KDLB 2OOBB 3VTVA 3QCAA 5AEKB 5FR6A 2MBEA 2N9XA 4WJQA 5E6PA 2JT4B 2AL6A 4BOZB 2HJ8A 3N30A 5AZFA 3QHTA 2V4LA 1V2YA 1SGHA 1V9JA 2NS5A 4IC7B 4DDGD 2WDTB 1OEYJ 3RUIB 4HDQA 3RCZA 3ZRFA 3DBRI 3ZRCA 3OJ3A 2BKRB 4W9KA 4AWJA 1NI2A 4ZRIA 2KN5A 4I6NB 3IFWB 3V60A 2WX0A 3AU5A 4BKTA 3SD5A 4W9LA 2LXCA 3VQIA 1H8CA 3DVGX 1UBIA 2K8CA 2ZVOA 2ZNVB 2C7HA 2K6DB 1WY8A 2ZEQA 1P9DU 4K7SA 3UQBA 4FADA 2G4SA 4W9CA 3A4RA 2L7RA 1TTNA 3ZVVA 1P1AA 4HPMB 4W9GA 4MJSB 3WALA 1WX8A 1GJZA 3PRPB 5DPSA 3KUCB 2LVQA 2KANA 2KO3A 4MH0E 2L0FA 4G3XB 3V6EB 2R2OA 3TL5A 2Z59B 2KD0A 2KFJA 2EMSA 2CHXA 2NVUI 2KQSA 1S3SG 2K1FA 3H7PA 3OLMD 4IUMB 4M8MA 4CHKA 2WX1A 4GGQA 3X0WA 5D6JB 1EF1A 2J0JA 4WWNA 5D94A 4MSQB 3WA0A 4ICUA 4B95A 2XBBC 4AJYB 3KVFB 4E3CA 2MBOA 3DVNU 1K8RB 1YX6B 4MGZE 4E71A 2N4FA 3P2BA 1OTRB 1XD3B 2M1MA 1CMXB 3M3JA 1ZKHA 1SIFA 2RPQA 3KUDB 4W9DA 4RM8A 4WJPA 2BPSA 2NBVB 3QIJA 2CKHB 5LXHA 1SE9A 2RSUA 4GDKA 3QC8B 1WM2A 2KTRA 3WAMA 3A9JA 3NZSA 3RULA 1C3TA 4PS3A 1QZEA 1WGHA 2HD5B 2MQJA 4KIKA 4WJNA 2JRIB 3W1SC 2M0XA 2C60A 4I6PA 1V49A 4GDLA 1UZXB 5J18A 4NJ6A 3WAPA 2J7QB 1WXMA 2BYVE 4BBNF 2N1VA 1MG8A 2AWTA 3WANA 4BBNC 3A9KA 3QA8A 1Q1OA 2FCQA 3WIMA 1WX9A 3JSVB 2MLBA 3VH4B 2XK5A 1WX7A 2DAFA 2KJRA 1WR6E 3PLVA 3JVZX 2KC2A 2BGFA 2LWPA 2ZJDA 1LXDA 2JPHA 3A1QB 4DXAB 1OQYA 5J17A 4A3PA 1WH3A 2LZ6A 4TKNA 4DHJB 3PRZA 2IO3B 4ANUA 2GBRA 2UYZB 3U7DA 4HCPB 3NZUA 3PREA 3UF8A 2D3GA 2DZKA 2KNBA 2N9PC 1JRUA 2KFKB 1WE7A 2AL3A 2V3SA 4E74A 2DENB 3K9OB 4NQLB 3ZDTA 2KLCA 5L83A 4NJ7A 4AOFA 1E8YA 2KX0A 2OJRA 2Y5BB 3K9PB 1IP9A 3KUZA 4EOYA 4K7WA 1WXAA 3R7RA 1UD7A 1H4RA 4HCNB 3JW0X 3DOWA 4NY0A 4M0WB 3PHXB 1X1MA 3QARA 4HWIB 3VDZA 5CHVC 3APFA 4DBGA 4B6WA 4FN2A 4BVUC 2B3AA 2XEWA 3UGBB 4A20A 4FBJB 2LGYA 1Y8RC 1TGZB 2L00B 3A33B 3TBLD 1BT0A 2O6VB 4BKGA 2KFKA 4LDTD 2FUHB 4KDIC 3HM6X 3PSEB 4J6IA 2J0KA 3HHMA 4LDTB 2PEAA 3B08A 3EHVA 4GB9A 4PS7A 3MJWA 2MA9B 4WJOA 2PE9A 1VCBA 2KJ6A 3L16A 3VUYA 3W1SA 3ZUNA 3NS8A 4OVUA 3ML9A 3DBSA 4JL9A 2ZPYA 2MP2A 3KYCD 1GUAB 3R66C 2IBIB 3ZLZA 2D07B 2AYOB 5AZHA 3PLUA 3AXCA 2LGXA 3APCA 3BINA 3QQ8B 1OEYA 3OAWA 3TMPB 1HE8A 2M4NA 3EFUA 3ZNHB 2FIDA 3M95A 3V62A 3A1QA 2FAZA 3ZDMC 2KDIA 2KMAA 3C0RB 2MP2B 1C1YB 5E6OA 5JHBA 2PE6B 4DDID 2KTRB 2RR9A 3UINB 1WGGA 5EDSA 4I6LB 4HLEA 3HK0A 4MGKE 1S1QB 4TUUA 3S2AA 1TBEA 2M17A 3DQVA 3M62B 3Q3JA 1WJ6A 3H9DA 3PPAA 1ZGUB 3GZNI 3L13A 4PYZA 1U4AA 1YJ1A 3IHPC 4HVBA 1UH6A 3VAWA 5CHFA 1Z2MA 2G3QB 2N7DA 2KX3A 4TQ0A 5KHOA 2IO1B 1P0RA 4KV2A 1L2NA 4EEWA 4EZJA 3L17A 2ZCBA 2PPHA 3KH0A 1YIWA 4TQ1A 2GBJA 2LVPA 1AARA 1OGWA 2LJ5A 4W9HA 3RZWC 3AU4A 5LLIA 1PQSA 2N9EB 2LGDA 1WZ0A 1WGYA 3RZFA 3VTUA 3M63B 3DPDA 1R4MI 2V1YA 3H6NA 4FJZA 2O2VB 4WWPA 2GMIC 2M8SA 3ALBA 3H1UA 3I3TB 5IA7A 3PT2B 1WXVA 4MSMB 1EO6A 2REXA 2KDFB 2KHWB 3KYDD 1E8WA 2G45B 1Q0WB 1V81A 1WJ4A 3UIPB 3B0AA 4GMVA 1V80A 4W9FA 3QAQA 4K81A 3IG3A 1YX5B 2FCMA 4ASWC 4FLHA 4WAAA 3EC8A 2KDBA 2KWCA 4WQOB 3DCGA 5D7GA 5DPRA 3RD2A 2BKFA 4HK2A 2KLGA 4FHJA 1IPGA 3B1LX 1FXTB 4XZ4A 3X23A 1GC6A 1RFAA 1A5RA 4W9IA 3ZIMA 2L76A 3IVFA 3U30A 4FHKA 5KHQA 1P98A 4NQKE 4A3OA 3DVNV 5L95C 4G0NB 2IY1B 1KJTA 1WI0A 3SDLC 1WJUA 3VVWB 1F9JA 2IO0B 1T0YA 3CSFA 5DPTA 3TIXA 4DHZB 4DK5A 4PYUA 3PHWB 1J0GA 2JUOA 3ECIA 5D2MB 4F8CB 3A4SC 2IO2B 2KOXA 2MSED 4NNJB 2KTFA 3CF6E 3VUWA 1UGMA 2I1JA 3MTNB 3DBHI 2MWSB 3ZNID 4DHZE 2RGFA 2D11A 4HPLB 3QX1A 3PGEA 2PJHA 1Q5WB 2BYEA 5JZEB 4XC2A 2EMTA 5JHAA 2NBUA 2JY6A 1UELA 1J19A 4FA6A 2AEHA 4OVVA 4BOSC 4AJWA 2R2QA 3N32A 2NPTA 4BKSD 1V5TA 1WZ3A 3V61A 1LQBA 2ZZPB 3ZO5B 2BWES 1ISNA 2JXXA 2C7NB 2GBMA 2JF5A 4X57B 3NHEB 1J8CA 4ZYNA 1KLVA 2LVOA 1YD8U 3NY5A 4IWQA 2FCNA 2RD0A 4GN1A 4PS8A 4IW0A 2MBHA 4MELA 3ENEA 3VXWA 4FULA 3KW5B 2ZVNA 2K25A 2D10A 4M8NA 3LJ3A 2ASQA 3AI5A 3QK0A 2MX2A 2ZNVC 2O2VA 2K6QA 1WMHA 3HIZA 2A4ZA 4K7UA 4RM9A 2KMCA 4LJOB 4AUQC 4HJKA 5IAAC 2C5LC 1GNUA 1WE6A 2MRPA 3RT3B 2DZJA 2L3ZA 4BKSA 3CMMB 2I1KA 4FJYA 4B9KA 1WRDB 1E90A 2L05A 3PTFC 4GOCA 1VD2A 4IM0A 3R7QA 1WR1A 2CU1A 2KWUB 1WYWB 1TZ1A 2DX5B 2GOWA 4MGYE 3UQAA 3VUXA 4HDOA 3EECA 5CX3A 1M94A 3PS6A 4G11A 4NAWB 5DPWA 4EZKA 4II3B 4GSWA 3RYTA 5CTRC 2K8HA 2MBQA 2DYBA 4GXBA 1LFDA 3JYUA 5HKHA 2LI5A 2K8BA 4ANWA 1WFYA 4LCDE 4G50A 1KM7A 1WXSA 2LXAA 2KWVB 1GC7A 4KSKC 4IWOA 4NAWA 4ANVA 3W1YA 1YQBA 2L0TA 4WWOA 5BO4B 3H7SA 1KOTA 1E8ZA 1ZW7A 4MM3A 4CO7A 1E7UA 2CHZA 2BYFA 2KXJA 5LXIB 3SHQA 3ZNGC 3A9JB 3IBEA 2L8JA 3ZTCA 3PRMB 4DHJD 3QWZB 3TCAA 4NPNA 2CHWA 4MEMA 4EKUA 4JLCA 3DVGY 4II2B 3L10B 2DAJA 2KK8A 2KZRA 5DCNA 2O6VA 4GIVA 5AZGA 4RMAA 3N3KB 4MGIE 2NBWB 4HXDA 3VFKA 2J0MA 4LJPB 2KDEB 3ZW3A 2GBKA 2DYOA 4ZDVA 2KVRA 3PV1A 1V5OA 2LD9A 3ZNZB 2Z0EB 2JWZA 2VRRB 2N7EA 3DBLI 3APDA 2KC1A 4URKA 2D2QA 2K39A 1IYFA 4KZCA 4KSLC 4EUTA 2WYQA 2Z0DB 2GBNA 2IZVB 2JVCA 4JIOU 1UBQA 5TR5A 4F7ZA 4XX5A 4MJSA 2CR5A 2ZCCA 4P7IA 4N9F4 2NPTB 3T9LA 3VTWA 3WAOA 3AULA 2KKCA 3DDCB 3VHTC 1WJNA 2ZPNA 2XK5B 4ANXA 1E5WA 3JSVA 1I35A 1E7VA 3A9KB 1RRBA 2JZ3B 4JQWC 2JRHA 3U8ZA 1Z5SB 1WF9A 2DZMA 3NOBA 1L7YA 4IM3A 4YL8A 3SU8X 4ZRJA 1E8XA 2DHZA 2MW5A 4F1SA 2EKEC 4KIKB 1WIAA 4KZ0A 2KJHB 2KQ7A 3L54A 1NDDA 2IYDB 2LRUA 2LASA 2NCNA 4GDKB 4TV3A 2WWZA 5G2NA 4IM2A 3L0WB 4GDLB 1G6JA 3T8MA 2CS4A 2C7MB 2YVCA 4W9JA 5CHWA 2LRWA 2HE7A 3ZTDA 2DYMA 3QJZA 5G55A 5JH5C 3V6CB 1P3QU 2FCSA 5J2RA 1XQQA 2LUEA 3TJPA 3R3MA 1NBFC 4JGHB 2MCNB 2FIFA 4ICVA 3GOEA 1D3ZA 4ZRKA 3O65B 4K1RB 1WM3A 2BF8B 3H7PB 1XT9B 2DZIA 3PVLA 3PZDA 4IG7B 3CSTA 2C9WB 2MBBB 1GG3A 1WMHB 2O6VD 1LM8B 3LDZE 1V6EA
chains in the Genus database with same CATH superfamily
2JZZA 4EZLA 4MDKE 1C4PA 2WXKA 1JW9D 1YNTE 1I42A 2A5UA 4DXFA 1RLFA 4CYEA 2IY0B 1R4NI 3Q3FA 3VH3B 1EF5A 1JQ4A 2WDQB 2INPE 5C23A 3L08A 2ICIA 5D3DA 2BWFA 1RAXA 4AP4C 1ET9A 4IWPA 3C8YA 5E6NA 3Q3NC 2NR2A 3HM3A 1V86A 4KDLB 2OOBB 4M02A 4B0MA 1QLBB 3N30A 1DGJA 3RUIB 2WU2B 1WRIA 2BKRB 4W9KA 4AWJA 3AE3B 3AEFB 1AN8A 1T3QA 4W9LA 4JPSA 1H8CA 2K5PA 1K52A 4ZOHC 2C7HA 4XWTA 2BB5A 2ZEQA 2QEJC 4W9CA 3A4RA 3ZVVA 1C9FA 2G1EA 2VZKB 3PRPB 5DPSA 2W82A 2L0FA 4G3XB 3V6EB 3NRZA 3H7PA 3W2DA 4M8MA 4CHKA 2WX1A 3X0WA 4WWNA 1C78A 5HI1A 1J7BA 1RWSA 3WA0A 1IBXB 3ETRA 3KVFB 4E3CA 1I4PA 3H8HA 1K8RB 4E71A 2N4FA 2MHJA 1OTRB 3M3JA 3GE3C 1ZKHA 1CZPA 1NYQA 1EM7A 4GDKA 2KTRA 3WAMA 2WXFA 3NZSA 3RULA 2L32A 1QZEA 2PVOD 2V9HA 3N1YC 2HD5B 2MQJA 4WJNA 3W1SC 4DQOC 3Q8CA 1V49A 4I6PA 4GDLA 4JE3B 2G9HD 2XN9C 2BYVE 2N1VA 3WANA 3JSVB 1WR6E 2KC2A 3B9JA 2ZJDA 3AEAB 1F1HA 1OQYA 2IGGA 1WH3A 5IP4D 1ESFA 3O13A 3AECB 2BS3B 1HA5A 2N9PC 2KFKB 1SEBD 2KX0A 1IP9A 5T8IA 4LNNA 4HCNB 3AE6B 4B6WA 4FBJB 1TGZB 3TBLD 3IT4B 2KFKA 4LDTD 2D3BA 4AQ7A 2J0KA 3HHMA 4WJOA 3MJWA 2PE9A 3L16A 1UUPA 4BAXA 1JRPA 4ACFA 5EE1A 4JL9A 2WDRB 4D2KA 1DOYA 3HVDA 1QKZA 4IKGA 1HE8A 1WYGA 3BYTB 3M95A 2KMAA 2JSVX 2JQRB 2OEDA 4DDID 2KTRB 2RR9A 5EDSA 4TUUA 3M62B 1WJ6A 5KHOA 1UNSA 2IO1B 3EUB2 1RFKA 3GZNB 5HHDG 2IJ0A 2PKOA 2LJ5A 4W9HA 3AU4A 5LLIA 2N9EB 2L1AA 4US9A 1WGYA 1IBXA 3RZFA 3DPDA 2V1YA 4FJZA 2O2VB 1MG4A 3I3TB 3W9CB 1EO6A 2REXA 2G45B 2KVZA 2ON8A 1V81A 3UIPB 2YEPF 2FUG1 1YX5B 2FCMA 4WAAA 3TEWA 1T5XD 1JWMD 2ZW0A 5BYRA 4HK2A 2Y5CA 3E56A 1R7SA 3X23A 3IAS1 4OZCA 3IVFA 5KHQA 3AEEB 3DVNV 4ARIA 2IY1B 1JWUD 2WXQA 1T6BX 1WJUA 2WXIA 2DBYA 1T0YA 2TSSA 4DHZB 4F8CB 1TS4A 3CF6E 1UGMA 4KGSA 2JXTA 2KQ4X 5JZEB 4XC2A 5BMIA 4YXDB 4TMAB 2WXJA 4FA6A 4OVVA 4ITKA 5D3IB 3Q8FA 3N32A 2WS3B 4BKSD 1OQQA 2ZZPB 3NUHB 1TKYA 2J42A 1MVKA 1J8CA 2LVOA 3AE1B 1YD8U 3EA6A 4ZRPA 2RD0A 4IW0A 1KF6B 3ENEA 3VXWA 2K25A 3LJ3A 3QK0A 2ONQA 2ZNVC 2V3NA 4K7UA 1SB3C 1AYFA 3AE5B 4HJKA 1WE6A 1TS3A 2QSDA 1SE2A 1DOIA 4GOCA 1VD2A 3R7QA 3DBLB 4YTNB 2L83A 3DBRB 3BWUD 3SR6A 1EWCA 1IUEA 4TSSA 3EECA 5CX3A 1E10A 1CK1A 4RGMA 4EZKA 4NZLB 3NZ3A 3RYTA 3FC4A 5CTRC 3BVMA 4GXBA 1WFYA 4LCDE 1WXSA 4RGOS 1KLUD 4KSKC 4M00A 4UDUC 4NAWA 4ANVA 3W1YA 4WWOA 5BO4B 2WXOA 3H7SA 5BYSA 1E8ZA 1ZW7A 2RMMA 4OHJA 5LXIB 1QILA 1UWXA 3IBEA 4P6VF 3ZTCA 4DHJD 3QWZB 3TCAA 4MEMA 2KK8A 2IDYA 5AZGA 4RMAA 3C19A 4HXDA 1LO5D 2Z0EB 3NVVA 2N7EA 1FFVA 3L4PA 4EUTA 4YSZB 4JIOU 2MEKA 4P7IA 3T9LA 2BW2A 2WHIA 3VTWA 1WJNA 2DLBA 2XK5B 4RF0A 3FILA 3A9KB 1D5ZC 4JQWC 2JRHA 3HRDD 4RGTA 3SU8X 4ZRJA 1E8XA 4F1SA 2EKEC 4KIKB 4KZ0A 2KJHB 4MH8A 2NCNA 4TV3A 1JCKB 2MJEA 3L0WB 5H8YE 1ZDVA 1TY2A 2WU5B 3QJZA 1TS2A 5JH5C 2FCSA 2LUEA 4C4VB 1NBFC 2MCNB 2BVCA 2FIFA 2KYWA 4OVZA 1ZOYB 2CJOA 3PZDA 4IG7B 1YN4A 2C9WB 2MBBB 1GPXA 2OJWA 3IT6B 3UIOB 2YLMA 1EU3A 3LB8C 4KVGB 3RN9C 4BFRA 5C1ZA 5AUKA 1WGRA 1F52A 5IOIA 2PW9A 1TKEA 3ML8A 2RDGA 3OJ4B 3ONSA 3BY4B 1ZPSA 4A6QA 2W3SA 2W9NA 2HTHA 3RPFC 1HZ6A 3QCAA 4HPPA 1T0QC 4K3CA 4XGAB 2HJ8A 5AZFA 3GS2A 3BZDB 2V4LA 2NS5A 1SGHA 4DDGD 1LGRA 2N7JA 3DBRI 2WXHA 3DBHB 3ZJUA 2PTLA 4I6NB 3V60A 2WX0A 1QOFA 3AM9A 3DVGX 4OW0A 2ZNVB 2K6DB 1WY8A 3SFDB 1P9DU 3UQBA 3NS1A 2L7RA 1WX8A 1GJZA 2KO3A 2KFJA 2CHXA 2SEBD 3OLMD 4GGQA 5D94A 3Q8BA 1JWAD 4MSQB 4B95A 2XBBC 1FMAD 3DVNU 4KX6B 4M0WA 3T3OA 1P7FA 1XD3B 2M1MA 5G5HA 2V4IB 3QIJA 2CKHB 3QC8B 1WM2A 3AE2B 4PS3A 1WGHA 1UZXB 1YN5A 3RNCC 2J7QB 4XWWA 2DAFA 2AX5A 3JVZX 5FR3A 1CQVA 2RDBC 4M01A 3BIID 2LZ6A 4TKNA 4DHJB 2UYZB 3U7DA 3PREA 3UF8A 1OFFA 2I2YA 2AL3A 2V3SA 4E74A 3K9OB 3P42A 3R2IA 1MHXA 1WXAA 3AE7B 1H4RA 1HXYD 1GB1A 4NY0A 1X1MA 4BZAA 3IAM1 2B3AA 3VR8B 1VZ6A 1BT0A 1QF6A 2M0AA 3PSEB 4LDTB 4PS7A 3B08A 4GB9A 1B9RA 3VUYA 1PGXA 1VCBA 2KJ6A 1STEA 5AUIA 5TSSA 3AEGB 4MACA 2IBIB 2YEPB 1UGJA 3PLUA 3AXCA 3APCA 3ZNHB 4US8A 2FIDA 1TKGA 3V62A 2FAZA 2KDIA 1MPEA 5IN7A 2LHDA 2D5GA 5E6OA 4NJCA 2RPVA 1TT5B 1D5XC 4HLEA 1S1QB 1I4XA 1XEEA 3GZNI 4PYZA 1YJ1A 4HVBA 1Z2MA 2N7DA 3GP7A 4KV2A 3HUIA 4TQ1A 3TSSA 1TS5A 2LVPA 4N58A 1DYQA 2X8XX 2WDVB 1WZ0A 3VTUA 1JWSD 3H6NA 3VRBB 4L1BA 2M8SA 3H1UA 4WH4A 2KDFB 3KYDD 1WJ4A 4P1BC 5BMGA 3B0AA 1N63A 1V80A 4YTPB 4W9FA 2HTME 1EU4A 2KWCA 3DCGA 4S0RA 2KLGA 2BYTA 1FXTB 1A5RA 3ZIMA 4A3OA 5L95C 4G0NB 1KJTA 1WI0A 4P1CC 3VVWB 2INNE 5DPTA 1C79A 3PHWB 1J0GA 1XO3A 3DHHC 4WQMA 3A4SC 1UWMA 2KTFA 1MI0A 3FKYA 3VUWA 2I1JA 3DBHI 3ZNID 3P4RB 5JHAA 2WXNA 1J19A 2R61A 3AN1A 4KKIA 4LNFA 2HDEA 4ZRQA 2R2QA 1BUIC 1SJED 1VZ8A 1XF5L 1WWTA 4YWGG 1WZ3A 2LMCA 1ISNA 3Q3MC 2JF5A 4B0EA 4X57B 4ZYNA 4LNKA 1SIJA 2FCNA 4GN1A 4A90A 2MBHA 4MELA 4FULA 1I4GA 4REZA 2H88B 4RFBA 2BS2B 2O2VA 3ZXVA 4RM9A 3RNFC 3CWIA 3MJ5A 2WXPA 2C5LC 1N62A 4B9KA 5HFYA 4FJYA 1WRDB 2ACZB 2L05A 1F2RC 2FBWB 2CU1A 1L4DB 1WYWB 3MFGA 1TZ1A 2BS4B 2DX5B 1C4CA 3VUXA 1WGKA 4HDOA 1M94A 3W5UB 1V97A 3N1XC 2DYBA 1LFDA 3JYUA 2WP9B 2LI5A 2K8BA 4ANWA 4G50A 2W3RA 1FNWA 1XXGA 1L0VB 4CO7A 4MM3A 1E7UA 1XCTL 2KXJA 1C77A 4S17A 1B1ZA 1JROA 4EKUA 4JLCA 3L10B 2DAJA 2KZRA 3AV8A 1FCCC 5EE9A 1MFWA 2J0MA 4LJPB 1QOGA 3ZW3A 2GBKA 3APDA 1VR9A 4ARCA 4URKA 1NVID 4KZCA 2WYQA 2KN4A 2GBNA 2NTSA 1Y56A 3OG5A 3AE8B 3R2TA 3FAHA 2KKCA 2AQ2B 3VHTC 2KT7A 1PYWD 1I4HA 1I35A 1RRBA 2JZ3B 4LLGM 3U8ZA 1Z5SB 3Q8AA 2DZMA 5JXVA 3NOBA 1L7YA 1E0ZA 1GOZA 2MW5A 1WIAA 2KQ7A 2LRUA 2N0SB 2N9LA 5G2NA 1D5MC 4GDLB 4DXGA 1G6JA 3KLSX 5CHWA 2HE7A 3ZTDA 5G55A 3V6CB 1XQQA 1OQRA 1R4MB 1D3ZA 2K3UA 4ZRKA 3O65B 4K1RB 1WM3A 2LGSA 3PVLA 2WXRA 2O6VD 1J7AA 1WMHB 4YL8A 2VH1A 1V6EA 4W9EA 1XLNA 1IGDA 3LYYA 1D4BA 4C56C 4HRSA 4GU2A 4EFOA 2QHOA 2FNJB 2L52A 5FKAC 2UU7A 4C7ZA 2G4DB 3ZKJC 4FJVB 3IXSA 3I5JC 3VTVA 2LJIA 5AEKB 5EE0A 2MBEA 2N9XA 5E6PA 2JT4B 2X38A 2AL6A 4BOZB 1FNVA 1N60A 1FIQA 3Q3OC 2QILA 1E7PB 2WDTB 1OEYJ 1QQRA 3RCZA 3ZRCA 4JWUC 2GI9A 4ZRIA 1ET6A 4BKTA 3AH7A 2M56B 2LXCA 3VQIA 1JWBD 1UBIA 2K8CA 2D3CA 2ZVOA 3DWMA 4K7SA 2IGHA 3ABVB 3AEDB 2G4SA 1TTNA 1L5PA 4HPMB 4MJSB 3WALA 3RNEC 3AB5A 3TUOA 3KUCB 2LVQA 4MH0E 2Z59B 1IGCA 2EMSA 2NVUI 1S3SG 5D6JB 1WXQA 2AQ3B 3NVYA 1YOVB 1YMHE 4AJYB 3BYYB 4ZYSA 4KGTA 3P2BA 3RNBC 4WJPA 1SIFA 2RPQA 4W9DA 4RM8A 2BPSA 2NBVB 4WIPA 3A9JA 1C3TA 4KIKA 2JRIB 2M0XA 2C60A 1MG8A 2AWTA 4A9AA 3A9KA 3QA8A 3WIMA 1WX9A 1N61A 1FCLA 2LHEA 1WX7A 2KJRA 2XK5A 3P4SB 3Q2AC 1L6UA 1MJDA 2BGFA 2LWPA 3A1QB 5BMHA 5J17A 3R8BA 2IPKD 2D3GA 4J3OD 2KNBA 1JRUA 1KTKA 2DENB 4NQLB 2KLCA 2Y5PA 4AOFA 4RH6A 2K0PA 2OJRA 3I63C 3K9PB 3R7RA 3J9CA 3UI3A 3JW0X 3DOWA 4M0WB 3PHXB 4HWIB 2MJDA 4FN2A 4BVUC 2LGYA 3N1ZC 3A33B 4BKGA 4KDIC 4AS1A 2RDHA 1FM0D 4ZHOA 3EHVA 1KLGD 2QDFA 2ZPYA 2MP2A 1PGBA 3R66C 3ZLZA 3CIRB 2D07B 2AYOB 3I57A 1XCQL 3QQ8B 3OAWA 3TMPB 5FK9C 3A1QA 3TEZA 3MC0B 3Q8EA 2KDMA 5JHBA 1I7HA 2XNAC 2BT6A 1WGGA 1L0XB 4I6LB 5GXGB 4MGKE 4L2YA 3S2AA 1TBEA 2M17A 1ZGUB 2VH2A 1ZDXA 2G3QB 3B2GA 1L2NA 2JYTA 3L17A 2ZCBA 2PPHA 2WLBA 3KH0A 4QAYA 3RZWC 1AARA 4LNOA 1EWYC 1T0SC 4OZBA 3E9SA 3M63B 1R4MI 3RMKC 1RM6C 2GMIC 4MSMB 4R3DA 4XE0A 4HEA1 2PIAA 3ZGZA 2PVGC 4WWMA 3I9V1 4K81A 1SXTA 4MT5A 4FLHA 1PDXA 2N9KA 1N5XA 1FPYA 4FHJA 3BVZA 1IPGA 2LFIA 4A8XC 3EGRA 1Q10A 4LNIA 5I4DA 4XZ4A 3TEYA 1RFAA 4W9IA 2L76A 4NQKE 2BQQA 3SDLC 2IO0B 3P4PB 4PYUA 4HJGE 1GAQB 2WGSA 2JUOA 3ECIA 4KGRA 2IO2B 2KOXA 2MSED 2KWDA 5BYQA 4NAMA 4DHZE 2RGFA 2D11A 2PJHA 1Q5WB 1UELA 2AEHA 4LTUA 1TY0A 2WXGA 1AWDA 3V61A 1LQBA 3ZO5B 2C7NB 1ENFA 2J53A 3NHEB 1KLVA 1XLPA 2DWQA 3NY5A 4PS8A 1FRRA 4M8NA 3KW5B 3NVZA 2MX2A 2K6QA 1WMHA 2A4ZA 2DNFA 4LJOB 5IKCM 4AUQC 2PMVA 3BK1A 1YJJA 2MRPA 2L3ZA 3LXFA 4BKSA 1BXTA 1ROEA 4N59A 2KWUB 2GOWA 4MGYE 3PS6A 1YJIA 3DHIC 4G11A 4NAWB 4II3B 4PK1A 3MC9A 5HKHA 1NENB 4C00A 1HQRD 4IWOA 1YQ3B 3KWVA 1YQBA 4OZAA 2L0TA 2BBCA 1KOTA 2BYFA 3EFCA 3ZNGC 3RI7C 3A9JB 2L8JA 3Q14C 3PRMB 4NPNA 2CHWA 4II2B 1E9MA 1SJHD 1SE4A 2O6VA 1HEZE 4GIVA 3N3KB 3RFZB 4ZDVA 2E6XA 2KVRA 2SAKA 1V5OA 3T3NA 2VRRB 3DBLI 2INCC 4L23A 2I38A 1L0YB 4ZHPA 4GLSC 1DOXA 4KSLC 1WSPA 1F2RI 2IZVB 1UBQA 5TR5A 3TEXA 1K50A 4XX5A 3U52E 4MJSA 2CR5A 1K51A 1V1PB 2NMQA 3WAOA 3DDCB 4WURA 3JSVA 1PGAA 1VRAB 2LUMA 3PZ8A 1SBBB 3BVGA 1BMLC 1V1PA 3AE9B 3P1MA 2IYDB 2LASA 3MC8A 4GDKB 2WWZA 3T8MA 2CS4A 2C7MB 2YVCA 1ZUD2 4RGNA 2IGDA 3R3MA 5C3JB 3GOEA 2MH7A 3OWEB 3W5VB 2BF8B 3H7PB 1TYGB 3CSTA 1QOBA 2UWQA 5LNK1 1FO4A 2CJNA 2WNMA 3MHSD 4YTMB 1WGDA 4DWFA 1FRDA 3PO0A 3D32A 1EUVB 2QC8A 2N1WA 5GMVA 1QOAA 1D6EC 2BB6A 5FR6A 4HKQA 4WJQA 1KRHA 2ZW1A 3SEBA 3QHTA 1V2YA 1V9JA 4RF1A 4IC7B 1V8CA 4HDQA 3ZRFA 1TZOA 2MJ3A 3OJ3A 4JWSC 3NJTA 1NI2A 3ZJTA 2KN5A 3IFWB 3AU5A 3SD5A 2B76B 5EE3A 2Q5WD 4JX1C 5IO9A 2H89B 2NTTA 3WCQA 4FADA 4RNAA 3P4QB 2INDC 2GB1A 1P1AA 2Z8LA 4N6EB 1FXIA 4W9GA 2KANA 2R2OA 3TL5A 2KD0A 1C76A 2KQSA 2K1FA 4O1NA 4IUMB 4KKJA 1EF1A 2J0JA 2V0GA 4USAA 2GRIA 4ICUA 3MP9A 2MBOA 1VJKA 1YX6B 4MGZE 5E6JA 1L4ZB 1CMXB 3KUDB 5LXHA 1SE9A 1NI3A 1FNUA 2RSUA 4PT5A 4HKZE 4Q2JA 3NVWA 4K3BA 4MM3B 5J18A 4NJ6A 3WAPA 1WXMA 1V1OA 4BBNF 1FD6A 4BBNC 3ZYYX 1Q1OA 1VLBA 2FCQA 2MLBA 3VH4B 1I4RA 4A55A 1A70A 3PLVA 1LXDA 2JPHA 4DXAB 4YSYB 4A3PA 3ZXRA 3N20C 1FXAA 3PRZA 2IO3B 4ANUA 2GBRA 4HCPB 2K22A 3KQ4A 3NZUA 2DZKA 2K9XA 1VDVA 1WE7A 1JMLA 3ZDTA 5L83A 4NJ7A 1E8YA 5C2TB 2Y5BB 1PFDA 3KUZA 1NYRA 2JWUA 4K7WA 4EOYA 1UD7A 2EELA 3GB1A 2HJ1A 3QARA 3DWGC 3VDZA 1GB4A 5CHVC 3APFA 4C4VA 4DBGA 3BK2A 2XEWA 3UGBB 4A20A 1Y8RC 2L00B 1N5WA 3MHZA 2O6VB 4IOIE 2FUHB 3HM6X 2D3AA 4J6IA 3U7ZA 4LK0M 2PEAA 3AE4B 2MA9B 3ZUNA 3W1SA 3NS8A 4OVUA 3ML9A 3DBSA 3KYCD 1GUAB 1XLQA 1TIFA 3VR9B 3HVZA 5AZHA 3BINA 2LGXA 1OEYA 2JYEA 3EFUA 2M4NA 4CQNA 1QT9A 2WXLA 3ZDMC 4IDIA 2BTEA 3U2SC 3C0RB 2MP2B 1C1YB 3NG0A 1JALA 2J52A 2PE6B 3UINB 3RNGC 4C80A 3HK0A 3DQVA 3Q3JA 3H9DA 3URYA 3PPAA 3L13A 1U4AA 3IHPC 1UH6A 3VAWA 5CHFA 1YN3A 2QJLA 2KX3A 4TQ0A 1P0RA 4EEWA 4EZJA 1YIWA 4EE2A 2GBJA 1OGWA 2OHFA 1HTOA 1PQSA 2LGDA 4WWPA 3ALBA 5IA7A 2CU3A 3PT2B 1WXVA 2W55A 2KHWB 1E8WA 2LGIA 1L6VA 3V3XA 2PLPA 1Q0WB 4GMVA 3QAQA 3IG3A 4ASWC 4HROA 3EC8A 2KDBA 3AEBB 4WQOB 5D7GA 1C4AA 5DPRA 1KFYB 3RD2A 2BKFA 1VZ7A 2FE8A 3B1LX 1F77A 3ZQ4A 1GC6A 2JZPA 1ZXHA 1J7CA 2EKIA 3U30A 4FHKA 1P98A 1ZE3D 1YQ4B 1PUTA 2KMMA 1F9JA 3CSFA 4DK5A 3TIXA 2VZKD 3N9YC 1RYJA 5D2MB 1FEHA 3PZ7A 4NNJB 4XDDA 2V3PA 3MTNB 2MWSB 5H92C 5MPOA 4HPLB 3QX1A 3PGEA 2BYEA 2EMTA 2NBUA 2JY6A 1N6ZA 4BOSC 4AJWA 3AMZA 2NPTA 3V05A 1TJEA 1V5TA 3ZJVA 1UF0A 2BWES 4RCOA 2JXXA 2GBMA 1R4NB 4IWQA 4YT0B 2ZVNA 2D10A 2ASQA 3AI5A 3HIZA 2KMCA 5IAAC 4FXCA 1SSNA 2WXMA 1GNUA 3RT3B 2DZJA 2AQ1B 2W54A 3CMMB 2I1KA 1E90A 3PTFC 5HG2A 4IM0A 1WR1A 3KWLA 3B2FA 3UQAA 1M4VA 3P63A 1KH0A 5DPWA 2KACA 4GSWA 2K8HA 2MBQA 1KM7A 1XLOA 2LXAA 2KWVB 2GLSA 1GC7A 1FFUA 3FILB 2JX5A 1T0RC 2CHZA 2Y3AA 1P7EA 2WQYB 3SHQA 1NEKB 1MHHE 4P16A 4XDCA 2KAJA 3DVGY 5DCNA 3Q6BA 1SF0A 1ZXIA 3Q69A 3GE8C 1AW7A 1SE3A 1HTQA 4MGIE 2NBWB 3VFKA 2KDEB 2QIEB 2DYOA 3PV1A 2LD9A 3ZNZB 5G5GA 3VRAB 2JWZA 3RNAC 2KC1A 2D2QA 2K39A 3DHGC 1IYFA 4XYCA 2Z0DB 2JVCA 4F7ZA 1I4QA 2E3TA 2ZCCA 4N9F4 1E6EB 2NPTB 1ACCA 3AULA 1HZ5A 2ZPNA 4ANXA 1E5WA 1F0ZA 3SFEB 1E7VA 3U4EG 4YSXB 1K53A 1WF9A 4IM3A 2DHZA 3L54A 1NDDA 4IM2A 2QCZA 2LEKA 4W9JA 2J4XA 2LRWA 2JU6X 2QMTA 2DYMA 1CJEA 4H2AA 1P3QU 2M19A 5J2RA 3TJPA 4JGHB 1ZP0B 4C7YA 4ICVA 4WAFA 1XT9B 2DZIA 1GG3A 3LDZE 1LM8B
chains in the Genus database with same CATH topology
2JZZA 4W9EA 4EZLA 2UWQA 3UIOB 2YLMA 4MDKE 4KVGB 3MHSD 4BFRA 4GU2A 4EFOA 2QHOA 2FNJB 5C1ZA 1WGRA 1I42A 2A5UA 2G4DB 3ML8A 1RLFA 4CYEA 2IY0B 1R4NI 3OJ4B 3BY4B 3ONSA 1EF5A 1WGDA 3Q3FA 3VH3B 3ZKJC 5C23A 3L08A 4FJVB 4DWFA 2BWFA 3D32A 1RAXA 4AP4C 2W9NA 1EUVB 4IWPA 5E6NA 2N1WA 2HTHA 5GMVA 2NR2A 3HM3A 1V86A 4KDLB 2OOBB 3VTVA 3QCAA 5AEKB 5FR6A 2MBEA 2N9XA 4WJQA 5E6PA 2JT4B 2AL6A 4BOZB 2HJ8A 3N30A 5AZFA 3QHTA 2V4LA 1V2YA 1SGHA 1V9JA 2NS5A 4IC7B 4DDGD 2WDTB 1OEYJ 3RUIB 4HDQA 3RCZA 3ZRFA 3DBRI 3ZRCA 3OJ3A 2BKRB 4W9KA 4AWJA 1NI2A 4ZRIA 2KN5A 4I6NB 3IFWB 3V60A 2WX0A 3AU5A 4BKTA 3SD5A 4W9LA 2LXCA 3VQIA 1H8CA 3DVGX 1UBIA 2K8CA 2ZVOA 2ZNVB 2C7HA 2K6DB 1WY8A 2ZEQA 1P9DU 4K7SA 3UQBA 4FADA 2G4SA 4W9CA 3A4RA 2L7RA 1TTNA 3ZVVA 1P1AA 4HPMB 4W9GA 4MJSB 3WALA 1WX8A 1GJZA 3PRPB 5DPSA 3KUCB 2LVQA 2KANA 2KO3A 4MH0E 2L0FA 4G3XB 3V6EB 2R2OA 3TL5A 2Z59B 2KD0A 2KFJA 2EMSA 2CHXA 2NVUI 2KQSA 1S3SG 2K1FA 3H7PA 3OLMD 4IUMB 4M8MA 4CHKA 2WX1A 4GGQA 3X0WA 5D6JB 1EF1A 2J0JA 4WWNA 5D94A 4MSQB 3WA0A 4ICUA 4B95A 2XBBC 4AJYB 3KVFB 4E3CA 2MBOA 3DVNU 1K8RB 1YX6B 4MGZE 4E71A 2N4FA 3P2BA 1OTRB 1XD3B 2M1MA 1CMXB 3M3JA 1ZKHA 1SIFA 2RPQA 3KUDB 4W9DA 4RM8A 4WJPA 2BPSA 2NBVB 3QIJA 2CKHB 5LXHA 1SE9A 2RSUA 4GDKA 3QC8B 1WM2A 2KTRA 3WAMA 3A9JA 3NZSA 3RULA 1C3TA 4PS3A 1QZEA 1WGHA 2HD5B 2MQJA 4KIKA 4WJNA 2JRIB 3W1SC 2M0XA 2C60A 4I6PA 1V49A 4GDLA 1UZXB 5J18A 4NJ6A 3WAPA 2J7QB 1WXMA 2BYVE 4BBNF 2N1VA 1MG8A 2AWTA 3WANA 4BBNC 3A9KA 3QA8A 1Q1OA 2FCQA 3WIMA 1WX9A 3JSVB 2MLBA 3VH4B 2XK5A 1WX7A 2DAFA 2KJRA 1WR6E 3PLVA 3JVZX 2KC2A 2BGFA 2LWPA 2ZJDA 1LXDA 2JPHA 3A1QB 4DXAB 1OQYA 5J17A 4A3PA 1WH3A 2LZ6A 4TKNA 4DHJB 3PRZA 2IO3B 4ANUA 2GBRA 2UYZB 3U7DA 4HCPB 3NZUA 3PREA 3UF8A 2D3GA 2DZKA 2KNBA 2N9PC 1JRUA 2KFKB 1WE7A 2AL3A 2V3SA 4E74A 2DENB 3K9OB 4NQLB 3ZDTA 2KLCA 5L83A 4NJ7A 4AOFA 1E8YA 2KX0A 2OJRA 2Y5BB 3K9PB 1IP9A 3KUZA 4EOYA 4K7WA 1WXAA 3R7RA 1UD7A 1H4RA 4HCNB 3JW0X 3DOWA 4NY0A 4M0WB 3PHXB 1X1MA 3QARA 4HWIB 3VDZA 5CHVC 3APFA 4DBGA 4B6WA 4FN2A 4BVUC 2B3AA 2XEWA 3UGBB 4A20A 4FBJB 2LGYA 1Y8RC 1TGZB 2L00B 3A33B 3TBLD 1BT0A 2O6VB 4BKGA 2KFKA 4LDTD 2FUHB 4KDIC 3HM6X 3PSEB 4J6IA 2J0KA 3HHMA 4LDTB 2PEAA 3B08A 3EHVA 4GB9A 4PS7A 3MJWA 2MA9B 4WJOA 2PE9A 1VCBA 2KJ6A 3L16A 3VUYA 3W1SA 3ZUNA 3NS8A 4OVUA 3ML9A 3DBSA 4JL9A 2ZPYA 2MP2A 3KYCD 1GUAB 3R66C 2IBIB 3ZLZA 2D07B 2AYOB 5AZHA 3PLUA 3AXCA 2LGXA 3APCA 3BINA 3QQ8B 1OEYA 3OAWA 3TMPB 1HE8A 2M4NA 3EFUA 3ZNHB 2FIDA 3M95A 3V62A 3A1QA 2FAZA 3ZDMC 2KDIA 2KMAA 3C0RB 2MP2B 1C1YB 5E6OA 5JHBA 2PE6B 4DDID 2KTRB 2RR9A 3UINB 1WGGA 5EDSA 4I6LB 4HLEA 3HK0A 4MGKE 1S1QB 4TUUA 3S2AA 1TBEA 2M17A 3DQVA 3M62B 3Q3JA 1WJ6A 3H9DA 3PPAA 1ZGUB 3GZNI 3L13A 4PYZA 1U4AA 1YJ1A 3IHPC 4HVBA 1UH6A 3VAWA 5CHFA 1Z2MA 2G3QB 2N7DA 2KX3A 4TQ0A 5KHOA 2IO1B 1P0RA 4KV2A 1L2NA 4EEWA 4EZJA 3L17A 2ZCBA 2PPHA 3KH0A 1YIWA 4TQ1A 2GBJA 2LVPA 1AARA 1OGWA 2LJ5A 4W9HA 3RZWC 3AU4A 5LLIA 1PQSA 2N9EB 2LGDA 1WZ0A 1WGYA 3RZFA 3VTUA 3M63B 3DPDA 1R4MI 2V1YA 3H6NA 4FJZA 2O2VB 4WWPA 2GMIC 2M8SA 3ALBA 3H1UA 3I3TB 5IA7A 3PT2B 1WXVA 4MSMB 1EO6A 2REXA 2KDFB 2KHWB 3KYDD 1E8WA 2G45B 1Q0WB 1V81A 1WJ4A 3UIPB 3B0AA 4GMVA 1V80A 4W9FA 3QAQA 4K81A 3IG3A 1YX5B 2FCMA 4ASWC 4FLHA 4WAAA 3EC8A 2KDBA 2KWCA 4WQOB 3DCGA 5D7GA 5DPRA 3RD2A 2BKFA 4HK2A 2KLGA 4FHJA 1IPGA 3B1LX 1FXTB 4XZ4A 3X23A 1GC6A 1RFAA 1A5RA 4W9IA 3ZIMA 2L76A 3IVFA 3U30A 4FHKA 5KHQA 1P98A 4NQKE 4A3OA 3DVNV 5L95C 4G0NB 2IY1B 1KJTA 1WI0A 3SDLC 1WJUA 3VVWB 1F9JA 2IO0B 1T0YA 3CSFA 5DPTA 3TIXA 4DHZB 4DK5A 4PYUA 3PHWB 1J0GA 2JUOA 3ECIA 5D2MB 4F8CB 3A4SC 2IO2B 2KOXA 2MSED 4NNJB 2KTFA 3CF6E 3VUWA 1UGMA 2I1JA 3MTNB 3DBHI 2MWSB 3ZNID 4DHZE 2RGFA 2D11A 4HPLB 3QX1A 3PGEA 2PJHA 1Q5WB 2BYEA 5JZEB 4XC2A 2EMTA 5JHAA 2NBUA 2JY6A 1UELA 1J19A 4FA6A 2AEHA 4OVVA 4BOSC 4AJWA 2R2QA 3N32A 2NPTA 4BKSD 1V5TA 1WZ3A 3V61A 1LQBA 2ZZPB 3ZO5B 2BWES 1ISNA 2JXXA 2C7NB 2GBMA 2JF5A 4X57B 3NHEB 1J8CA 4ZYNA 1KLVA 2LVOA 1YD8U 3NY5A 4IWQA 2FCNA 2RD0A 4GN1A 4PS8A 4IW0A 2MBHA 4MELA 3ENEA 3VXWA 4FULA 3KW5B 2ZVNA 2K25A 2D10A 4M8NA 3LJ3A 2ASQA 3AI5A 3QK0A 2MX2A 2ZNVC 2O2VA 2K6QA 1WMHA 3HIZA 2A4ZA 4K7UA 4RM9A 2KMCA 4LJOB 4AUQC 4HJKA 5IAAC 2C5LC 1GNUA 1WE6A 2MRPA 3RT3B 2DZJA 2L3ZA 4BKSA 3CMMB 2I1KA 4FJYA 4B9KA 1WRDB 1E90A 2L05A 3PTFC 4GOCA 1VD2A 4IM0A 3R7QA 1WR1A 2CU1A 2KWUB 1WYWB 1TZ1A 2DX5B 2GOWA 4MGYE 3UQAA 3VUXA 4HDOA 3EECA 5CX3A 1M94A 3PS6A 4G11A 4NAWB 5DPWA 4EZKA 4II3B 4GSWA 3RYTA 5CTRC 2K8HA 2MBQA 2DYBA 4GXBA 1LFDA 3JYUA 5HKHA 2LI5A 2K8BA 4ANWA 1WFYA 4LCDE 4G50A 1KM7A 1WXSA 2LXAA 2KWVB 1GC7A 4KSKC 4IWOA 4NAWA 4ANVA 3W1YA 1YQBA 2L0TA 4WWOA 5BO4B 3H7SA 1KOTA 1E8ZA 1ZW7A 4MM3A 4CO7A 1E7UA 2CHZA 2BYFA 2KXJA 5LXIB 3SHQA 3ZNGC 3A9JB 3IBEA 2L8JA 3ZTCA 3PRMB 4DHJD 3QWZB 3TCAA 4NPNA 2CHWA 4MEMA 4EKUA 4JLCA 3DVGY 4II2B 3L10B 2DAJA 2KK8A 2KZRA 5DCNA 2O6VA 4GIVA 5AZGA 4RMAA 3N3KB 4MGIE 2NBWB 4HXDA 3VFKA 2J0MA 4LJPB 2KDEB 3ZW3A 2GBKA 2DYOA 4ZDVA 2KVRA 3PV1A 1V5OA 2LD9A 3ZNZB 2Z0EB 2JWZA 2VRRB 2N7EA 3DBLI 3APDA 2KC1A 4URKA 2D2QA 2K39A 1IYFA 4KZCA 4KSLC 4EUTA 2WYQA 2Z0DB 2GBNA 2IZVB 2JVCA 4JIOU 1UBQA 5TR5A 4F7ZA 4XX5A 4MJSA 2CR5A 2ZCCA 4P7IA 4N9F4 2NPTB 3T9LA 3VTWA 3WAOA 3AULA 2KKCA 3DDCB 3VHTC 1WJNA 2ZPNA 2XK5B 4ANXA 1E5WA 3JSVA 1I35A 1E7VA 3A9KB 1RRBA 2JZ3B 4JQWC 2JRHA 3U8ZA 1Z5SB 1WF9A 2DZMA 3NOBA 1L7YA 4IM3A 4YL8A 3SU8X 4ZRJA 1E8XA 2DHZA 2MW5A 4F1SA 2EKEC 4KIKB 1WIAA 4KZ0A 2KJHB 2KQ7A 3L54A 1NDDA 2IYDB 2LRUA 2LASA 2NCNA 4GDKB 4TV3A 2WWZA 5G2NA 4IM2A 3L0WB 4GDLB 1G6JA 3T8MA 2CS4A 2C7MB 2YVCA 4W9JA 5CHWA 2LRWA 2HE7A 3ZTDA 2DYMA 3QJZA 5G55A 5JH5C 3V6CB 1P3QU 2FCSA 5J2RA 1XQQA 2LUEA 3TJPA 3R3MA 1NBFC 4JGHB 2MCNB 2FIFA 4ICVA 3GOEA 1D3ZA 4ZRKA 3O65B 4K1RB 1WM3A 2BF8B 3H7PB 1XT9B 2DZIA 3PVLA 3PZDA 4IG7B 3CSTA 2C9WB 2MBBB 1GG3A 1WMHB 2O6VD 1LM8B 3LDZE 1V6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZZ A;  4W9E A;  4EZL A;  2UWQ A;  3UIO B;  2YLM A;  4MDK E;  4KVG B;  3MHS D;  4BFR A;  4GU2 A;  4EFO A;  2QHO A;  2FNJ B;  5C1Z A;  1WGR A;  1I42 A;  2A5U A;  2G4D B;  3ML8 A;  1RLF A;  4CYE A;  2IY0 B;  1R4N I;  3OJ4 B;  3BY4 B;  3ONS A;  1EF5 A;  1WGD A;  3Q3F A;  3VH3 B;  3ZKJ C;  5C23 A;  3L08 A;  4FJV B;  4DWF A;  2BWF A;  3D32 A;  1RAX A;  4AP4 C;  2W9N A;  1EUV B;  4IWP A;  5E6N A;  2N1W A;  2HTH A;  5GMV A;  2NR2 A;  3HM3 A;  1V86 A;  4KDL B;  2OOB B;  3VTV A;  3QCA A;  5AEK B;  5FR6 A;  2MBE A;  2N9X A;  4WJQ A;  5E6P A;  2JT4 B;  2AL6 A;  4BOZ B;  2HJ8 A;  3N30 A;  5AZF A;  3QHT A;  2V4L A;  1V2Y A;  1SGH A;  1V9J A;  2NS5 A;  4IC7 B;  4DDG D;  2WDT B;  1OEY J;  3RUI B;  4HDQ A;  3RCZ A;  3ZRF A;  3DBR I;  3ZRC A;  3OJ3 A;  2BKR B;  4W9K A;  4AWJ A;  1NI2 A;  4ZRI A;  2KN5 A;  4I6N B;  3IFW B;  3V60 A;  2WX0 A;  3AU5 A;  4BKT A;  3SD5 A;  4W9L A;  2LXC A;  3VQI A;  1H8C A;  3DVG X;  1UBI A;  2K8C A;  2ZVO A;  2ZNV B;  2C7H A;  2K6D B;  1WY8 A;  2ZEQ A;  1P9D U;  4K7S A;  3UQB A;  4FAD A;  2G4S A;  4W9C A;  3A4R A;  2L7R A;  1TTN A;  3ZVV A;  1P1A A;  4HPM B;  4W9G A;  4MJS B;  3WAL A;  1WX8 A;  1GJZ A;  3PRP B;  5DPS A;  3KUC B;  2LVQ A;  2KAN A;  2KO3 A;  4MH0 E;  2L0F A;  4G3X B;  3V6E B;  2R2O A;  3TL5 A;  2Z59 B;  2KD0 A;  2KFJ A;  2EMS A;  2CHX A;  2NVU I;  2KQS A;  1S3S G;  2K1F A;  3H7P A;  3OLM D;  4IUM B;  4M8M A;  4CHK A;  2WX1 A;  4GGQ A;  3X0W A;  5D6J B;  1EF1 A;  2J0J A;  4WWN A;  5D94 A;  4MSQ B;  3WA0 A;  4ICU A;  4B95 A;  2XBB C;  4AJY B;  3KVF B;  4E3C A;  2MBO A;  3DVN U;  1K8R B;  1YX6 B;  4MGZ E;  4E71 A;  2N4F A;  3P2B A;  1OTR B;  1XD3 B;  2M1M A;  1CMX B;  3M3J A;  1ZKH A;  1SIF A;  2RPQ A;  3KUD B;  4W9D A;  4RM8 A;  4WJP A;  2BPS A;  2NBV B;  3QIJ A;  2CKH B;  5LXH A;  1SE9 A;  2RSU A;  4GDK A;  3QC8 B;  1WM2 A;  2KTR A;  3WAM A;  3A9J A;  3NZS A;  3RUL A;  1C3T A;  4PS3 A;  1QZE A;  1WGH A;  2HD5 B;  2MQJ A;  4KIK A;  4WJN A;  2JRI B;  3W1S C;  2M0X A;  2C60 A;  4I6P A;  1V49 A;  4GDL A;  1UZX B;  5J18 A;  4NJ6 A;  3WAP A;  2J7Q B;  1WXM A;  2BYV E;  4BBN F;  2N1V A;  1MG8 A;  2AWT A;  3WAN A;  4BBN C;  3A9K A;  3QA8 A;  1Q1O A;  2FCQ A;  3WIM A;  1WX9 A;  3JSV B;  2MLB A;  3VH4 B;  2XK5 A;  1WX7 A;  2DAF A;  2KJR A;  1WR6 E;  3PLV A;  3JVZ X;  2KC2 A;  2BGF A;  2LWP A;  2ZJD A;  1LXD A;  2JPH A;  3A1Q B;  4DXA B;  1OQY A;  5J17 A;  4A3P A;  1WH3 A;  2LZ6 A;  4TKN A;  4DHJ B;  3PRZ A;  2IO3 B;  4ANU A;  2GBR A;  2UYZ B;  3U7D A;  4HCP B;  3NZU A;  3PRE A;  3UF8 A;  2D3G A;  2DZK A;  2KNB A;  2N9P C;  1JRU A;  2KFK B;  1WE7 A;  2AL3 A;  2V3S A;  4E74 A;  2DEN B;  3K9O B;  4NQL B;  3ZDT A;  2KLC A;  5L83 A;  4NJ7 A;  4AOF A;  1E8Y A;  2KX0 A;  2OJR A;  2Y5B B;  3K9P B;  1IP9 A;  3KUZ A;  4EOY A;  4K7W A;  1WXA A;  3R7R A;  1UD7 A;  1H4R A;  4HCN B;  3JW0 X;  3DOW A;  4NY0 A;  4M0W B;  3PHX B;  1X1M A;  3QAR A;  4HWI B;  3VDZ A;  5CHV C;  3APF A;  4DBG A;  4B6W A;  4FN2 A;  4BVU C;  2B3A A;  2XEW A;  3UGB B;  4A20 A;  4FBJ B;  2LGY A;  1Y8R C;  1TGZ B;  2L00 B;  3A33 B;  3TBL D;  1BT0 A;  2O6V B;  4BKG A;  2KFK A;  4LDT D;  2FUH B;  4KDI C;  3HM6 X;  3PSE B;  4J6I A;  2J0K A;  3HHM A;  4LDT B;  2PEA A;  3B08 A;  3EHV A;  4GB9 A;  4PS7 A;  3MJW A;  2MA9 B;  4WJO A;  2PE9 A;  1VCB A;  2KJ6 A;  3L16 A;  3VUY A;  3W1S A;  3ZUN A;  3NS8 A;  4OVU A;  3ML9 A;  3DBS A;  4JL9 A;  2ZPY A;  2MP2 A;  3KYC D;  1GUA B;  3R66 C;  2IBI B;  3ZLZ A;  2D07 B;  2AYO B;  5AZH A;  3PLU A;  3AXC A;  2LGX A;  3APC A;  3BIN A;  3QQ8 B;  1OEY A;  3OAW A;  3TMP B;  1HE8 A;  2M4N A;  3EFU A;  3ZNH B;  2FID A;  3M95 A;  3V62 A;  3A1Q A;  2FAZ A;  3ZDM C;  2KDI A;  2KMA A;  3C0R B;  2MP2 B;  1C1Y B;  5E6O A;  5JHB A;  2PE6 B;  4DDI D;  2KTR B;  2RR9 A;  3UIN B;  1WGG A;  5EDS A;  4I6L B;  4HLE A;  3HK0 A;  4MGK E;  1S1Q B;  4TUU A;  3S2A A;  1TBE A;  2M17 A;  3DQV A;  3M62 B;  3Q3J A;  1WJ6 A;  3H9D A;  3PPA A;  1ZGU B;  3GZN I;  3L13 A;  4PYZ A;  1U4A A;  1YJ1 A;  3IHP C;  4HVB A;  1UH6 A;  3VAW A;  5CHF A;  1Z2M A;  2G3Q B;  2N7D A;  2KX3 A;  4TQ0 A;  5KHO A;  2IO1 B;  1P0R A;  4KV2 A;  1L2N A;  4EEW A;  4EZJ A;  3L17 A;  2ZCB A;  2PPH A;  3KH0 A;  1YIW A;  4TQ1 A;  2GBJ A;  2LVP A;  1AAR A;  1OGW A;  2LJ5 A;  4W9H A;  3RZW C;  3AU4 A;  5LLI A;  1PQS A;  2N9E B;  2LGD A;  1WZ0 A;  1WGY A;  3RZF A;  3VTU A;  3M63 B;  3DPD A;  1R4M I;  2V1Y A;  3H6N A;  4FJZ A;  2O2V B;  4WWP A;  2GMI C;  2M8S A;  3ALB A;  3H1U A;  3I3T B;  5IA7 A;  3PT2 B;  1WXV A;  4MSM B;  1EO6 A;  2REX A;  2KDF B;  2KHW B;  3KYD D;  1E8W A;  2G45 B;  1Q0W B;  1V81 A;  1WJ4 A;  3UIP B;  3B0A A;  4GMV A;  1V80 A;  4W9F A;  3QAQ A;  4K81 A;  3IG3 A;  1YX5 B;  2FCM A;  4ASW C;  4FLH A;  4WAA A;  3EC8 A;  2KDB A;  2KWC A;  4WQO B;  3DCG A;  5D7G A;  5DPR A;  3RD2 A;  2BKF A;  4HK2 A;  2KLG A;  4FHJ A;  1IPG A;  3B1L X;  1FXT B;  4XZ4 A;  3X23 A;  1GC6 A;  1RFA A;  1A5R A;  4W9I A;  3ZIM A;  2L76 A;  3IVF A;  3U30 A;  4FHK A;  5KHQ A;  1P98 A;  4NQK E;  4A3O A;  3DVN V;  5L95 C;  4G0N B;  2IY1 B;  1KJT A;  1WI0 A;  3SDL C;  1WJU A;  3VVW B;  1F9J A;  2IO0 B;  1T0Y A;  3CSF A;  5DPT A;  3TIX A;  4DHZ B;  4DK5 A;  4PYU A;  3PHW B;  1J0G A;  2JUO A;  3ECI A;  5D2M B;  4F8C B;  3A4S C;  2IO2 B;  2KOX A;  2MSE D;  4NNJ B;  2KTF A;  3CF6 E;  3VUW A;  1UGM A;  2I1J A;  3MTN B;  3DBH I;  2MWS B;  3ZNI D;  4DHZ E;  2RGF A;  2D11 A;  4HPL B;  3QX1 A;  3PGE A;  2PJH A;  1Q5W B;  2BYE A;  5JZE B;  4XC2 A;  2EMT A;  5JHA A;  2NBU A;  2JY6 A;  1UEL A;  1J19 A;  4FA6 A;  2AEH A;  4OVV A;  4BOS C;  4AJW A;  2R2Q A;  3N32 A;  2NPT A;  4BKS D;  1V5T A;  1WZ3 A;  3V61 A;  1LQB A;  2ZZP B;  3ZO5 B;  2BWE S;  1ISN A;  2JXX A;  2C7N B;  2GBM A;  2JF5 A;  4X57 B;  3NHE B;  1J8C A;  4ZYN A;  1KLV A;  2LVO A;  1YD8 U;  3NY5 A;  4IWQ A;  2FCN A;  2RD0 A;  4GN1 A;  4PS8 A;  4IW0 A;  2MBH A;  4MEL A;  3ENE A;  3VXW A;  4FUL A;  3KW5 B;  2ZVN A;  2K25 A;  2D10 A;  4M8N A;  3LJ3 A;  2ASQ A;  3AI5 A;  3QK0 A;  2MX2 A;  2ZNV C;  2O2V A;  2K6Q A;  1WMH A;  3HIZ A;  2A4Z A;  4K7U A;  4RM9 A;  2KMC A;  4LJO B;  4AUQ C;  4HJK A;  5IAA C;  2C5L C;  1GNU A;  1WE6 A;  2MRP A;  3RT3 B;  2DZJ A;  2L3Z A;  4BKS A;  3CMM B;  2I1K A;  4FJY A;  4B9K A;  1WRD B;  1E90 A;  2L05 A;  3PTF C;  4GOC A;  1VD2 A;  4IM0 A;  3R7Q A;  1WR1 A;  2CU1 A;  2KWU B;  1WYW B;  1TZ1 A;  2DX5 B;  2GOW A;  4MGY E;  3UQA A;  3VUX A;  4HDO A;  3EEC A;  5CX3 A;  1M94 A;  3PS6 A;  4G11 A;  4NAW B;  5DPW A;  4EZK A;  4II3 B;  4GSW A;  3RYT A;  5CTR C;  2K8H A;  2MBQ A;  2DYB A;  4GXB A;  1LFD A;  3JYU A;  5HKH A;  2LI5 A;  2K8B A;  4ANW A;  1WFY A;  4LCD E;  4G50 A;  1KM7 A;  1WXS A;  2LXA A;  2KWV B;  1GC7 A;  4KSK C;  4IWO A;  4NAW A;  4ANV A;  3W1Y A;  1YQB A;  2L0T A;  4WWO A;  5BO4 B;  3H7S A;  1KOT A;  1E8Z A;  1ZW7 A;  4MM3 A;  4CO7 A;  1E7U A;  2CHZ A;  2BYF A;  2KXJ A;  5LXI B;  3SHQ A;  3ZNG C;  3A9J B;  3IBE A;  2L8J A;  3ZTC A;  3PRM B;  4DHJ D;  3QWZ B;  3TCA A;  4NPN A;  2CHW A;  4MEM A;  4EKU A;  4JLC A;  3DVG Y;  4II2 B;  3L10 B;  2DAJ A;  2KK8 A;  2KZR A;  5DCN A;  2O6V A;  4GIV A;  5AZG A;  4RMA A;  3N3K B;  4MGI E;  2NBW B;  4HXD A;  3VFK A;  2J0M A;  4LJP B;  2KDE B;  3ZW3 A;  2GBK A;  2DYO A;  4ZDV A;  2KVR A;  3PV1 A;  1V5O A;  2LD9 A;  3ZNZ B;  2Z0E B;  2JWZ A;  2VRR B;  2N7E A;  3DBL I;  3APD A;  2KC1 A;  4URK A;  2D2Q A;  2K39 A;  1IYF A;  4KZC A;  4KSL C;  4EUT A;  2WYQ A;  2Z0D B;  2GBN A;  2IZV B;  2JVC A;  4JIO U;  1UBQ A;  5TR5 A;  4F7Z A;  4XX5 A;  4MJS A;  2CR5 A;  2ZCC A;  4P7I A;  4N9F 4;  2NPT B;  3T9L A;  3VTW A;  3WAO A;  3AUL A;  2KKC A;  3DDC B;  3VHT C;  1WJN A;  2ZPN A;  2XK5 B;  4ANX A;  1E5W A;  3JSV A;  1I35 A;  1E7V A;  3A9K B;  1RRB A;  2JZ3 B;  4JQW C;  2JRH A;  3U8Z A;  1Z5S B;  1WF9 A;  2DZM A;  3NOB A;  1L7Y A;  4IM3 A;  4YL8 A;  3SU8 X;  4ZRJ A;  1E8X A;  2DHZ A;  2MW5 A;  4F1S A;  2EKE C;  4KIK B;  1WIA A;  4KZ0 A;  2KJH B;  2KQ7 A;  3L54 A;  1NDD A;  2IYD B;  2LRU A;  2LAS A;  2NCN A;  4GDK B;  4TV3 A;  2WWZ A;  5G2N A;  4IM2 A;  3L0W B;  4GDL B;  1G6J A;  3T8M A;  2CS4 A;  2C7M B;  2YVC A;  4W9J A;  5CHW A;  2LRW A;  2HE7 A;  3ZTD A;  2DYM A;  3QJZ A;  5G55 A;  5JH5 C;  3V6C B;  1P3Q U;  2FCS A;  5J2R A;  1XQQ A;  2LUE A;  3TJP A;  3R3M A;  1NBF C;  4JGH B;  2MCN B;  2FIF A;  4ICV A;  3GOE A;  1D3Z A;  4ZRK A;  3O65 B;  4K1R B;  1WM3 A;  2BF8 B;  3H7P B;  1XT9 B;  2DZI A;  3PVL A;  3PZD A;  4IG7 B;  3CST A;  2C9W B;  2MBB B;  1GG3 A;  1WMH B;  2O6V D;  1LM8 B;  3LDZ E;  1V6E A; 
#chains in the Genus database with same CATH topology
 2JZZ A;  4EZL A;  4MDK E;  1C4P A;  2WXK A;  1JW9 D;  1YNT E;  1I42 A;  2A5U A;  4DXF A;  1RLF A;  4CYE A;  2IY0 B;  1R4N I;  3Q3F A;  3VH3 B;  1EF5 A;  1JQ4 A;  2WDQ B;  2INP E;  5C23 A;  3L08 A;  2ICI A;  5D3D A;  2BWF A;  1RAX A;  4AP4 C;  1ET9 A;  4IWP A;  3C8Y A;  5E6N A;  3Q3N C;  2NR2 A;  3HM3 A;  1V86 A;  4KDL B;  2OOB B;  4M02 A;  4B0M A;  1QLB B;  3N30 A;  1DGJ A;  3RUI B;  2WU2 B;  1WRI A;  2BKR B;  4W9K A;  4AWJ A;  3AE3 B;  3AEF B;  1AN8 A;  1T3Q A;  4W9L A;  4JPS A;  1H8C A;  2K5P A;  1K52 A;  4ZOH C;  2C7H A;  4XWT A;  2BB5 A;  2ZEQ A;  2QEJ C;  4W9C A;  3A4R A;  3ZVV A;  1C9F A;  2G1E A;  2VZK B;  3PRP B;  5DPS A;  2W82 A;  2L0F A;  4G3X B;  3V6E B;  3NRZ A;  3H7P A;  3W2D A;  4M8M A;  4CHK A;  2WX1 A;  3X0W A;  4WWN A;  1C78 A;  5HI1 A;  1J7B A;  1RWS A;  3WA0 A;  1IBX B;  3ETR A;  3KVF B;  4E3C A;  1I4P A;  3H8H A;  1K8R B;  4E71 A;  2N4F A;  2MHJ A;  1OTR B;  3M3J A;  3GE3 C;  1ZKH A;  1CZP A;  1NYQ A;  1EM7 A;  4GDK A;  2KTR A;  3WAM A;  2WXF A;  3NZS A;  3RUL A;  2L32 A;  1QZE A;  2PVO D;  2V9H A;  3N1Y C;  2HD5 B;  2MQJ A;  4WJN A;  3W1S C;  4DQO C;  3Q8C A;  1V49 A;  4I6P A;  4GDL A;  4JE3 B;  2G9H D;  2XN9 C;  2BYV E;  2N1V A;  3WAN A;  3JSV B;  1WR6 E;  2KC2 A;  3B9J A;  2ZJD A;  3AEA B;  1F1H A;  1OQY A;  2IGG A;  1WH3 A;  5IP4 D;  1ESF A;  3O13 A;  3AEC B;  2BS3 B;  1HA5 A;  2N9P C;  2KFK B;  1SEB D;  2KX0 A;  1IP9 A;  5T8I A;  4LNN A;  4HCN B;  3AE6 B;  4B6W A;  4FBJ B;  1TGZ B;  3TBL D;  3IT4 B;  2KFK A;  4LDT D;  2D3B A;  4AQ7 A;  2J0K A;  3HHM A;  4WJO A;  3MJW A;  2PE9 A;  3L16 A;  1UUP A;  4BAX A;  1JRP A;  4ACF A;  5EE1 A;  4JL9 A;  2WDR B;  4D2K A;  1DOY A;  3HVD A;  1QKZ A;  4IKG A;  1HE8 A;  1WYG A;  3BYT B;  3M95 A;  2KMA A;  2JSV X;  2JQR B;  2OED A;  4DDI D;  2KTR B;  2RR9 A;  5EDS A;  4TUU A;  3M62 B;  1WJ6 A;  5KHO A;  1UNS A;  2IO1 B;  3EUB 2;  1RFK A;  3GZN B;  5HHD G;  2IJ0 A;  2PKO A;  2LJ5 A;  4W9H A;  3AU4 A;  5LLI A;  2N9E B;  2L1A A;  4US9 A;  1WGY A;  1IBX A;  3RZF A;  3DPD A;  2V1Y A;  4FJZ A;  2O2V B;  1MG4 A;  3I3T B;  3W9C B;  1EO6 A;  2REX A;  2G45 B;  2KVZ A;  2ON8 A;  1V81 A;  3UIP B;  2YEP F;  2FUG 1;  1YX5 B;  2FCM A;  4WAA A;  3TEW A;  1T5X D;  1JWM D;  2ZW0 A;  5BYR A;  4HK2 A;  2Y5C A;  3E56 A;  1R7S A;  3X23 A;  3IAS 1;  4OZC A;  3IVF A;  5KHQ A;  3AEE B;  3DVN V;  4ARI A;  2IY1 B;  1JWU D;  2WXQ A;  1T6B X;  1WJU A;  2WXI A;  2DBY A;  1T0Y A;  2TSS A;  4DHZ B;  4F8C B;  1TS4 A;  3CF6 E;  1UGM A;  4KGS A;  2JXT A;  2KQ4 X;  5JZE B;  4XC2 A;  5BMI A;  4YXD B;  4TMA B;  2WXJ A;  4FA6 A;  4OVV A;  4ITK A;  5D3I B;  3Q8F A;  3N32 A;  2WS3 B;  4BKS D;  1OQQ A;  2ZZP B;  3NUH B;  1TKY A;  2J42 A;  1MVK A;  1J8C A;  2LVO A;  3AE1 B;  1YD8 U;  3EA6 A;  4ZRP A;  2RD0 A;  4IW0 A;  1KF6 B;  3ENE A;  3VXW A;  2K25 A;  3LJ3 A;  3QK0 A;  2ONQ A;  2ZNV C;  2V3N A;  4K7U A;  1SB3 C;  1AYF A;  3AE5 B;  4HJK A;  1WE6 A;  1TS3 A;  2QSD A;  1SE2 A;  1DOI A;  4GOC A;  1VD2 A;  3R7Q A;  3DBL B;  4YTN B;  2L83 A;  3DBR B;  3BWU D;  3SR6 A;  1EWC A;  1IUE A;  4TSS A;  3EEC A;  5CX3 A;  1E10 A;  1CK1 A;  4RGM A;  4EZK A;  4NZL B;  3NZ3 A;  3RYT A;  3FC4 A;  5CTR C;  3BVM A;  4GXB A;  1WFY A;  4LCD E;  1WXS A;  4RGO S;  1KLU D;  4KSK C;  4M00 A;  4UDU C;  4NAW A;  4ANV A;  3W1Y A;  4WWO A;  5BO4 B;  2WXO A;  3H7S A;  5BYS A;  1E8Z A;  1ZW7 A;  2RMM A;  4OHJ A;  5LXI B;  1QIL A;  1UWX A;  3IBE A;  4P6V F;  3ZTC A;  4DHJ D;  3QWZ B;  3TCA A;  4MEM A;  2KK8 A;  2IDY A;  5AZG A;  4RMA A;  3C19 A;  4HXD A;  1LO5 D;  2Z0E B;  3NVV A;  2N7E A;  1FFV A;  3L4P A;  4EUT A;  4YSZ B;  4JIO U;  2MEK A;  4P7I A;  3T9L A;  2BW2 A;  2WHI A;  3VTW A;  1WJN A;  2DLB A;  2XK5 B;  4RF0 A;  3FIL A;  3A9K B;  1D5Z C;  4JQW C;  2JRH A;  3HRD D;  4RGT A;  3SU8 X;  4ZRJ A;  1E8X A;  4F1S A;  2EKE C;  4KIK B;  4KZ0 A;  2KJH B;  4MH8 A;  2NCN A;  4TV3 A;  1JCK B;  2MJE A;  3L0W B;  5H8Y E;  1ZDV A;  1TY2 A;  2WU5 B;  3QJZ A;  1TS2 A;  5JH5 C;  2FCS A;  2LUE A;  4C4V B;  1NBF C;  2MCN B;  2BVC A;  2FIF A;  2KYW A;  4OVZ A;  1ZOY B;  2CJO A;  3PZD A;  4IG7 B;  1YN4 A;  2C9W B;  2MBB B;  1GPX A;  2OJW A;  3IT6 B;  3UIO B;  2YLM A;  1EU3 A;  3LB8 C;  4KVG B;  3RN9 C;  4BFR A;  5C1Z A;  5AUK A;  1WGR A;  1F52 A;  5IOI A;  2PW9 A;  1TKE A;  3ML8 A;  2RDG A;  3OJ4 B;  3ONS A;  3BY4 B;  1ZPS A;  4A6Q A;  2W3S A;  2W9N A;  2HTH A;  3RPF C;  1HZ6 A;  3QCA A;  4HPP A;  1T0Q C;  4K3C A;  4XGA B;  2HJ8 A;  5AZF A;  3GS2 A;  3BZD B;  2V4L A;  2NS5 A;  1SGH A;  4DDG D;  1LGR A;  2N7J A;  3DBR I;  2WXH A;  3DBH B;  3ZJU A;  2PTL A;  4I6N B;  3V60 A;  2WX0 A;  1QOF A;  3AM9 A;  3DVG X;  4OW0 A;  2ZNV B;  2K6D B;  1WY8 A;  3SFD B;  1P9D U;  3UQB A;  3NS1 A;  2L7R A;  1WX8 A;  1GJZ A;  2KO3 A;  2KFJ A;  2CHX A;  2SEB D;  3OLM D;  4GGQ A;  5D94 A;  3Q8B A;  1JWA D;  4MSQ B;  4B95 A;  2XBB C;  1FMA D;  3DVN U;  4KX6 B;  4M0W A;  3T3O A;  1P7F A;  1XD3 B;  2M1M A;  5G5H A;  2V4I B;  3QIJ A;  2CKH B;  3QC8 B;  1WM2 A;  3AE2 B;  4PS3 A;  1WGH A;  1UZX B;  1YN5 A;  3RNC C;  2J7Q B;  4XWW A;  2DAF A;  2AX5 A;  3JVZ X;  5FR3 A;  1CQV A;  2RDB C;  4M01 A;  3BII D;  2LZ6 A;  4TKN A;  4DHJ B;  2UYZ B;  3U7D A;  3PRE A;  3UF8 A;  1OFF A;  2I2Y A;  2AL3 A;  2V3S A;  4E74 A;  3K9O B;  3P42 A;  3R2I A;  1MHX A;  1WXA A;  3AE7 B;  1H4R A;  1HXY D;  1GB1 A;  4NY0 A;  1X1M A;  4BZA A;  3IAM 1;  2B3A A;  3VR8 B;  1VZ6 A;  1BT0 A;  1QF6 A;  2M0A A;  3PSE B;  4LDT B;  4PS7 A;  3B08 A;  4GB9 A;  1B9R A;  3VUY A;  1PGX A;  1VCB A;  2KJ6 A;  1STE A;  5AUI A;  5TSS A;  3AEG B;  4MAC A;  2IBI B;  2YEP B;  1UGJ A;  3PLU A;  3AXC A;  3APC A;  3ZNH B;  4US8 A;  2FID A;  1TKG A;  3V62 A;  2FAZ A;  2KDI A;  1MPE A;  5IN7 A;  2LHD A;  2D5G A;  5E6O A;  4NJC A;  2RPV A;  1TT5 B;  1D5X C;  4HLE A;  1S1Q B;  1I4X A;  1XEE A;  3GZN I;  4PYZ A;  1YJ1 A;  4HVB A;  1Z2M A;  2N7D A;  3GP7 A;  4KV2 A;  3HUI A;  4TQ1 A;  3TSS A;  1TS5 A;  2LVP A;  4N58 A;  1DYQ A;  2X8X X;  2WDV B;  1WZ0 A;  3VTU A;  1JWS D;  3H6N A;  3VRB B;  4L1B A;  2M8S A;  3H1U A;  4WH4 A;  2KDF B;  3KYD D;  1WJ4 A;  4P1B C;  5BMG A;  3B0A A;  1N63 A;  1V80 A;  4YTP B;  4W9F A;  2HTM E;  1EU4 A;  2KWC A;  3DCG A;  4S0R A;  2KLG A;  2BYT A;  1FXT B;  1A5R A;  3ZIM A;  4A3O A;  5L95 C;  4G0N B;  1KJT A;  1WI0 A;  4P1C C;  3VVW B;  2INN E;  5DPT A;  1C79 A;  3PHW B;  1J0G A;  1XO3 A;  3DHH C;  4WQM A;  3A4S C;  1UWM A;  2KTF A;  1MI0 A;  3FKY A;  3VUW A;  2I1J A;  3DBH I;  3ZNI D;  3P4R B;  5JHA A;  2WXN A;  1J19 A;  2R61 A;  3AN1 A;  4KKI A;  4LNF A;  2HDE A;  4ZRQ A;  2R2Q A;  1BUI C;  1SJE D;  1VZ8 A;  1XF5 L;  1WWT A;  4YWG G;  1WZ3 A;  2LMC A;  1ISN A;  3Q3M C;  2JF5 A;  4B0E A;  4X57 B;  4ZYN A;  4LNK A;  1SIJ A;  2FCN A;  4GN1 A;  4A90 A;  2MBH A;  4MEL A;  4FUL A;  1I4G A;  4REZ A;  2H88 B;  4RFB A;  2BS2 B;  2O2V A;  3ZXV A;  4RM9 A;  3RNF C;  3CWI A;  3MJ5 A;  2WXP A;  2C5L C;  1N62 A;  4B9K A;  5HFY A;  4FJY A;  1WRD B;  2ACZ B;  2L05 A;  1F2R C;  2FBW B;  2CU1 A;  1L4D B;  1WYW B;  3MFG A;  1TZ1 A;  2BS4 B;  2DX5 B;  1C4C A;  3VUX A;  1WGK A;  4HDO A;  1M94 A;  3W5U B;  1V97 A;  3N1X C;  2DYB A;  1LFD A;  3JYU A;  2WP9 B;  2LI5 A;  2K8B A;  4ANW A;  4G50 A;  2W3R A;  1FNW A;  1XXG A;  1L0V B;  4CO7 A;  4MM3 A;  1E7U A;  1XCT L;  2KXJ A;  1C77 A;  4S17 A;  1B1Z A;  1JRO A;  4EKU A;  4JLC A;  3L10 B;  2DAJ A;  2KZR A;  3AV8 A;  1FCC C;  5EE9 A;  1MFW A;  2J0M A;  4LJP B;  1QOG A;  3ZW3 A;  2GBK A;  3APD A;  1VR9 A;  4ARC A;  4URK A;  1NVI D;  4KZC A;  2WYQ A;  2KN4 A;  2GBN A;  2NTS A;  1Y56 A;  3OG5 A;  3AE8 B;  3R2T A;  3FAH A;  2KKC A;  2AQ2 B;  3VHT C;  2KT7 A;  1PYW D;  1I4H A;  1I35 A;  1RRB A;  2JZ3 B;  4LLG M;  3U8Z A;  1Z5S B;  3Q8A A;  2DZM A;  5JXV A;  3NOB A;  1L7Y A;  1E0Z A;  1GOZ A;  2MW5 A;  1WIA A;  2KQ7 A;  2LRU A;  2N0S B;  2N9L A;  5G2N A;  1D5M C;  4GDL B;  4DXG A;  1G6J A;  3KLS X;  5CHW A;  2HE7 A;  3ZTD A;  5G55 A;  3V6C B;  1XQQ A;  1OQR A;  1R4M B;  1D3Z A;  2K3U A;  4ZRK A;  3O65 B;  4K1R B;  1WM3 A;  2LGS A;  3PVL A;  2WXR A;  2O6V D;  1J7A A;  1WMH B;  4YL8 A;  2VH1 A;  1V6E A;  4W9E A;  1XLN A;  1IGD A;  3LYY A;  1D4B A;  4C56 C;  4HRS A;  4GU2 A;  4EFO A;  2QHO A;  2FNJ B;  2L52 A;  5FKA C;  2UU7 A;  4C7Z A;  2G4D B;  3ZKJ C;  4FJV B;  3IXS A;  3I5J C;  3VTV A;  2LJI A;  5AEK B;  5EE0 A;  2MBE A;  2N9X A;  5E6P A;  2JT4 B;  2X38 A;  2AL6 A;  4BOZ B;  1FNV A;  1N60 A;  1FIQ A;  3Q3O C;  2QIL A;  1E7P B;  2WDT B;  1OEY J;  1QQR A;  3RCZ A;  3ZRC A;  4JWU C;  2GI9 A;  4ZRI A;  1ET6 A;  4BKT A;  3AH7 A;  2M56 B;  2LXC A;  3VQI A;  1JWB D;  1UBI A;  2K8C A;  2D3C A;  2ZVO A;  3DWM A;  4K7S A;  2IGH A;  3ABV B;  3AED B;  2G4S A;  1TTN A;  1L5P A;  4HPM B;  4MJS B;  3WAL A;  3RNE C;  3AB5 A;  3TUO A;  3KUC B;  2LVQ A;  4MH0 E;  2Z59 B;  1IGC A;  2EMS A;  2NVU I;  1S3S G;  5D6J B;  1WXQ A;  2AQ3 B;  3NVY A;  1YOV B;  1YMH E;  4AJY B;  3BYY B;  4ZYS A;  4KGT A;  3P2B A;  3RNB C;  4WJP A;  1SIF A;  2RPQ A;  4W9D A;  4RM8 A;  2BPS A;  2NBV B;  4WIP A;  3A9J A;  1C3T A;  4KIK A;  2JRI B;  2M0X A;  2C60 A;  1MG8 A;  2AWT A;  4A9A A;  3A9K A;  3QA8 A;  3WIM A;  1WX9 A;  1N61 A;  1FCL A;  2LHE A;  1WX7 A;  2KJR A;  2XK5 A;  3P4S B;  3Q2A C;  1L6U A;  1MJD A;  2BGF A;  2LWP A;  3A1Q B;  5BMH A;  5J17 A;  3R8B A;  2IPK D;  2D3G A;  4J3O D;  2KNB A;  1JRU A;  1KTK A;  2DEN B;  4NQL B;  2KLC A;  2Y5P A;  4AOF A;  4RH6 A;  2K0P A;  2OJR A;  3I63 C;  3K9P B;  3R7R A;  3J9C A;  3UI3 A;  3JW0 X;  3DOW A;  4M0W B;  3PHX B;  4HWI B;  2MJD A;  4FN2 A;  4BVU C;  2LGY A;  3N1Z C;  3A33 B;  4BKG A;  4KDI C;  4AS1 A;  2RDH A;  1FM0 D;  4ZHO A;  3EHV A;  1KLG D;  2QDF A;  2ZPY A;  2MP2 A;  1PGB A;  3R66 C;  3ZLZ A;  3CIR B;  2D07 B;  2AYO B;  3I57 A;  1XCQ L;  3QQ8 B;  3OAW A;  3TMP B;  5FK9 C;  3A1Q A;  3TEZ A;  3MC0 B;  3Q8E A;  2KDM A;  5JHB A;  1I7H A;  2XNA C;  2BT6 A;  1WGG A;  1L0X B;  4I6L B;  5GXG B;  4MGK E;  4L2Y A;  3S2A A;  1TBE A;  2M17 A;  1ZGU B;  2VH2 A;  1ZDX A;  2G3Q B;  3B2G A;  1L2N A;  2JYT A;  3L17 A;  2ZCB A;  2PPH A;  2WLB A;  3KH0 A;  4QAY A;  3RZW C;  1AAR A;  4LNO A;  1EWY C;  1T0S C;  4OZB A;  3E9S A;  3M63 B;  1R4M I;  3RMK C;  1RM6 C;  2GMI C;  4MSM B;  4R3D A;  4XE0 A;  4HEA 1;  2PIA A;  3ZGZ A;  2PVG C;  4WWM A;  3I9V 1;  4K81 A;  1SXT A;  4MT5 A;  4FLH A;  1PDX A;  2N9K A;  1N5X A;  1FPY A;  4FHJ A;  3BVZ A;  1IPG A;  2LFI A;  4A8X C;  3EGR A;  1Q10 A;  4LNI A;  5I4D A;  4XZ4 A;  3TEY A;  1RFA A;  4W9I A;  2L76 A;  4NQK E;  2BQQ A;  3SDL C;  2IO0 B;  3P4P B;  4PYU A;  4HJG E;  1GAQ B;  2WGS A;  2JUO A;  3ECI A;  4KGR A;  2IO2 B;  2KOX A;  2MSE D;  2KWD A;  5BYQ A;  4NAM A;  4DHZ E;  2RGF A;  2D11 A;  2PJH A;  1Q5W B;  1UEL A;  2AEH A;  4LTU A;  1TY0 A;  2WXG A;  1AWD A;  3V61 A;  1LQB A;  3ZO5 B;  2C7N B;  1ENF A;  2J53 A;  3NHE B;  1KLV A;  1XLP A;  2DWQ A;  3NY5 A;  4PS8 A;  1FRR A;  4M8N A;  3KW5 B;  3NVZ A;  2MX2 A;  2K6Q A;  1WMH A;  2A4Z A;  2DNF A;  4LJO B;  5IKC M;  4AUQ C;  2PMV A;  3BK1 A;  1YJJ A;  2MRP A;  2L3Z A;  3LXF A;  4BKS A;  1BXT A;  1ROE A;  4N59 A;  2KWU B;  2GOW A;  4MGY E;  3PS6 A;  1YJI A;  3DHI C;  4G11 A;  4NAW B;  4II3 B;  4PK1 A;  3MC9 A;  5HKH A;  1NEN B;  4C00 A;  1HQR D;  4IWO A;  1YQ3 B;  3KWV A;  1YQB A;  4OZA A;  2L0T A;  2BBC A;  1KOT A;  2BYF A;  3EFC A;  3ZNG C;  3RI7 C;  3A9J B;  2L8J A;  3Q14 C;  3PRM B;  4NPN A;  2CHW A;  4II2 B;  1E9M A;  1SJH D;  1SE4 A;  2O6V A;  1HEZ E;  4GIV A;  3N3K B;  3RFZ B;  4ZDV A;  2E6X A;  2KVR A;  2SAK A;  1V5O A;  3T3N A;  2VRR B;  3DBL I;  2INC C;  4L23 A;  2I38 A;  1L0Y B;  4ZHP A;  4GLS C;  1DOX A;  4KSL C;  1WSP A;  1F2R I;  2IZV B;  1UBQ A;  5TR5 A;  3TEX A;  1K50 A;  4XX5 A;  3U52 E;  4MJS A;  2CR5 A;  1K51 A;  1V1P B;  2NMQ A;  3WAO A;  3DDC B;  4WUR A;  3JSV A;  1PGA A;  1VRA B;  2LUM A;  3PZ8 A;  1SBB B;  3BVG A;  1BML C;  1V1P A;  3AE9 B;  3P1M A;  2IYD B;  2LAS A;  3MC8 A;  4GDK B;  2WWZ A;  3T8M A;  2CS4 A;  2C7M B;  2YVC A;  1ZUD 2;  4RGN A;  2IGD A;  3R3M A;  5C3J B;  3GOE A;  2MH7 A;  3OWE B;  3W5V B;  2BF8 B;  3H7P B;  1TYG B;  3CST A;  1QOB A;  2UWQ A;  5LNK 1;  1FO4 A;  2CJN A;  2WNM A;  3MHS D;  4YTM B;  1WGD A;  4DWF A;  1FRD A;  3PO0 A;  3D32 A;  1EUV B;  2QC8 A;  2N1W A;  5GMV A;  1QOA A;  1D6E C;  2BB6 A;  5FR6 A;  4HKQ A;  4WJQ A;  1KRH A;  2ZW1 A;  3SEB A;  3QHT A;  1V2Y A;  1V9J A;  4RF1 A;  4IC7 B;  1V8C A;  4HDQ A;  3ZRF A;  1TZO A;  2MJ3 A;  3OJ3 A;  4JWS C;  3NJT A;  1NI2 A;  3ZJT A;  2KN5 A;  3IFW B;  3AU5 A;  3SD5 A;  2B76 B;  5EE3 A;  2Q5W D;  4JX1 C;  5IO9 A;  2H89 B;  2NTT A;  3WCQ A;  4FAD A;  4RNA A;  3P4Q B;  2IND C;  2GB1 A;  1P1A A;  2Z8L A;  4N6E B;  1FXI A;  4W9G A;  2KAN A;  2R2O A;  3TL5 A;  2KD0 A;  1C76 A;  2KQS A;  2K1F A;  4O1N A;  4IUM B;  4KKJ A;  1EF1 A;  2J0J A;  2V0G A;  4USA A;  2GRI A;  4ICU A;  3MP9 A;  2MBO A;  1VJK A;  1YX6 B;  4MGZ E;  5E6J A;  1L4Z B;  1CMX B;  3KUD B;  5LXH A;  1SE9 A;  1NI3 A;  1FNU A;  2RSU A;  4PT5 A;  4HKZ E;  4Q2J A;  3NVW A;  4K3B A;  4MM3 B;  5J18 A;  4NJ6 A;  3WAP A;  1WXM A;  1V1O A;  4BBN F;  1FD6 A;  4BBN C;  3ZYY X;  1Q1O A;  1VLB A;  2FCQ A;  2MLB A;  3VH4 B;  1I4R A;  4A55 A;  1A70 A;  3PLV A;  1LXD A;  2JPH A;  4DXA B;  4YSY B;  4A3P A;  3ZXR A;  3N20 C;  1FXA A;  3PRZ A;  2IO3 B;  4ANU A;  2GBR A;  4HCP B;  2K22 A;  3KQ4 A;  3NZU A;  2DZK A;  2K9X A;  1VDV A;  1WE7 A;  1JML A;  3ZDT A;  5L83 A;  4NJ7 A;  1E8Y A;  5C2T B;  2Y5B B;  1PFD A;  3KUZ A;  1NYR A;  2JWU A;  4K7W A;  4EOY A;  1UD7 A;  2EEL A;  3GB1 A;  2HJ1 A;  3QAR A;  3DWG C;  3VDZ A;  1GB4 A;  5CHV C;  3APF A;  4C4V A;  4DBG A;  3BK2 A;  2XEW A;  3UGB B;  4A20 A;  1Y8R C;  2L00 B;  1N5W A;  3MHZ A;  2O6V B;  4IOI E;  2FUH B;  3HM6 X;  2D3A A;  4J6I A;  3U7Z A;  4LK0 M;  2PEA A;  3AE4 B;  2MA9 B;  3ZUN A;  3W1S A;  3NS8 A;  4OVU A;  3ML9 A;  3DBS A;  3KYC D;  1GUA B;  1XLQ A;  1TIF A;  3VR9 B;  3HVZ A;  5AZH A;  3BIN A;  2LGX A;  1OEY A;  2JYE A;  3EFU A;  2M4N A;  4CQN A;  1QT9 A;  2WXL A;  3ZDM C;  4IDI A;  2BTE A;  3U2S C;  3C0R B;  2MP2 B;  1C1Y B;  3NG0 A;  1JAL A;  2J52 A;  2PE6 B;  3UIN B;  3RNG C;  4C80 A;  3HK0 A;  3DQV A;  3Q3J A;  3H9D A;  3URY A;  3PPA A;  3L13 A;  1U4A A;  3IHP C;  1UH6 A;  3VAW A;  5CHF A;  1YN3 A;  2QJL A;  2KX3 A;  4TQ0 A;  1P0R A;  4EEW A;  4EZJ A;  1YIW A;  4EE2 A;  2GBJ A;  1OGW A;  2OHF A;  1HTO A;  1PQS A;  2LGD A;  4WWP A;  3ALB A;  5IA7 A;  2CU3 A;  3PT2 B;  1WXV A;  2W55 A;  2KHW B;  1E8W A;  2LGI A;  1L6V A;  3V3X A;  2PLP A;  1Q0W B;  4GMV A;  3QAQ A;  3IG3 A;  4ASW C;  4HRO A;  3EC8 A;  2KDB A;  3AEB B;  4WQO B;  5D7G A;  1C4A A;  5DPR A;  1KFY B;  3RD2 A;  2BKF A;  1VZ7 A;  2FE8 A;  3B1L X;  1F77 A;  3ZQ4 A;  1GC6 A;  2JZP A;  1ZXH A;  1J7C A;  2EKI A;  3U30 A;  4FHK A;  1P98 A;  1ZE3 D;  1YQ4 B;  1PUT A;  2KMM A;  1F9J A;  3CSF A;  4DK5 A;  3TIX A;  2VZK D;  3N9Y C;  1RYJ A;  5D2M B;  1FEH A;  3PZ7 A;  4NNJ B;  4XDD A;  2V3P A;  3MTN B;  2MWS B;  5H92 C;  5MPO A;  4HPL B;  3QX1 A;  3PGE A;  2BYE A;  2EMT A;  2NBU A;  2JY6 A;  1N6Z A;  4BOS C;  4AJW A;  3AMZ A;  2NPT A;  3V05 A;  1TJE A;  1V5T A;  3ZJV A;  1UF0 A;  2BWE S;  4RCO A;  2JXX A;  2GBM A;  1R4N B;  4IWQ A;  4YT0 B;  2ZVN A;  2D10 A;  2ASQ A;  3AI5 A;  3HIZ A;  2KMC A;  5IAA C;  4FXC A;  1SSN A;  2WXM A;  1GNU A;  3RT3 B;  2DZJ A;  2AQ1 B;  2W54 A;  3CMM B;  2I1K A;  1E90 A;  3PTF C;  5HG2 A;  4IM0 A;  1WR1 A;  3KWL A;  3B2F A;  3UQA A;  1M4V A;  3P63 A;  1KH0 A;  5DPW A;  2KAC A;  4GSW A;  2K8H A;  2MBQ A;  1KM7 A;  1XLO A;  2LXA A;  2KWV B;  2GLS A;  1GC7 A;  1FFU A;  3FIL B;  2JX5 A;  1T0R C;  2CHZ A;  2Y3A A;  1P7E A;  2WQY B;  3SHQ A;  1NEK B;  1MHH E;  4P16 A;  4XDC A;  2KAJ A;  3DVG Y;  5DCN A;  3Q6B A;  1SF0 A;  1ZXI A;  3Q69 A;  3GE8 C;  1AW7 A;  1SE3 A;  1HTQ A;  4MGI E;  2NBW B;  3VFK A;  2KDE B;  2QIE B;  2DYO A;  3PV1 A;  2LD9 A;  3ZNZ B;  5G5G A;  3VRA B;  2JWZ A;  3RNA C;  2KC1 A;  2D2Q A;  2K39 A;  3DHG C;  1IYF A;  4XYC A;  2Z0D B;  2JVC A;  4F7Z A;  1I4Q A;  2E3T A;  2ZCC A;  4N9F 4;  1E6E B;  2NPT B;  1ACC A;  3AUL A;  1HZ5 A;  2ZPN A;  4ANX A;  1E5W A;  1F0Z A;  3SFE B;  1E7V A;  3U4E G;  4YSX B;  1K53 A;  1WF9 A;  4IM3 A;  2DHZ A;  3L54 A;  1NDD A;  4IM2 A;  2QCZ A;  2LEK A;  4W9J A;  2J4X A;  2LRW A;  2JU6 X;  2QMT A;  2DYM A;  1CJE A;  4H2A A;  1P3Q U;  2M19 A;  5J2R A;  3TJP A;  4JGH B;  1ZP0 B;  4C7Y A;  4ICV A;  4WAF A;  1XT9 B;  2DZI A;  1GG3 A;  3LDZ E;  1LM8 B; 
#chains in the Genus database with same CATH homology
 2JZZ A;  4W9E A;  4EZL A;  2UWQ A;  3UIO B;  2YLM A;  4MDK E;  4KVG B;  3MHS D;  4BFR A;  4GU2 A;  4EFO A;  2QHO A;  2FNJ B;  5C1Z A;  1WGR A;  1I42 A;  2A5U A;  2G4D B;  3ML8 A;  1RLF A;  4CYE A;  2IY0 B;  1R4N I;  3OJ4 B;  3BY4 B;  3ONS A;  1EF5 A;  1WGD A;  3Q3F A;  3VH3 B;  3ZKJ C;  5C23 A;  3L08 A;  4FJV B;  4DWF A;  2BWF A;  3D32 A;  1RAX A;  4AP4 C;  2W9N A;  1EUV B;  4IWP A;  5E6N A;  2N1W A;  2HTH A;  5GMV A;  2NR2 A;  3HM3 A;  1V86 A;  4KDL B;  2OOB B;  3VTV A;  3QCA A;  5AEK B;  5FR6 A;  2MBE A;  2N9X A;  4WJQ A;  5E6P A;  2JT4 B;  2AL6 A;  4BOZ B;  2HJ8 A;  3N30 A;  5AZF A;  3QHT A;  2V4L A;  1V2Y A;  1SGH A;  1V9J A;  2NS5 A;  4IC7 B;  4DDG D;  2WDT B;  1OEY J;  3RUI B;  4HDQ A;  3RCZ A;  3ZRF A;  3DBR I;  3ZRC A;  3OJ3 A;  2BKR B;  4W9K A;  4AWJ A;  1NI2 A;  4ZRI A;  2KN5 A;  4I6N B;  3IFW B;  3V60 A;  2WX0 A;  3AU5 A;  4BKT A;  3SD5 A;  4W9L A;  2LXC A;  3VQI A;  1H8C A;  3DVG X;  1UBI A;  2K8C A;  2ZVO A;  2ZNV B;  2C7H A;  2K6D B;  1WY8 A;  2ZEQ A;  1P9D U;  4K7S A;  3UQB A;  4FAD A;  2G4S A;  4W9C A;  3A4R A;  2L7R A;  1TTN A;  3ZVV A;  1P1A A;  4HPM B;  4W9G A;  4MJS B;  3WAL A;  1WX8 A;  1GJZ A;  3PRP B;  5DPS A;  3KUC B;  2LVQ A;  2KAN A;  2KO3 A;  4MH0 E;  2L0F A;  4G3X B;  3V6E B;  2R2O A;  3TL5 A;  2Z59 B;  2KD0 A;  2KFJ A;  2EMS A;  2CHX A;  2NVU I;  2KQS A;  1S3S G;  2K1F A;  3H7P A;  3OLM D;  4IUM B;  4M8M A;  4CHK A;  2WX1 A;  4GGQ A;  3X0W A;  5D6J B;  1EF1 A;  2J0J A;  4WWN A;  5D94 A;  4MSQ B;  3WA0 A;  4ICU A;  4B95 A;  2XBB C;  4AJY B;  3KVF B;  4E3C A;  2MBO A;  3DVN U;  1K8R B;  1YX6 B;  4MGZ E;  4E71 A;  2N4F A;  3P2B A;  1OTR B;  1XD3 B;  2M1M A;  1CMX B;  3M3J A;  1ZKH A;  1SIF A;  2RPQ A;  3KUD B;  4W9D A;  4RM8 A;  4WJP A;  2BPS A;  2NBV B;  3QIJ A;  2CKH B;  5LXH A;  1SE9 A;  2RSU A;  4GDK A;  3QC8 B;  1WM2 A;  2KTR A;  3WAM A;  3A9J A;  3NZS A;  3RUL A;  1C3T A;  4PS3 A;  1QZE A;  1WGH A;  2HD5 B;  2MQJ A;  4KIK A;  4WJN A;  2JRI B;  3W1S C;  2M0X A;  2C60 A;  4I6P A;  1V49 A;  4GDL A;  1UZX B;  5J18 A;  4NJ6 A;  3WAP A;  2J7Q B;  1WXM A;  2BYV E;  4BBN F;  2N1V A;  1MG8 A;  2AWT A;  3WAN A;  4BBN C;  3A9K A;  3QA8 A;  1Q1O A;  2FCQ A;  3WIM A;  1WX9 A;  3JSV B;  2MLB A;  3VH4 B;  2XK5 A;  1WX7 A;  2DAF A;  2KJR A;  1WR6 E;  3PLV A;  3JVZ X;  2KC2 A;  2BGF A;  2LWP A;  2ZJD A;  1LXD A;  2JPH A;  3A1Q B;  4DXA B;  1OQY A;  5J17 A;  4A3P A;  1WH3 A;  2LZ6 A;  4TKN A;  4DHJ B;  3PRZ A;  2IO3 B;  4ANU A;  2GBR A;  2UYZ B;  3U7D A;  4HCP B;  3NZU A;  3PRE A;  3UF8 A;  2D3G A;  2DZK A;  2KNB A;  2N9P C;  1JRU A;  2KFK B;  1WE7 A;  2AL3 A;  2V3S A;  4E74 A;  2DEN B;  3K9O B;  4NQL B;  3ZDT A;  2KLC A;  5L83 A;  4NJ7 A;  4AOF A;  1E8Y A;  2KX0 A;  2OJR A;  2Y5B B;  3K9P B;  1IP9 A;  3KUZ A;  4EOY A;  4K7W A;  1WXA A;  3R7R A;  1UD7 A;  1H4R A;  4HCN B;  3JW0 X;  3DOW A;  4NY0 A;  4M0W B;  3PHX B;  1X1M A;  3QAR A;  4HWI B;  3VDZ A;  5CHV C;  3APF A;  4DBG A;  4B6W A;  4FN2 A;  4BVU C;  2B3A A;  2XEW A;  3UGB B;  4A20 A;  4FBJ B;  2LGY A;  1Y8R C;  1TGZ B;  2L00 B;  3A33 B;  3TBL D;  1BT0 A;  2O6V B;  4BKG A;  2KFK A;  4LDT D;  2FUH B;  4KDI C;  3HM6 X;  3PSE B;  4J6I A;  2J0K A;  3HHM A;  4LDT B;  2PEA A;  3B08 A;  3EHV A;  4GB9 A;  4PS7 A;  3MJW A;  2MA9 B;  4WJO A;  2PE9 A;  1VCB A;  2KJ6 A;  3L16 A;  3VUY A;  3W1S A;  3ZUN A;  3NS8 A;  4OVU A;  3ML9 A;  3DBS A;  4JL9 A;  2ZPY A;  2MP2 A;  3KYC D;  1GUA B;  3R66 C;  2IBI B;  3ZLZ A;  2D07 B;  2AYO B;  5AZH A;  3PLU A;  3AXC A;  2LGX A;  3APC A;  3BIN A;  3QQ8 B;  1OEY A;  3OAW A;  3TMP B;  1HE8 A;  2M4N A;  3EFU A;  3ZNH B;  2FID A;  3M95 A;  3V62 A;  3A1Q A;  2FAZ A;  3ZDM C;  2KDI A;  2KMA A;  3C0R B;  2MP2 B;  1C1Y B;  5E6O A;  5JHB A;  2PE6 B;  4DDI D;  2KTR B;  2RR9 A;  3UIN B;  1WGG A;  5EDS A;  4I6L B;  4HLE A;  3HK0 A;  4MGK E;  1S1Q B;  4TUU A;  3S2A A;  1TBE A;  2M17 A;  3DQV A;  3M62 B;  3Q3J A;  1WJ6 A;  3H9D A;  3PPA A;  1ZGU B;  3GZN I;  3L13 A;  4PYZ A;  1U4A A;  1YJ1 A;  3IHP C;  4HVB A;  1UH6 A;  3VAW A;  5CHF A;  1Z2M A;  2G3Q B;  2N7D A;  2KX3 A;  4TQ0 A;  5KHO A;  2IO1 B;  1P0R A;  4KV2 A;  1L2N A;  4EEW A;  4EZJ A;  3L17 A;  2ZCB A;  2PPH A;  3KH0 A;  1YIW A;  4TQ1 A;  2GBJ A;  2LVP A;  1AAR A;  1OGW A;  2LJ5 A;  4W9H A;  3RZW C;  3AU4 A;  5LLI A;  1PQS A;  2N9E B;  2LGD A;  1WZ0 A;  1WGY A;  3RZF A;  3VTU A;  3M63 B;  3DPD A;  1R4M I;  2V1Y A;  3H6N A;  4FJZ A;  2O2V B;  4WWP A;  2GMI C;  2M8S A;  3ALB A;  3H1U A;  3I3T B;  5IA7 A;  3PT2 B;  1WXV A;  4MSM B;  1EO6 A;  2REX A;  2KDF B;  2KHW B;  3KYD D;  1E8W A;  2G45 B;  1Q0W B;  1V81 A;  1WJ4 A;  3UIP B;  3B0A A;  4GMV A;  1V80 A;  4W9F A;  3QAQ A;  4K81 A;  3IG3 A;  1YX5 B;  2FCM A;  4ASW C;  4FLH A;  4WAA A;  3EC8 A;  2KDB A;  2KWC A;  4WQO B;  3DCG A;  5D7G A;  5DPR A;  3RD2 A;  2BKF A;  4HK2 A;  2KLG A;  4FHJ A;  1IPG A;  3B1L X;  1FXT B;  4XZ4 A;  3X23 A;  1GC6 A;  1RFA A;  1A5R A;  4W9I A;  3ZIM A;  2L76 A;  3IVF A;  3U30 A;  4FHK A;  5KHQ A;  1P98 A;  4NQK E;  4A3O A;  3DVN V;  5L95 C;  4G0N B;  2IY1 B;  1KJT A;  1WI0 A;  3SDL C;  1WJU A;  3VVW B;  1F9J A;  2IO0 B;  1T0Y A;  3CSF A;  5DPT A;  3TIX A;  4DHZ B;  4DK5 A;  4PYU A;  3PHW B;  1J0G A;  2JUO A;  3ECI A;  5D2M B;  4F8C B;  3A4S C;  2IO2 B;  2KOX A;  2MSE D;  4NNJ B;  2KTF A;  3CF6 E;  3VUW A;  1UGM A;  2I1J A;  3MTN B;  3DBH I;  2MWS B;  3ZNI D;  4DHZ E;  2RGF A;  2D11 A;  4HPL B;  3QX1 A;  3PGE A;  2PJH A;  1Q5W B;  2BYE A;  5JZE B;  4XC2 A;  2EMT A;  5JHA A;  2NBU A;  2JY6 A;  1UEL A;  1J19 A;  4FA6 A;  2AEH A;  4OVV A;  4BOS C;  4AJW A;  2R2Q A;  3N32 A;  2NPT A;  4BKS D;  1V5T A;  1WZ3 A;  3V61 A;  1LQB A;  2ZZP B;  3ZO5 B;  2BWE S;  1ISN A;  2JXX A;  2C7N B;  2GBM A;  2JF5 A;  4X57 B;  3NHE B;  1J8C A;  4ZYN A;  1KLV A;  2LVO A;  1YD8 U;  3NY5 A;  4IWQ A;  2FCN A;  2RD0 A;  4GN1 A;  4PS8 A;  4IW0 A;  2MBH A;  4MEL A;  3ENE A;  3VXW A;  4FUL A;  3KW5 B;  2ZVN A;  2K25 A;  2D10 A;  4M8N A;  3LJ3 A;  2ASQ A;  3AI5 A;  3QK0 A;  2MX2 A;  2ZNV C;  2O2V A;  2K6Q A;  1WMH A;  3HIZ A;  2A4Z A;  4K7U A;  4RM9 A;  2KMC A;  4LJO B;  4AUQ C;  4HJK A;  5IAA C;  2C5L C;  1GNU A;  1WE6 A;  2MRP A;  3RT3 B;  2DZJ A;  2L3Z A;  4BKS A;  3CMM B;  2I1K A;  4FJY A;  4B9K A;  1WRD B;  1E90 A;  2L05 A;  3PTF C;  4GOC A;  1VD2 A;  4IM0 A;  3R7Q A;  1WR1 A;  2CU1 A;  2KWU B;  1WYW B;  1TZ1 A;  2DX5 B;  2GOW A;  4MGY E;  3UQA A;  3VUX A;  4HDO A;  3EEC A;  5CX3 A;  1M94 A;  3PS6 A;  4G11 A;  4NAW B;  5DPW A;  4EZK A;  4II3 B;  4GSW A;  3RYT A;  5CTR C;  2K8H A;  2MBQ A;  2DYB A;  4GXB A;  1LFD A;  3JYU A;  5HKH A;  2LI5 A;  2K8B A;  4ANW A;  1WFY A;  4LCD E;  4G50 A;  1KM7 A;  1WXS A;  2LXA A;  2KWV B;  1GC7 A;  4KSK C;  4IWO A;  4NAW A;  4ANV A;  3W1Y A;  1YQB A;  2L0T A;  4WWO A;  5BO4 B;  3H7S A;  1KOT A;  1E8Z A;  1ZW7 A;  4MM3 A;  4CO7 A;  1E7U A;  2CHZ A;  2BYF A;  2KXJ A;  5LXI B;  3SHQ A;  3ZNG C;  3A9J B;  3IBE A;  2L8J A;  3ZTC A;  3PRM B;  4DHJ D;  3QWZ B;  3TCA A;  4NPN A;  2CHW A;  4MEM A;  4EKU A;  4JLC A;  3DVG Y;  4II2 B;  3L10 B;  2DAJ A;  2KK8 A;  2KZR A;  5DCN A;  2O6V A;  4GIV A;  5AZG A;  4RMA A;  3N3K B;  4MGI E;  2NBW B;  4HXD A;  3VFK A;  2J0M A;  4LJP B;  2KDE B;  3ZW3 A;  2GBK A;  2DYO A;  4ZDV A;  2KVR A;  3PV1 A;  1V5O A;  2LD9 A;  3ZNZ B;  2Z0E B;  2JWZ A;  2VRR B;  2N7E A;  3DBL I;  3APD A;  2KC1 A;  4URK A;  2D2Q A;  2K39 A;  1IYF A;  4KZC A;  4KSL C;  4EUT A;  2WYQ A;  2Z0D B;  2GBN A;  2IZV B;  2JVC A;  4JIO U;  1UBQ A;  5TR5 A;  4F7Z A;  4XX5 A;  4MJS A;  2CR5 A;  2ZCC A;  4P7I A;  4N9F 4;  2NPT B;  3T9L A;  3VTW A;  3WAO A;  3AUL A;  2KKC A;  3DDC B;  3VHT C;  1WJN A;  2ZPN A;  2XK5 B;  4ANX A;  1E5W A;  3JSV A;  1I35 A;  1E7V A;  3A9K B;  1RRB A;  2JZ3 B;  4JQW C;  2JRH A;  3U8Z A;  1Z5S B;  1WF9 A;  2DZM A;  3NOB A;  1L7Y A;  4IM3 A;  4YL8 A;  3SU8 X;  4ZRJ A;  1E8X A;  2DHZ A;  2MW5 A;  4F1S A;  2EKE C;  4KIK B;  1WIA A;  4KZ0 A;  2KJH B;  2KQ7 A;  3L54 A;  1NDD A;  2IYD B;  2LRU A;  2LAS A;  2NCN A;  4GDK B;  4TV3 A;  2WWZ A;  5G2N A;  4IM2 A;  3L0W B;  4GDL B;  1G6J A;  3T8M A;  2CS4 A;  2C7M B;  2YVC A;  4W9J A;  5CHW A;  2LRW A;  2HE7 A;  3ZTD A;  2DYM A;  3QJZ A;  5G55 A;  5JH5 C;  3V6C B;  1P3Q U;  2FCS A;  5J2R A;  1XQQ A;  2LUE A;  3TJP A;  3R3M A;  1NBF C;  4JGH B;  2MCN B;  2FIF A;  4ICV A;  3GOE A;  1D3Z A;  4ZRK A;  3O65 B;  4K1R B;  1WM3 A;  2BF8 B;  3H7P B;  1XT9 B;  2DZI A;  3PVL A;  3PZD A;  4IG7 B;  3CST A;  2C9W B;  2MBB B;  1GG3 A;  1WMH B;  2O6V D;  1LM8 B;  3LDZ E;  1V6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...