2LGYA

Ubiquitin-like domain from hoil-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E3 ligase HOIL-1 Ubl domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgyA00
1ZW7A 3H7SA 5D2MB 1E7VA 3ZTDA 2RD0A 5DCNA 3MJWA 4AJWA 2BKFA 2HD5B 5AEKB 1HE8A 2KO3A 2JT4B 4GSWA 4A20A 3H1UA 2JVCA 2IO2B 3M63B 2KMAA 4GIVA 1V6EA 4BOZB 4TQ1A 2NBWB 1Q5WB 3D32A 3M3JA 1RAXA 4WWOA 1Q0WB 1LXDA 1WGDA 3OAWA 3SD5A 2MLBA 2O6VB 4PS7A 3EECA 4MGKE 3PS6A 2R2OA 2NBVB 4W9FA 2V1YA 1WXSA 4WWNA 1X1MA 4GDLA 2KWUB 2MW5A 2LI5A 1KOTA 3AI5A 4FJZA 2MQJA 3QHTA 2BF8B 4AWJA 2L05A 4MGIE 2FIDA 2AYOB 1RFAA 2MBEA 5CX3A 3UIOB 4E71A 2RPQA 5JH5C 1ZGUB 2KXJA 3HM3A 1UBIA 3JW0X 2KWCA 5E6OA 1IPGA 1WIAA 2MA9B 3ONSA 5L95C 3A1QB 1R4NI 2BYVE 2FCSA 2WX0A 3HIZA 2RSUA 2N1WA 5IAAC 4EEWA 1UBQA 1JRUA 2KTRA 5G55A 5LXHA 2N7DA 5C1ZA 2GBJA 2O2VB 4EZJA 1K8RB 4FHKA 1J19A 5C23A 4LJPB 4FBJB 2DHZA 3ALBA 4W9DA 2PE9A 1WJUA 2KK8A 4MGYE 2NS5A 3ZUNA 2CS4A 3N32A 4FHJA 2Y5BB 5CHFA 4FULA 1RLFA 5KHOA 3DPDA 2IZVB 5D6JB 2MCNB 2M4NA 3A9JA 4LDTB 3RT3B 2WDTB 3PLVA 4ICUA 1WMHB 3W1SA 1OTRB 4GGQA 1SGHA 2FCMA 3AXCA 4W9LA 1WJ4A 2IO3B 1E8ZA 2FCNA 3X23A 3H7PB 1R4MI 2IYDB 1WJ6A 3JYUA 1YX5B 1XT9B 2R2QA 4BKSD 4HCPB 3QARA 1GNUA 3CMMB 4GB9A 4IW0A 3JSVA 2BWFA 4IM3A 4PYZA 2UYZB 2ASQA 2V4LA 1V86A 1E8YA 2IY1B 1WZ3A 2KN5A 2DYMA 3NZSA 4WQOB 5FR6A 2AL6A 2L0TA 4G50A 1SIFA 3H7PA 4NAWB 4ZRIA 1LFDA 2L8JA 5CHWA 2C9WB 2C7NB 3VXWA 3NS8A 4HVBA 3IBEA 3NY5A 3V6EB 1F9JA 4KSKC 2LVOA 4TKNA 2LUEA 2HTHA 3VUWA 4KIKA 4CO7A 3ZVVA 1P1AA 2KDBA 2CHZA 5DPSA 2JPHA 3IG3A 1WE7A 1WXAA 2MSED 4FA6A 4AUQC 3ZNHB 1UH6A 2LRWA 4IWPA 3UF8A 3VTUA 3VVWB 4E74A 2DZMA 3NZUA 1WM2A 3DBHI 4HPLB 4MJSA 2BYFA 3NHEB 4KV2A 2KD0A 2N4FA 2XBBC 3KUCB 4M0WB 3WAOA 5DPRA 3QAQA 4DHJD 3RYTA 2N9PC 4KVGB 3I3TB 4MSQB 3UQBA 3PSEB 4HJKA 3ZW3A 4G0NB 4EUTA 2LZ6A 2MBOA 3BINA 1KJTA 3DCGA 3UINB 1Z5SB 2JRIB 5LLIA 2B3AA 3VAWA 4BKSA 2LGXA 1YJ1A 2MP2B 2ZVNA 3ECIA 4K1RB 1V49A 2O6VD 3APDA 4W9JA 1ISNA 1H8CA 4CHKA 5D94A 5L83A 4M8MA 4M8NA 4BKGA 4MJSB 3Q3JA 4IWQA 4ANVA 4MSMB 2HJ8A 3WIMA 3IFWB 3BY4B 3ENEA 3X0WA 1YIWA 3PHXB 1YD8U 2KC2A 2CU1A 4ZRJA 3W1SC 2RR9A 3U7DA 2LGYA 5LXIB 4MGZE 2EKEC 2D11A 1E8XA 3PVLA 3H6NA 3L0WB 3EC8A 1BT0A 3H9DA 4E3CA 1WYWB 3KW5B 3DVNV 4BBNC 4NNJB 5HKHA 4FLHA 2DYOA 3ML9A 2IY0B 4GN1A 1WR1A 2XK5B 2KLGA 3QJZA 2A5UA 4GDKA 1OEYJ 3QC8B 1UELA 3PPAA 4ASWC 3QCAA 3O65B 1ZKHA 3SU8X 4BBNF 2BPSA 1V2YA 1S3SG 2D3GA 4A3OA 4FJVB 1XQQA 3L54A 3C0RB 4W9IA 2DAJA 4CYEA 1J0GA 4LJOB 2V3SA 4N9F4 3VUYA 1D3ZA 4WJOA 2IO0B 2GMIC 4TQ0A 3L08A 5JZEB 5CTRC 1GJZA 3L13A 2JRHA 1GUAB 1E90A 2ZCBA 4I6PA 1NBFC 4WAAA 3WALA 4RM8A 1WMHA 3KUZA 4HDQA 2G4SA 3QWZB 3RD2A 4KZ0A 3ZKJC 3ZO5B 1OEYA 2RGFA 2DX5B 5DPTA 2K8CA 1WI0A 2ZCCA 1WFYA 2N9EB 3V62A 3A33B 4HXDA 2K8HA 3B1LX 3QA8A 3DVGY 2OJRA 2ZJDA 3WA0A 2DAFA 2YLMA 2IBIB 1V5TA 2EMTA 3A4RA 2LASA 2LRUA 2BWES 2KOXA 4NJ7A 3B08A 5D7GA 3ML8A 3T9LA 1A5RA 1I35A 2PE6B 2KX3A 2KX0A 2AEHA 2L3ZA 4ANXA 4IC7B 5E6PA 2MBBB 2K6QA 4WWPA 2HE7A 1WX7A 3PLUA 1P3QU 2I1KA 5AZHA 4HPMB 3R7RA 3Q3FA 2M0XA 4DHJB 2CR5A 2FNJB 2G4DB 4P7IA 2NR2A 3TBLD 3NOBA 2CHWA 5J18A 2CKHB 1WX9A 2CHXA 4JL9A 3ZDTA 2FIFA 2GBMA 2JZZA 2PJHA 2KFKA 3ZRCA 4F7ZA 1Z2MA 2J0MA 2NBUA 2ZPNA 4FN2A 2I1JA 1M94A 2K39A 5G2NA 2KJRA 2ZNVC 3PZDA 3SDLC 3P2BA 3KYCD 4DHZB 5AZGA 1E5WA 2MWSB 4NQLB 4K7SA 4WJNA 3VHTC 3KUDB 2YVCA 2KZRA 5CHVC 2LVQA 4B9KA 3W1YA 3AU5A 3DVGX 2AL3A 4EZLA 3PGEA 3UQAA 1WGRA 4G11A 2KDFB 5E6NA 1GC7A 5AZFA 1C1YB 2M17A 2N9XA 3DBSA 1V81A 4W9CA 1WGHA 4MELA 4B95A 2DZKA 3AULA 4G3XB 2NPTA 4AJYB 4W9GA 4ZYNA 1WX8A 1J8CA 2JZ3B 2KQSA 4DBGA 1TGZB 2XEWA 4AOFA 5DPWA 3KYDD 2K25A 2KANA 3GZNI 1WM3A 3JVZX 1YX6B 1L2NA 1S1QB 1WF9A 2KJHB 2MRPA 2J0KA 2L76A 2QHOA 4IM2A 2Z59B 4OVVA 4JQWC 5GMVA 3HHMA 1C3TA 3A4SC 4IG7B 3VUXA 4XZ4A 3A9KB 3DOWA 3M62B 2MP2A 1T0YA 1WY8A 2LXCA 4MH0E 4URKA 1Q1OA 2DZIA 5J2RA 1G6JA 3T8MA 2WWZA 4DXAB 3ZNGC 4KSLC 3LJ3A 4BFRA 3K9PB 3AU4A 4TUUA 3UGBB 1LM8B 3VH4B 1GC6A 4MEMA 2ZNVB 4EKUA 4JLCA 5IA7A 1WXMA 4KZCA 4F8CB 2NCNA 4KDLB 2MBQA 3B0AA 4NY0A 2JXXA 3ZNZB 4EOYA 4HLEA 3HM6X 3MHSD 4WJQA 3DBLI 1YQBA 3KVFB 4W9HA 2Z0DB 4J6IA 2PEAA 2FAZA 1TTNA 3UIPB 5J17A 4HK2A 3A9KA 4DK5A 5BO4B 1WH3A 2KDIA 2KJ6A 3TJPA 3ZDMC 3TIXA 4B6WA 1V80A 3RUIB 1H4RA 1WJNA 2ZVOA 4II3B 2KLCA 4WJPA 3SHQA 3OJ3A 1UZXB 3QK0A 4K81A 2BKRB 2L00B 3IHPC 2A4ZA 4W9KA 1EUVB 1WR6E 2NVUI 2LWPA 4ZDVA 3MTNB 2JWZA 1OGWA 1RRBA 1EO6A 2K8BA 1VD2A 2M1MA 1VCBA 2K6DB 1UGMA 2ZPYA 1PQSA 3N30A 4ICVA 4RM9A 4FJYA 3L17A 3WANA 1V5OA 3N3KB 3RZFA 3VFKA 1WRDB 2VRRB 1FXTB 4GOCA 4GXBA 1E7UA 1EF1A 3IVFA 4NJ6A 4NPNA 1XD3B 2GOWA 4GDKB 2K1FA 4DDGD 1UD7A 2C60A 2PPHA 5TR5A 3OLMD 3WAMA 2KVRA 3ZLZA 2DZJA 2LVPA 3PREA 4ANUA 3VTWA 2N1VA 2G45B 4KDIC 4NAWA 4YL8A 3L16A 4LDTD 2NPTB 1NDDA 1I42A 3DBRI 2FUHB 2KTFA 2L7RA 3DQVA 1NI2A 4EZKA 2LXAA 4W9EA 1WE6A 2C5LC 3ZRFA 4BOSC 2LGDA 2UWQA 3VDZA 3S2AA 3CF6E 2BGFA 4ZRKA 1P98A 3HK0A 2JUOA 2N7EA 4TV3A 2WX1A 4AP4C 1TZ1A 3EFUA 3K9OB 3PV1A 3PTFC 2KQ7A 3PT2B 4GU2A 1P0RA 2OOBB 2KDEB 4A3PA 4EFOA 2KTRB 4FADA 1E8WA 2DYBA 3RULA 2KWVB 1SE9A 3EHVA 3LDZE 3PHWB 3R3MA 1IP9A 2REXA 3A9JB 4OVUA 3APFA 3ZIMA 1MG8A 1P9DU 2GBKA 4HWIB 1Y8RC 1GG3A 1WGGA 1WZ0A 3A1QA 3DDCB 3QX1A 2KC1A 2D2QA 2M8SA 2L0FA 3TL5A 1WXVA 3RZWC 4RMAA 4K7WA 2KKCA 4I6LB 3M95A 2KFKB 3TMPB 1KM7A 5EDSA 4XX5A 1V9JA 3RCZA 2KNBA 3U8ZA 3V61A 2DENB 2GBRA 2IO1B 3PRMB 2GBNA 3V60A 2O2VA 3WAPA 3R7QA 4GDLB 3ZNID 2FCQA 2ZZPB 4K7UA 2D07B 1TBEA 3GOEA 2C7MB 4DHZE 4PYUA 2O6VA 3APCA 3VH3B 5JHBA 4HCNB 4KIKB 4II2B 1KLVA 4MDKE 1U4AA 3CSFA 2LD9A 5JHAA 2J0JA 2ZEQA 2G3QB 2WYQA 3V6CB 2W9NA 4IM0A 3KH0A 4PS8A 2KFJA 2MBHA 4MM3A 4PS3A 4GMVA 3TCAA 4BKTA 4JIOU 3PRPB 4HDOA 3VTVA 3L10B 2C7HA 3VQIA 1EF5A 4IWOA 3U30A 1CMXB 4DDID 4IUMB 2XK5A 2JF5A 4NQKE 2LJ5A 4DWFA 3QIJA 2MX2A 2Z0EB 2D10A 1QZEA 3PRZA 4F1SA 5KHQA 2J7QB 2AWTA 1OQYA 1WGYA 2BYEA 2KHWB 3ZTCA 3QQ8B 4X57B 4ANWA 1IYFA 2EMSA 3CSTA 1LQBA 4I6NB 2JY6A 3OJ4B 3JSVB 3DVNU 3R66C 2KMCA 1AARA 4JGHB 4LCDE 4XC2A 4BVUC 1L7YA
chains in the Genus database with same CATH superfamily
1PGAA 1ZW7A 5D2MB 2WGSA 2QEJC 5DCNA 2BKFA 2RDGA 3RFZB 1HE8A 2KO3A 2WXJA 3DBLB 3H1UA 2JVCA 3M63B 4GIVA 4BOZB 2J52A 4TQ1A 3D32A 4MT5A 1RAXA 2WXNA 2MLBA 4BZAA 2R2OA 2V1YA 3NZ3A 2WLBA 3QHTA 4AWJA 2L05A 4E71A 1KRHA 3NVZA 5LXHA 2OEDA 5FR3A 2WU5B 4EZJA 1I4XA 1K8RB 3KLSX 1J19A 4LJPB 1E0ZA 2KK8A 2MH7A 2WHIA 2NS5A 1AWDA 3N32A 1QLBB 1MI0A 3O13A 3DPDA 3A9JA 4LDTB 2WDTB 3W1SA 4GGQA 1MHXA 3R2IA 2WQYB 2IJ0A 4US9A 1GNUA 3CMMB 4ZHOA 4IM3A 2UYZB 4ACFA 2V4LA 2KN5A 2Y5CA 3KWVA 4B0MA 2AL6A 3GB1A 4G50A 1C4CA 3NVVA 3VXWA 4AQ7A 3V6EB 4KSKC 2LVOA 4TKNA 1TKYA 4KIKA 4CO7A 1KTKA 2CHZA 5DPSA 2XNAC 3FKYA 3DHHC 4FA6A 4AUQC 1CK1A 4IWPA 3UF8A 4M02A 3VTUA 3PZ8A 4KV2A 4DHJD 3I3TB 4ZYSA 4HJKA 4DQOC 2LZ6A 5BYSA 1KJTA 4ITKA 1Z5SB 2JRIB 3IXSA 4JPSA 4BKSA 3B2FA 1QOFA 3MC9A 4K1RB 2QSDA 4JWSC 1H8CA 3RNBC 4BKGA 1NI3A 4ANVA 2WNMA 4NZLB 4MSMB 3BY4B 3ENEA 5C3JB 2CU1A 2QIEB 2KDMA 4BAXA 3TEZA 1UGJA 1WYWB 3KW5B 3DVNV 1JALA 1P7FA 1DYQA 2KLGA 1OEYJ 4ASWC 1L0VB 4M00A 2WXRA 3LXFA 2BPSA 1TJEA 1S3SG 3Q8CA 3HRDD 4FJVB 1IGCA 3L54A 1C76A 4ARIA 3AH7A 2W82A 4WJOA 4I6PA 1E90A 2BS3B 1NBFC 1TIFA 1XF5L 2KYWA 4RM8A 1PGBA 2E6XA 4HDQA 3QWZB 3I9V1 3ZO5B 2J53A 4FXCA 1M4VA 2DBYA 3W9CB 3CWIA 3DVGY 1QOAA 3WA0A 2YLMA 4A9AA 2LRUA 3B08A 2BYTA 2PE6B 2AEHA 2L3ZA 4R3DA 4IC7B 2MBBB 2I1KA 4C7ZA 1ESFA 3R7RA 1YN5A 1B9RA 1L6UA 2L1AA 2CKHB 4JL9A 2BTEA 5MPOA 3ZRCA 2J0MA 2NBUA 3Q3OC 4IKGA 1M94A 2QCZA 5G2NA 3SDLC 2MWSB 3ZXVA 5BMHA 3KUDB 2YVCA 3W1YA 4KGRA 4EZLA 2KDFB 5E6NA 5IOIA 4IDIA 3OWEB 1V81A 4B95A 3C19A 2IGGA 2KMMA 2DZKA 3ZYYX 4G3XB 1L0YB 2YEPB 5HI1A 1WX8A 1T0QC 1TGZB 5DPWA 2K25A 2KANA 1L2NA 4MH8A 3TSSA 1SSNA 2VZKB 1PGXA 4JQWC 3IT6B 4MACA 1C3TA 3A4SC 4IG7B 3HVDA 3VUXA 1QF6A 1C77A 2LXCA 1WY8A 1F0ZA 1Q1OA 2DZIA 5J2RA 2JSVX 4O1NA 2LUMA 1YQ3B 3AEDB 3N1XC 3AU4A 3UGBB 3VH4B 2ZNVB 2WDVB 2MBQA 4HLEA 3HM6X 4WJQA 1MJDA 2UU7A 4W9HA 5J17A 4RF1A 4DK5A 5BO4B 1WH3A 4B6WA 1H4RA 5EE1A 3Q3MC 2SAKA 2KLCA 4N6EB 4K81A 2L00B 1HZ6A 3SR6A 1DGJA 2KVZA 1EUVB 2LWPA 3DBHB 2N9LA 4KGTA 1OGWA 2WXHA 3B2GA 1VD2A 3NVWA 1UGMA 1PQSA 3N30A 1F1HA 3DHIC 4YSYB 3RZFA 1DOIA 1FXTB 4GXBA 1EF1A 1MG4A 4NPNA 1XD3B 1UD7A 2EELA 2PPHA 2KVRA 3RNEC 4CQNA 1I42A 3ZQ4A 2C5LC 3ZRFA 4L2YA 2LGDA 2UWQA 3VDZA 3S2AA 1QILA 4LNOA 1YJJA 3EFUA 3PTFC 4GU2A 1P0RA 2M19A 2D3AA 2KTRB 4FADA 3RULA 4LK0M 3EHVA 1IP9A 3A9JB 4OVUA 3APFA 3ZIMA 4PK1A 1FIQA 2GBKA 4RFBA 2L83A 1GG3A 1WZ0A 4YXDB 3AE5B 1L0XB 2L0FA 4RMAA 4K7WA 3M95A 1FPYA 5EDSA 4XX5A 1FNUA 3RCZA 2GBNA 3WAPA 3R7QA 4K7UA 3GOEA 1QT9A 4DHZE 2O6VA 2HJ1A 2H88B 2WYQA 1T6BX 3DWGC 2MBHA 4N59A 4MM3A 3TCAA 4BKTA 3PRPB 3VRAB 1MFWA 1XLQA 1K53A 4HRSA 1EF5A 3VQIA 3U30A 1SIJA 3C8YA 2VZKD 3MC0B 1AW7A 3SFDB 3PRZA 2J7QB 1OQYA 2WXIA 4ANWA 1IYFA 1VZ6A 2K9XA 4B0EA 3TL5A 3R66C 2KMCA 4LCDE 3AE9B 1E7VA 3ZTDA 1NENB 4LNFA 3NVYA 1Q5WB 2KQ4X 3IAS1 3M3JA 3N1ZC 1WGDA 3OAWA 2O6VB 4PS7A 3EECA 4MGKE 2RDBC 2W55A 4W9FA 3R8BA 4WQMA 1X1MA 2KWUB 1N61A 3AI5A 4FJZA 2AYOB 2MBEA 1ZGUB 2KXJA 3HM3A 5AUKA 2I38A 1IPGA 1FXAA 1WIAA 2MA9B 2QJLA 1AN8A 3A1QB 2BYVE 2WX0A 3BVMA 5HHDG 2D5GA 5IAAC 1YN4A 2JZPA 2XN9C 2EKIA 1EU3A 5G55A 2N7DA 1FRRA 3P42A 2JWUA 1HTOA 5C23A 2DWQA 5I4DA 1L6VA 4A8XC 4P16A 4MGYE 2Y5BB 5HFYA 3RNCC 4YSZB 1PFDA 2TSSA 2AQ3B 3ETRA 1KLGD 4W9LA 3ABVB 4OW0A 2VH1A 1WJ4A 1WGKA 2IO3B 4PT5A 2W54A 1ZUD2 3X23A 3JYUA 1YX5B 2LHDA 1TY0A 4BKSD 2PKOA 4D2KA 2N9KA 1SB3C 2RPVA 4GB9A 2KAJA 4IW0A 2BWFA 3BYYB 4YTNB 1WZ3A 2DYMA 4ZRIA 4A55A 4P6VF 2QDFA 1D5ZC 1DOXA 3NS8A 3IBEA 3NY5A 3I63C 5H8YE 2JU6X 2KDBA 1CQVA 1WXAA 2MSED 3ZNHB 5FK9C 2DZMA 4QAYA 4MJSA 2BYFA 2KD0A 3KUCB 4M0WB 2ACZB 4XDCA 5DPRA 3QAQA 2B76B 2JYTA 5G5GA 4EUTA 1IGDA 3P1MA 1JW9D 3DCGA 5LLIA 3AE6B 3AMZA 1D5MC 1YJ1A 2LGXA 1BXTA 1V49A 1PYWD 4MJSB 2PLPA 4IWQA 2HJ8A 3IFWB 2WXKA 1YIWA 1YD8U 4ZRJA 3U7DA 2LGYA 5LXIB 3FC4A 3L0WB 2ONQA 3H9DA 4E3CA 4BBNC 4NNJB 2DYOA 5E6JA 1WR1A 2IGDA 2XK5B 4C4VA 1R4NB 1OQRA 5EE3A 1ZKHA 3SU8X 1E9MA 4BBNF 1V2YA 2D3GA 4OZCA 3SFEB 3EA6A 3HUIA 5IN7A 4N9F4 2L52A 3VUYA 2GMIC 4TQ0A 3L08A 1AYFA 5FKAC 1V1PB 5JZEB 1GJZA 1GUAB 3WALA 4KGSA 1WMHA 2G4SA 4KZ0A 1OEYA 2RGFA 1XEEA 1WI0A 1WFYA 2N9EB 3V62A 1NYQA 4WH4A 2K8HA 3B1LX 2OJRA 2EMTA 2BWES 5D7GA 3TEWA 1I35A 1ET6A 1A5RA 3ML8A 4RNAA 5E6PA 2K6QA 4WWPA 1WX7A 1KH0A 5AZHA 2NTSA 2M0XA 2Q5WD 3I57A 2CR5A 5J18A 2CHXA 3ZDTA 2FIFA 2GBMA 4K3BA 4F7ZA 3AEGB 4FN2A 4WWMA 1GAQB 4C80A 3PZDA 1V8CA 2BBCA 4NQLB 1EM7A 3BIID 3Q2AC 5IP4D 4OZBA 3AE8B 3AU5A 1HA5A 3PGEA 3UQAA 1WGRA 2K22A 4G11A 1TS2A 5AZFA 1GC7A 2M17A 2N9XA 1L4DB 2WXQA 1FNWA 4MELA 1C79A 5BYRA 5AUIA 2NPTA 4W9GA 4DBGA 2BW2A 3GZNI 1WM3A 3BYTB 3MFGA 1L5PA 3HHMA 1FM0D 1NVID 4XZ4A 2V3NA 4C56C 1T0YA 4URKA 2JX5A 2LFIA 2FUG1 1G6JA 4DXAB 3CIRB 3LJ3A 3UI3A 2BS2B 3K9PB 5BMIA 1C4PA 4MEMA 2INNE 4JLCA 5IA7A 4F8CB 4KZCA 3EFCA 1K50A 3ZNZB 4EOYA 2JXXA 1JWMD 2LMCA 1UNSA 1I4QA 4HK2A 3VRBB 1OQQA 3MC8A 1STEA 3ZDMC 1V80A 1WJNA 3QK0A 1ACCA 3IHPC 4W9KA 2DNFA 3E9SA 3MTNB 4RCOA 1ZXIA 1EO6A 1QQRA 4N58A 2MHJA 2QC8A 2V3PA 1CZPA 3WANA 1FCCC 1WRDB 1J7CA 4GOCA 1E7UA 3IVFA 4NJ6A 2GOWA 4GDKB 4US8A 2K1FA 2CJOA 2C60A 3OLMD 3ZLZA 4ANUA 2PIAA 3PREA 1VZ7A 4LDTD 3DBRI 2KTFA 2LHEA 2LXAA 1T5XD 3W2DA 4BOSC 1C78A 3CF6E 2BGFA 4ZRKA 1P98A 2JUOA 2GI9A 2WX1A 3AEFB 3PV1A 3PT2B 4EFOA 2W3SA 3AM9A 2JXTA 1E8WA 2W3RA 3LDZE 2REXA 2Y5PA 1MG8A 1P9DU 3QX1A 2KC1A 4RH6A 2G9HD 1ZPSA 1WXVA 3U4EG 2KKCA 4I6LB 4XYCA 2KFKB 3V61A 2KNBA 3U8ZA 2DENB 3PRMB 3V60A 2FCQA 2D07B 1TBEA 1TT5B 1IBXB 4HCNB 4II2B 2CU3A 3H8HA 4MDKE 3CSFA 2LD9A 5JHAA 3NS1A 2J0JA 2WP9B 2ZEQA 2G3QB 4REZA 4EE2A 2W9NA 4IM0A 3AEAB 1WRIA 3VTVA 4IWOA 1JCKB 1R7SA 3MP9A 2WDRB 2JF5A 3ZJTA 2Z0EB 2D10A 1FD6A 2KWDA 1YMHE 4F1SA 2AWTA 2Y3AA 3ZTCA 2Z8LA 3JSVB 2KJRA 1YOVB 1XO3A 1L7YA 2RD0A 4AJWA 2JT4B 4A20A 3HVZA 4XWWA 2BB6A 2KMAA 1V6EA 3VR9B 3ZGZA 2NBWB 3AE1B 1LXDA 2AQ1B 3PS6A 1FO4A 4WWNA 4M01A 4GDLA 2MW5A 2PMVA 2BF8B 2CJNA 4MGIE 2FIDA 1RFAA 1YN3A 2MJDA 3JW0X 1UBIA 2KWCA 1YNTE 3BWUD 2RSUA 2N1WA 1E6EB 4RGOS 1GPXA 1RWSA 1UBQA 1JRUA 3Q14C 1IBXA 1RFKA 4JE3B 4WAFA 5C1ZA 2O2VB 3TEXA 3ALBA 4W9DA 2PE9A 3ZUNA 3URYA 4FHJA 2HTME 1RLFA 5KHOA 2IZVB 5IO9A 2M4NA 3RT3B 4ICUA 3AN1A 4YTPB 1F2RI 1SGHA 2FCMA 3AXCA 1JQ4A 1HTQA 1C4AA 3H7PB 2PW9A 2IYDB 1WJ6A 1XT9B 2R2QA 1VLBA 3V3XA 1ENFA 3TUOA 4ZHPA 3JSVA 4PYZA 2IY1B 1L4ZB 4WQOB 1SIFA 1LFDA 5CHWA 2C9WB 2C7NB 2HTHA 3VUWA 1JWBD 1ZXHA 3ZVVA 1J7AA 3IG3A 1WE7A 1UH6A 2LRWA 3ZJUA 3NZUA 1WM2A 5JXVA 5G5HA 3NHEB 4USAA 1GOZA 4JX1C 4XDDA 2K5PA 4XWTA 2N4FA 2N9PC 3W5VB 4MSQB 1KFYB 3ZW3A 4G0NB 2MBOA 3UINB 3VAWA 2B3AA 1DOYA 1V97A 2ZVNA 2D3BA 3APDA 1ISNA 1KLUD 5D94A 4M8MA 4M8NA 2IGHA 3WIMA 3X0WA 3PHXB 2KC2A 1HZ5A 2RR9A 4MGZE 2EKEC 1E8XA 3PVLA 3EC8A 1ZOYB 2OHFA 5HKHA 4FLHA 4GN1A 4P1BC 5D3IB 2A5UA 4GDKA 3QC8B 3B9JA 3PPAA 1WXQA 3Q8EA 4YTMB 3AE2B 4DXFA 3C0RB 4W9IA 2DAJA 4CYEA 2H89B 3KQ4A 1D5XC 1D3ZA 2MEKA 1NEKB 2IO0B 3U7ZA 2JRHA 5EE9A 3RD2A 3ZKJC 2DX5B 5DPTA 1TY2A 2K8CA 3A33B 4HXDA 1FNVA 3QA8A 2INCC 2DAFA 2J4XA 2IBIB 1V5TA 4NJ7A 1I4RA 1ROEA 4ANXA 1ZE3D 5C2TB 2HE7A 3PLUA 1P3QU 4HPMB 2G4DB 1VR9A 1UWXA 4HEA1 2WXGA 3TBLD 3NOBA 1A70A 1WX9A 3GS2A 2PJHA 1PUTA 2KFKA 3DBRB 1XLPA 3AECB 3AB5A 2ZPNA 3U52E 4OVZA 1K52A 3IAM1 3L4PA 3Q8FA 2I1JA 1FEHA 1RYJA 2YEPF 2RDHA 4L1BA 5AZGA 1E5WA 3AEBB 4K7SA 4WJNA 3W5UB 5CHVC 2BVCA 2JYEA 2LGSA 2AL3A 3KWLA 4ZRPA 2WXMA 4RGNA 4W9CA 3TEYA 3Q3NC 1FXIA 4ZRQA 1TS3A 3AULA 4AJYB 4ZYNA 2KQSA 2XEWA 3KYDD 3JVZX 1YX6B 1WF9A 2KJHB 2MRPA 3NRZA 1TKEA 2J0KA 2K0PA 2L76A 4OVVA 4HJGE 4HKZE 3FILB 3A9KB 3M62B 3BK1A 2N7JA 4LNKA 1I4HA 4NAMA 4EKUA 5EE0A 1WXMA 4KDLB 1JWAD 2QILA 3DBLI 1HEZE 3Q6BA 2Z0DB 2PEAA 3UIPB 1TTNA 4LNNA 3GZNB 3A9KA 2KDIA 2KN4A 1UUPA 2LEKA 2ZVOA 4II3B 3P4PB 3SHQA 3OJ3A 5H92C 2A4ZA 1N5WA 3P63A 3AEEB 1WSPA 2K6DB 2ZPYA 1QOGA 4RGTA 3L17A 1V5OA 2WS3B 2OJWA 2BB5A 3VFKA 1BUIC 3AE3B 3FILA 1SE3A 2KACA 1ZP0B 5TR5A 1KF6B 1V1PA 3WAMA 3NUHB 3ZJVA 3L16A 4LNIA 1NDDA 2KT7A 2V0GA 1UF0A 3GE3C 1NI2A 4W9EA 2HDEA 3ZXRA 1I7HA 3P4QB 1JRPA 2N7EA 4AP4C 1TZ1A 1T3QA 3K9OB 3MJ5A 2OOBB 2KDEB 4A3PA 3BVGA 1D4BA 2PTLA 3N1YC 3PHWB 4HWIB 1WGGA 2GLSA 4A6QA 1XLOA 3DDCB 2FE8A 2D2QA 4H2AA 3RNFC 3RZWC 2INPE 1KM7A 1V9JA 2GBRA 1SF0A 4GDLB 3ZNID 2ZZPB 1TS4A 2NTTA 5JHBA 3PO0A 1KLVA 1HQRD 1U4AA 4LLGM 3AE4B 2KFJA 4PS3A 4GMVA 4JIOU 4HDOA 1JROA 1P7EA 1EU4A 5BMGA 2C7HA 4C7YA 1TZOA 4AS1A 2G1EA 2BS4B 4DWFA 1Q10A 2MX2A 3PZ7A 2RMMA 5KHQA 2BYEA 2KHWB 1XCQL 3CSTA 2JY6A 4XC2A 1AARA 4JGHB 5HG2A 1N5XA 2AQ2B 3H7SA 2SEBD 3MJWA 4MM3B 2HD5B 5AEKB 4A90A 3EUB2 1PDXA 1K51A 4GSWA 3VR8B 4UDUC 1C9FA 2IO2B 1YQ4B 4WWOA 1Q0WB 1V1OA 3SD5A 3RNAC 5TSSA 2NBVB 1WXSA 4WIPA 2LI5A 1KOTA 2MQJA 1E7PB 5CX3A 3UIOB 2RPQA 5JH5C 3WCQA 2QMTA 5E6OA 3ONSA 5L95C 1I4PA 2LJIA 3I5JC 1R4NI 5IKCM 2FCSA 4ARCA 3HIZA 2IPKD 3E56A 4EEWA 5D3DA 2I2YA 3GP7A 4P1CC 2KTRA 1FMAD 1SXTA 2GBJA 4C00A 4FHKA 3T3NA 4FBJB 2DHZA 4M0WA 1ET9A 1WJUA 1CJEA 2MJ3A 2CS4A 5CHFA 1BMLC 4FULA 3P4SB 3U2SC 2V9HA 5D6JB 2MCNB 3PLVA 1WMHB 4LTUA 3P4RB 1OTRB 1SE2A 2N0SB 2ZW0A 1E8ZA 2FCNA 1R4MI 2INDC 2IDYA 4HCPB 3BZDB 4HKQA 3QARA 1N60A 4XGAB 2ASQA 3N20C 1V86A 1E8YA 4J3OD 5FR6A 3NZSA 1Y56A 2L0TA 3H7PA 4NAWB 2L8JA 2BT6A 1VZ8A 4WURA 4HVBA 1F9JA 2BQQA 2LUEA 3BVZA 1P1AA 2JPHA 4E74A 3VVWB 4HPPA 4HPLB 3DBHI 2ICIA 1I4GA 4HROA 1SJED 4K3CA 2XBBC 3WAOA 1FRDA 4L23A 3NG0A 3IT4B 3RYTA 1R4MB 4KVGB 3UQBA 3PSEB 1SBBB 1N63A 2GRIA 1UWMA 2V4IB 2X8XX 1WWTA 3BINA 4KX6B 2MP2B 3ECIA 2O6VD 1IUEA 1OFFA 4W9JA 1VJKA 4CHKA 5L83A 3NJTA 1N6ZA 3Q3JA 1WYGA 3AE7B 3W1SC 2PVOD 4JWUC 2D11A 3H6NA 4ZOHC 1MPEA 1BT0A 5LNK1 1XCTL 3ML9A 2IY0B 3QJZA 1UELA 1GB1A 3QCAA 3O65B 1D6EC 4RF0A 4A3OA 1XQQA 1J0GA 4LJOB 2V3SA 1TKGA 3SEBA 2AX5A 2VH2A 5CTRC 1LGRA 3L13A 2ZCBA 4WAAA 2WDQB 3KUZA 3Q8AA 2ZCCA 4XE0A 1EWYC 2ZJDA 2M0AA 3DWMA 1HXYD 3A4RA 2LASA 2KOXA 3T9LA 5GXGB 2KX3A 2KX0A 2FBWB 3Q3FA 4DHJB 2FNJB 1JMLA 4P7IA 2NR2A 2CHWA 1EWCA 2NMQA 1T0SC 2ON8A 2JZZA 1MVKA 3OG5A 1Z2MA 4S17A 2PVGC 3FAHA 5BYQA 1RM6C 4Q2JA 2WXPA 2K39A 3AV8A 2ZNVC 1F52A 3P2BA 3KYCD 4DHZB 2WXOA 3VHTC 4OHJA 2KZRA 2LVQA 4B9KA 1ZDXA 3DVGX 1FCLA 2X38A 1VDVA 2WXLA 1C1YB 3DBSA 1J7BA 3RN9C 1WGHA 3T3OA 1JWSD 4RGMA 4OZAA 3EGRA 4DXGA 1J8CA 2JZ3B 4AOFA 1SEBD 1S1QB 2QHOA 4IM2A 3DHGC 2M56B 2Z59B 5GMVA 1T0RC 1QOBA 3DOWA 1MHHE 2MP2A 2E3TA 2R61A 4MH0E 3T8MA 2WWZA 3ZNGC 1XLNA 1E10A 3R2TA 4KSLC 4BFRA 1FFUA 4TUUA 2JQRB 1LM8B 1GC6A 4YWGG 4GLSC 1GB4A 2D3CA 2NCNA 4NY0A 3B0AA 1QKZA 3MHSD 1YQBA 3KVFB 4NJCA 4J6IA 2FAZA 3LYYA 1JWUD 3N9YC 2DLBA 2KJ6A 3TJPA 3RNGC 3TIXA 3RUIB 3Q8BA 4WJPA 1UZXB 2BKRB 1WR6E 1YJIA 2NVUI 4ZDVA 1SE4A 2JWZA 2L32A 1RRBA 4IOIE 2K8BA 3RMKC 2M1MA 1VCBA 4ICVA 4RM9A 1SJHD 4FJYA 3N3KB 2K3UA 4KKJA 5T8IA 2VRRB 3BK2A 1XXGA 4DDGD 4YT0B 2DZJA 2LVPA 3VTWA 2N1VA 2G45B 4KDIC 4NAWA 4YL8A 2NPTB 4TMAB 2FUHB 2L7RA 3DQVA 4EZKA 1WE6A 1FFVA 1TYGB 3MHZA 3HK0A 4TV3A 2J42A 3J9CA 2KQ7A 2DYBA 2KWVB 1SE9A 3R3MA 1Y8RC 3A1QA 3GE8C 2M8SA 3V05A 4S0RA 4YSXB 1B1ZA 4KKIA 1F77A 3TMPB 2IO1B 2LGIA 2O2VA 2C7MB 4PYUA 3APCA 3VH3B 2MJEA 4KIKB 1NYRA 1N62A 2GB1A 1TS5A 4TSSA 2WU2B 3V6CB 3KH0A 4PS8A 3L10B 3RI7C 1LO5D 2WXFA 3Q69A 1CMXB 4DDID 4IUMB 2ZW1A 2XK5A 4C4VB 3RPFC 4NQKE 2LJ5A 3QIJA 1VRAB 1ZDVA 1F2RC 1QZEA 1WGYA 3QQ8B 4X57B 2EMSA 1LQBA 4I6NB 3OJ4B 3DVNU 3LB8C 4BVUC
chains in the Genus database with same CATH topology
1ZW7A 3H7SA 5D2MB 1E7VA 3ZTDA 2RD0A 5DCNA 3MJWA 4AJWA 2BKFA 2HD5B 5AEKB 1HE8A 2KO3A 2JT4B 4GSWA 4A20A 3H1UA 2JVCA 2IO2B 3M63B 2KMAA 4GIVA 1V6EA 4BOZB 4TQ1A 2NBWB 1Q5WB 3D32A 3M3JA 1RAXA 4WWOA 1Q0WB 1LXDA 1WGDA 3OAWA 3SD5A 2MLBA 2O6VB 4PS7A 3EECA 4MGKE 3PS6A 2R2OA 2NBVB 4W9FA 2V1YA 1WXSA 4WWNA 1X1MA 4GDLA 2KWUB 2MW5A 2LI5A 1KOTA 3AI5A 4FJZA 2MQJA 3QHTA 2BF8B 4AWJA 2L05A 4MGIE 2FIDA 2AYOB 1RFAA 2MBEA 5CX3A 3UIOB 4E71A 2RPQA 5JH5C 1ZGUB 2KXJA 3HM3A 1UBIA 3JW0X 2KWCA 5E6OA 1IPGA 1WIAA 2MA9B 3ONSA 5L95C 3A1QB 1R4NI 2BYVE 2FCSA 2WX0A 3HIZA 2RSUA 2N1WA 5IAAC 4EEWA 1UBQA 1JRUA 2KTRA 5G55A 5LXHA 2N7DA 5C1ZA 2GBJA 2O2VB 4EZJA 1K8RB 4FHKA 1J19A 5C23A 4LJPB 4FBJB 2DHZA 3ALBA 4W9DA 2PE9A 1WJUA 2KK8A 4MGYE 2NS5A 3ZUNA 2CS4A 3N32A 4FHJA 2Y5BB 5CHFA 4FULA 1RLFA 5KHOA 3DPDA 2IZVB 5D6JB 2MCNB 2M4NA 3A9JA 4LDTB 3RT3B 2WDTB 3PLVA 4ICUA 1WMHB 3W1SA 1OTRB 4GGQA 1SGHA 2FCMA 3AXCA 4W9LA 1WJ4A 2IO3B 1E8ZA 2FCNA 3X23A 3H7PB 1R4MI 2IYDB 1WJ6A 3JYUA 1YX5B 1XT9B 2R2QA 4BKSD 4HCPB 3QARA 1GNUA 3CMMB 4GB9A 4IW0A 3JSVA 2BWFA 4IM3A 4PYZA 2UYZB 2ASQA 2V4LA 1V86A 1E8YA 2IY1B 1WZ3A 2KN5A 2DYMA 3NZSA 4WQOB 5FR6A 2AL6A 2L0TA 4G50A 1SIFA 3H7PA 4NAWB 4ZRIA 1LFDA 2L8JA 5CHWA 2C9WB 2C7NB 3VXWA 3NS8A 4HVBA 3IBEA 3NY5A 3V6EB 1F9JA 4KSKC 2LVOA 4TKNA 2LUEA 2HTHA 3VUWA 4KIKA 4CO7A 3ZVVA 1P1AA 2KDBA 2CHZA 5DPSA 2JPHA 3IG3A 1WE7A 1WXAA 2MSED 4FA6A 4AUQC 3ZNHB 1UH6A 2LRWA 4IWPA 3UF8A 3VTUA 3VVWB 4E74A 2DZMA 3NZUA 1WM2A 3DBHI 4HPLB 4MJSA 2BYFA 3NHEB 4KV2A 2KD0A 2N4FA 2XBBC 3KUCB 4M0WB 3WAOA 5DPRA 3QAQA 4DHJD 3RYTA 2N9PC 4KVGB 3I3TB 4MSQB 3UQBA 3PSEB 4HJKA 3ZW3A 4G0NB 4EUTA 2LZ6A 2MBOA 3BINA 1KJTA 3DCGA 3UINB 1Z5SB 2JRIB 5LLIA 2B3AA 3VAWA 4BKSA 2LGXA 1YJ1A 2MP2B 2ZVNA 3ECIA 4K1RB 1V49A 2O6VD 3APDA 4W9JA 1ISNA 1H8CA 4CHKA 5D94A 5L83A 4M8MA 4M8NA 4BKGA 4MJSB 3Q3JA 4IWQA 4ANVA 4MSMB 2HJ8A 3WIMA 3IFWB 3BY4B 3ENEA 3X0WA 1YIWA 3PHXB 1YD8U 2KC2A 2CU1A 4ZRJA 3W1SC 2RR9A 3U7DA 2LGYA 5LXIB 4MGZE 2EKEC 2D11A 1E8XA 3PVLA 3H6NA 3L0WB 3EC8A 1BT0A 3H9DA 4E3CA 1WYWB 3KW5B 3DVNV 4BBNC 4NNJB 5HKHA 4FLHA 2DYOA 3ML9A 2IY0B 4GN1A 1WR1A 2XK5B 2KLGA 3QJZA 2A5UA 4GDKA 1OEYJ 3QC8B 1UELA 3PPAA 4ASWC 3QCAA 3O65B 1ZKHA 3SU8X 4BBNF 2BPSA 1V2YA 1S3SG 2D3GA 4A3OA 4FJVB 1XQQA 3L54A 3C0RB 4W9IA 2DAJA 4CYEA 1J0GA 4LJOB 2V3SA 4N9F4 3VUYA 1D3ZA 4WJOA 2IO0B 2GMIC 4TQ0A 3L08A 5JZEB 5CTRC 1GJZA 3L13A 2JRHA 1GUAB 1E90A 2ZCBA 4I6PA 1NBFC 4WAAA 3WALA 4RM8A 1WMHA 3KUZA 4HDQA 2G4SA 3QWZB 3RD2A 4KZ0A 3ZKJC 3ZO5B 1OEYA 2RGFA 2DX5B 5DPTA 2K8CA 1WI0A 2ZCCA 1WFYA 2N9EB 3V62A 3A33B 4HXDA 2K8HA 3B1LX 3QA8A 3DVGY 2OJRA 2ZJDA 3WA0A 2DAFA 2YLMA 2IBIB 1V5TA 2EMTA 3A4RA 2LASA 2LRUA 2BWES 2KOXA 4NJ7A 3B08A 5D7GA 3ML8A 3T9LA 1A5RA 1I35A 2PE6B 2KX3A 2KX0A 2AEHA 2L3ZA 4ANXA 4IC7B 5E6PA 2MBBB 2K6QA 4WWPA 2HE7A 1WX7A 3PLUA 1P3QU 2I1KA 5AZHA 4HPMB 3R7RA 3Q3FA 2M0XA 4DHJB 2CR5A 2FNJB 2G4DB 4P7IA 2NR2A 3TBLD 3NOBA 2CHWA 5J18A 2CKHB 1WX9A 2CHXA 4JL9A 3ZDTA 2FIFA 2GBMA 2JZZA 2PJHA 2KFKA 3ZRCA 4F7ZA 1Z2MA 2J0MA 2NBUA 2ZPNA 4FN2A 2I1JA 1M94A 2K39A 5G2NA 2KJRA 2ZNVC 3PZDA 3SDLC 3P2BA 3KYCD 4DHZB 5AZGA 1E5WA 2MWSB 4NQLB 4K7SA 4WJNA 3VHTC 3KUDB 2YVCA 2KZRA 5CHVC 2LVQA 4B9KA 3W1YA 3AU5A 3DVGX 2AL3A 4EZLA 3PGEA 3UQAA 1WGRA 4G11A 2KDFB 5E6NA 1GC7A 5AZFA 1C1YB 2M17A 2N9XA 3DBSA 1V81A 4W9CA 1WGHA 4MELA 4B95A 2DZKA 3AULA 4G3XB 2NPTA 4AJYB 4W9GA 4ZYNA 1WX8A 1J8CA 2JZ3B 2KQSA 4DBGA 1TGZB 2XEWA 4AOFA 5DPWA 3KYDD 2K25A 2KANA 3GZNI 1WM3A 3JVZX 1YX6B 1L2NA 1S1QB 1WF9A 2KJHB 2MRPA 2J0KA 2L76A 2QHOA 4IM2A 2Z59B 4OVVA 4JQWC 5GMVA 3HHMA 1C3TA 3A4SC 4IG7B 3VUXA 4XZ4A 3A9KB 3DOWA 3M62B 2MP2A 1T0YA 1WY8A 2LXCA 4MH0E 4URKA 1Q1OA 2DZIA 5J2RA 1G6JA 3T8MA 2WWZA 4DXAB 3ZNGC 4KSLC 3LJ3A 4BFRA 3K9PB 3AU4A 4TUUA 3UGBB 1LM8B 3VH4B 1GC6A 4MEMA 2ZNVB 4EKUA 4JLCA 5IA7A 1WXMA 4KZCA 4F8CB 2NCNA 4KDLB 2MBQA 3B0AA 4NY0A 2JXXA 3ZNZB 4EOYA 4HLEA 3HM6X 3MHSD 4WJQA 3DBLI 1YQBA 3KVFB 4W9HA 2Z0DB 4J6IA 2PEAA 2FAZA 1TTNA 3UIPB 5J17A 4HK2A 3A9KA 4DK5A 5BO4B 1WH3A 2KDIA 2KJ6A 3TJPA 3ZDMC 3TIXA 4B6WA 1V80A 3RUIB 1H4RA 1WJNA 2ZVOA 4II3B 2KLCA 4WJPA 3SHQA 3OJ3A 1UZXB 3QK0A 4K81A 2BKRB 2L00B 3IHPC 2A4ZA 4W9KA 1EUVB 1WR6E 2NVUI 2LWPA 4ZDVA 3MTNB 2JWZA 1OGWA 1RRBA 1EO6A 2K8BA 1VD2A 2M1MA 1VCBA 2K6DB 1UGMA 2ZPYA 1PQSA 3N30A 4ICVA 4RM9A 4FJYA 3L17A 3WANA 1V5OA 3N3KB 3RZFA 3VFKA 1WRDB 2VRRB 1FXTB 4GOCA 4GXBA 1E7UA 1EF1A 3IVFA 4NJ6A 4NPNA 1XD3B 2GOWA 4GDKB 2K1FA 4DDGD 1UD7A 2C60A 2PPHA 5TR5A 3OLMD 3WAMA 2KVRA 3ZLZA 2DZJA 2LVPA 3PREA 4ANUA 3VTWA 2N1VA 2G45B 4KDIC 4NAWA 4YL8A 3L16A 4LDTD 2NPTB 1NDDA 1I42A 3DBRI 2FUHB 2KTFA 2L7RA 3DQVA 1NI2A 4EZKA 2LXAA 4W9EA 1WE6A 2C5LC 3ZRFA 4BOSC 2LGDA 2UWQA 3VDZA 3S2AA 3CF6E 2BGFA 4ZRKA 1P98A 3HK0A 2JUOA 2N7EA 4TV3A 2WX1A 4AP4C 1TZ1A 3EFUA 3K9OB 3PV1A 3PTFC 2KQ7A 3PT2B 4GU2A 1P0RA 2OOBB 2KDEB 4A3PA 4EFOA 2KTRB 4FADA 1E8WA 2DYBA 3RULA 2KWVB 1SE9A 3EHVA 3LDZE 3PHWB 3R3MA 1IP9A 2REXA 3A9JB 4OVUA 3APFA 3ZIMA 1MG8A 1P9DU 2GBKA 4HWIB 1Y8RC 1GG3A 1WGGA 1WZ0A 3A1QA 3DDCB 3QX1A 2KC1A 2D2QA 2M8SA 2L0FA 3TL5A 1WXVA 3RZWC 4RMAA 4K7WA 2KKCA 4I6LB 3M95A 2KFKB 3TMPB 1KM7A 5EDSA 4XX5A 1V9JA 3RCZA 2KNBA 3U8ZA 3V61A 2DENB 2GBRA 2IO1B 3PRMB 2GBNA 3V60A 2O2VA 3WAPA 3R7QA 4GDLB 3ZNID 2FCQA 2ZZPB 4K7UA 2D07B 1TBEA 3GOEA 2C7MB 4DHZE 4PYUA 2O6VA 3APCA 3VH3B 5JHBA 4HCNB 4KIKB 4II2B 1KLVA 4MDKE 1U4AA 3CSFA 2LD9A 5JHAA 2J0JA 2ZEQA 2G3QB 2WYQA 3V6CB 2W9NA 4IM0A 3KH0A 4PS8A 2KFJA 2MBHA 4MM3A 4PS3A 4GMVA 3TCAA 4BKTA 4JIOU 3PRPB 4HDOA 3VTVA 3L10B 2C7HA 3VQIA 1EF5A 4IWOA 3U30A 1CMXB 4DDID 4IUMB 2XK5A 2JF5A 4NQKE 2LJ5A 4DWFA 3QIJA 2MX2A 2Z0EB 2D10A 1QZEA 3PRZA 4F1SA 5KHQA 2J7QB 2AWTA 1OQYA 1WGYA 2BYEA 2KHWB 3ZTCA 3QQ8B 4X57B 4ANWA 1IYFA 2EMSA 3CSTA 1LQBA 4I6NB 2JY6A 3OJ4B 3JSVB 3DVNU 3R66C 2KMCA 1AARA 4JGHB 4LCDE 4XC2A 4BVUC 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW7 A;  3H7S A;  5D2M B;  1E7V A;  3ZTD A;  2RD0 A;  5DCN A;  3MJW A;  4AJW A;  2BKF A;  2HD5 B;  5AEK B;  1HE8 A;  2KO3 A;  2JT4 B;  4GSW A;  4A20 A;  3H1U A;  2JVC A;  2IO2 B;  3M63 B;  2KMA A;  4GIV A;  1V6E A;  4BOZ B;  4TQ1 A;  2NBW B;  1Q5W B;  3D32 A;  3M3J A;  1RAX A;  4WWO A;  1Q0W B;  1LXD A;  1WGD A;  3OAW A;  3SD5 A;  2MLB A;  2O6V B;  4PS7 A;  3EEC A;  4MGK E;  3PS6 A;  2R2O A;  2NBV B;  4W9F A;  2V1Y A;  1WXS A;  4WWN A;  1X1M A;  4GDL A;  2KWU B;  2MW5 A;  2LI5 A;  1KOT A;  3AI5 A;  4FJZ A;  2MQJ A;  3QHT A;  2BF8 B;  4AWJ A;  2L05 A;  4MGI E;  2FID A;  2AYO B;  1RFA A;  2MBE A;  5CX3 A;  3UIO B;  4E71 A;  2RPQ A;  5JH5 C;  1ZGU B;  2KXJ A;  3HM3 A;  1UBI A;  3JW0 X;  2KWC A;  5E6O A;  1IPG A;  1WIA A;  2MA9 B;  3ONS A;  5L95 C;  3A1Q B;  1R4N I;  2BYV E;  2FCS A;  2WX0 A;  3HIZ A;  2RSU A;  2N1W A;  5IAA C;  4EEW A;  1UBQ A;  1JRU A;  2KTR A;  5G55 A;  5LXH A;  2N7D A;  5C1Z A;  2GBJ A;  2O2V B;  4EZJ A;  1K8R B;  4FHK A;  1J19 A;  5C23 A;  4LJP B;  4FBJ B;  2DHZ A;  3ALB A;  4W9D A;  2PE9 A;  1WJU A;  2KK8 A;  4MGY E;  2NS5 A;  3ZUN A;  2CS4 A;  3N32 A;  4FHJ A;  2Y5B B;  5CHF A;  4FUL A;  1RLF A;  5KHO A;  3DPD A;  2IZV B;  5D6J B;  2MCN B;  2M4N A;  3A9J A;  4LDT B;  3RT3 B;  2WDT B;  3PLV A;  4ICU A;  1WMH B;  3W1S A;  1OTR B;  4GGQ A;  1SGH A;  2FCM A;  3AXC A;  4W9L A;  1WJ4 A;  2IO3 B;  1E8Z A;  2FCN A;  3X23 A;  3H7P B;  1R4M I;  2IYD B;  1WJ6 A;  3JYU A;  1YX5 B;  1XT9 B;  2R2Q A;  4BKS D;  4HCP B;  3QAR A;  1GNU A;  3CMM B;  4GB9 A;  4IW0 A;  3JSV A;  2BWF A;  4IM3 A;  4PYZ A;  2UYZ B;  2ASQ A;  2V4L A;  1V86 A;  1E8Y A;  2IY1 B;  1WZ3 A;  2KN5 A;  2DYM A;  3NZS A;  4WQO B;  5FR6 A;  2AL6 A;  2L0T A;  4G50 A;  1SIF A;  3H7P A;  4NAW B;  4ZRI A;  1LFD A;  2L8J A;  5CHW A;  2C9W B;  2C7N B;  3VXW A;  3NS8 A;  4HVB A;  3IBE A;  3NY5 A;  3V6E B;  1F9J A;  4KSK C;  2LVO A;  4TKN A;  2LUE A;  2HTH A;  3VUW A;  4KIK A;  4CO7 A;  3ZVV A;  1P1A A;  2KDB A;  2CHZ A;  5DPS A;  2JPH A;  3IG3 A;  1WE7 A;  1WXA A;  2MSE D;  4FA6 A;  4AUQ C;  3ZNH B;  1UH6 A;  2LRW A;  4IWP A;  3UF8 A;  3VTU A;  3VVW B;  4E74 A;  2DZM A;  3NZU A;  1WM2 A;  3DBH I;  4HPL B;  4MJS A;  2BYF A;  3NHE B;  4KV2 A;  2KD0 A;  2N4F A;  2XBB C;  3KUC B;  4M0W B;  3WAO A;  5DPR A;  3QAQ A;  4DHJ D;  3RYT A;  2N9P C;  4KVG B;  3I3T B;  4MSQ B;  3UQB A;  3PSE B;  4HJK A;  3ZW3 A;  4G0N B;  4EUT A;  2LZ6 A;  2MBO A;  3BIN A;  1KJT A;  3DCG A;  3UIN B;  1Z5S B;  2JRI B;  5LLI A;  2B3A A;  3VAW A;  4BKS A;  2LGX A;  1YJ1 A;  2MP2 B;  2ZVN A;  3ECI A;  4K1R B;  1V49 A;  2O6V D;  3APD A;  4W9J A;  1ISN A;  1H8C A;  4CHK A;  5D94 A;  5L83 A;  4M8M A;  4M8N A;  4BKG A;  4MJS B;  3Q3J A;  4IWQ A;  4ANV A;  4MSM B;  2HJ8 A;  3WIM A;  3IFW B;  3BY4 B;  3ENE A;  3X0W A;  1YIW A;  3PHX B;  1YD8 U;  2KC2 A;  2CU1 A;  4ZRJ A;  3W1S C;  2RR9 A;  3U7D A;  2LGY A;  5LXI B;  4MGZ E;  2EKE C;  2D11 A;  1E8X A;  3PVL A;  3H6N A;  3L0W B;  3EC8 A;  1BT0 A;  3H9D A;  4E3C A;  1WYW B;  3KW5 B;  3DVN V;  4BBN C;  4NNJ B;  5HKH A;  4FLH A;  2DYO A;  3ML9 A;  2IY0 B;  4GN1 A;  1WR1 A;  2XK5 B;  2KLG A;  3QJZ A;  2A5U A;  4GDK A;  1OEY J;  3QC8 B;  1UEL A;  3PPA A;  4ASW C;  3QCA A;  3O65 B;  1ZKH A;  3SU8 X;  4BBN F;  2BPS A;  1V2Y A;  1S3S G;  2D3G A;  4A3O A;  4FJV B;  1XQQ A;  3L54 A;  3C0R B;  4W9I A;  2DAJ A;  4CYE A;  1J0G A;  4LJO B;  2V3S A;  4N9F 4;  3VUY A;  1D3Z A;  4WJO A;  2IO0 B;  2GMI C;  4TQ0 A;  3L08 A;  5JZE B;  5CTR C;  1GJZ A;  3L13 A;  2JRH A;  1GUA B;  1E90 A;  2ZCB A;  4I6P A;  1NBF C;  4WAA A;  3WAL A;  4RM8 A;  1WMH A;  3KUZ A;  4HDQ A;  2G4S A;  3QWZ B;  3RD2 A;  4KZ0 A;  3ZKJ C;  3ZO5 B;  1OEY A;  2RGF A;  2DX5 B;  5DPT A;  2K8C A;  1WI0 A;  2ZCC A;  1WFY A;  2N9E B;  3V62 A;  3A33 B;  4HXD A;  2K8H A;  3B1L X;  3QA8 A;  3DVG Y;  2OJR A;  2ZJD A;  3WA0 A;  2DAF A;  2YLM A;  2IBI B;  1V5T A;  2EMT A;  3A4R A;  2LAS A;  2LRU A;  2BWE S;  2KOX A;  4NJ7 A;  3B08 A;  5D7G A;  3ML8 A;  3T9L A;  1A5R A;  1I35 A;  2PE6 B;  2KX3 A;  2KX0 A;  2AEH A;  2L3Z A;  4ANX A;  4IC7 B;  5E6P A;  2MBB B;  2K6Q A;  4WWP A;  2HE7 A;  1WX7 A;  3PLU A;  1P3Q U;  2I1K A;  5AZH A;  4HPM B;  3R7R A;  3Q3F A;  2M0X A;  4DHJ B;  2CR5 A;  2FNJ B;  2G4D B;  4P7I A;  2NR2 A;  3TBL D;  3NOB A;  2CHW A;  5J18 A;  2CKH B;  1WX9 A;  2CHX A;  4JL9 A;  3ZDT A;  2FIF A;  2GBM A;  2JZZ A;  2PJH A;  2KFK A;  3ZRC A;  4F7Z A;  1Z2M A;  2J0M A;  2NBU A;  2ZPN A;  4FN2 A;  2I1J A;  1M94 A;  2K39 A;  5G2N A;  2KJR A;  2ZNV C;  3PZD A;  3SDL C;  3P2B A;  3KYC D;  4DHZ B;  5AZG A;  1E5W A;  2MWS B;  4NQL B;  4K7S A;  4WJN A;  3VHT C;  3KUD B;  2YVC A;  2KZR A;  5CHV C;  2LVQ A;  4B9K A;  3W1Y A;  3AU5 A;  3DVG X;  2AL3 A;  4EZL A;  3PGE A;  3UQA A;  1WGR A;  4G11 A;  2KDF B;  5E6N A;  1GC7 A;  5AZF A;  1C1Y B;  2M17 A;  2N9X A;  3DBS A;  1V81 A;  4W9C A;  1WGH A;  4MEL A;  4B95 A;  2DZK A;  3AUL A;  4G3X B;  2NPT A;  4AJY B;  4W9G A;  4ZYN A;  1WX8 A;  1J8C A;  2JZ3 B;  2KQS A;  4DBG A;  1TGZ B;  2XEW A;  4AOF A;  5DPW A;  3KYD D;  2K25 A;  2KAN A;  3GZN I;  1WM3 A;  3JVZ X;  1YX6 B;  1L2N A;  1S1Q B;  1WF9 A;  2KJH B;  2MRP A;  2J0K A;  2L76 A;  2QHO A;  4IM2 A;  2Z59 B;  4OVV A;  4JQW C;  5GMV A;  3HHM A;  1C3T A;  3A4S C;  4IG7 B;  3VUX A;  4XZ4 A;  3A9K B;  3DOW A;  3M62 B;  2MP2 A;  1T0Y A;  1WY8 A;  2LXC A;  4MH0 E;  4URK A;  1Q1O A;  2DZI A;  5J2R A;  1G6J A;  3T8M A;  2WWZ A;  4DXA B;  3ZNG C;  4KSL C;  3LJ3 A;  4BFR A;  3K9P B;  3AU4 A;  4TUU A;  3UGB B;  1LM8 B;  3VH4 B;  1GC6 A;  4MEM A;  2ZNV B;  4EKU A;  4JLC A;  5IA7 A;  1WXM A;  4KZC A;  4F8C B;  2NCN A;  4KDL B;  2MBQ A;  3B0A A;  4NY0 A;  2JXX A;  3ZNZ B;  4EOY A;  4HLE A;  3HM6 X;  3MHS D;  4WJQ A;  3DBL I;  1YQB A;  3KVF B;  4W9H A;  2Z0D B;  4J6I A;  2PEA A;  2FAZ A;  1TTN A;  3UIP B;  5J17 A;  4HK2 A;  3A9K A;  4DK5 A;  5BO4 B;  1WH3 A;  2KDI A;  2KJ6 A;  3TJP A;  3ZDM C;  3TIX A;  4B6W A;  1V80 A;  3RUI B;  1H4R A;  1WJN A;  2ZVO A;  4II3 B;  2KLC A;  4WJP A;  3SHQ A;  3OJ3 A;  1UZX B;  3QK0 A;  4K81 A;  2BKR B;  2L00 B;  3IHP C;  2A4Z A;  4W9K A;  1EUV B;  1WR6 E;  2NVU I;  2LWP A;  4ZDV A;  3MTN B;  2JWZ A;  1OGW A;  1RRB A;  1EO6 A;  2K8B A;  1VD2 A;  2M1M A;  1VCB A;  2K6D B;  1UGM A;  2ZPY A;  1PQS A;  3N30 A;  4ICV A;  4RM9 A;  4FJY A;  3L17 A;  3WAN A;  1V5O A;  3N3K B;  3RZF A;  3VFK A;  1WRD B;  2VRR B;  1FXT B;  4GOC A;  4GXB A;  1E7U A;  1EF1 A;  3IVF A;  4NJ6 A;  4NPN A;  1XD3 B;  2GOW A;  4GDK B;  2K1F A;  4DDG D;  1UD7 A;  2C60 A;  2PPH A;  5TR5 A;  3OLM D;  3WAM A;  2KVR A;  3ZLZ A;  2DZJ A;  2LVP A;  3PRE A;  4ANU A;  3VTW A;  2N1V A;  2G45 B;  4KDI C;  4NAW A;  4YL8 A;  3L16 A;  4LDT D;  2NPT B;  1NDD A;  1I42 A;  3DBR I;  2FUH B;  2KTF A;  2L7R A;  3DQV A;  1NI2 A;  4EZK A;  2LXA A;  4W9E A;  1WE6 A;  2C5L C;  3ZRF A;  4BOS C;  2LGD A;  2UWQ A;  3VDZ A;  3S2A A;  3CF6 E;  2BGF A;  4ZRK A;  1P98 A;  3HK0 A;  2JUO A;  2N7E A;  4TV3 A;  2WX1 A;  4AP4 C;  1TZ1 A;  3EFU A;  3K9O B;  3PV1 A;  3PTF C;  2KQ7 A;  3PT2 B;  4GU2 A;  1P0R A;  2OOB B;  2KDE B;  4A3P A;  4EFO A;  2KTR B;  4FAD A;  1E8W A;  2DYB A;  3RUL A;  2KWV B;  1SE9 A;  3EHV A;  3LDZ E;  3PHW B;  3R3M A;  1IP9 A;  2REX A;  3A9J B;  4OVU A;  3APF A;  3ZIM A;  1MG8 A;  1P9D U;  2GBK A;  4HWI B;  1Y8R C;  1GG3 A;  1WGG A;  1WZ0 A;  3A1Q A;  3DDC B;  3QX1 A;  2KC1 A;  2D2Q A;  2M8S A;  2L0F A;  3TL5 A;  1WXV A;  3RZW C;  4RMA A;  4K7W A;  2KKC A;  4I6L B;  3M95 A;  2KFK B;  3TMP B;  1KM7 A;  5EDS A;  4XX5 A;  1V9J A;  3RCZ A;  2KNB A;  3U8Z A;  3V61 A;  2DEN B;  2GBR A;  2IO1 B;  3PRM B;  2GBN A;  3V60 A;  2O2V A;  3WAP A;  3R7Q A;  4GDL B;  3ZNI D;  2FCQ A;  2ZZP B;  4K7U A;  2D07 B;  1TBE A;  3GOE A;  2C7M B;  4DHZ E;  4PYU A;  2O6V A;  3APC A;  3VH3 B;  5JHB A;  4HCN B;  4KIK B;  4II2 B;  1KLV A;  4MDK E;  1U4A A;  3CSF A;  2LD9 A;  5JHA A;  2J0J A;  2ZEQ A;  2G3Q B;  2WYQ A;  3V6C B;  2W9N A;  4IM0 A;  3KH0 A;  4PS8 A;  2KFJ A;  2MBH A;  4MM3 A;  4PS3 A;  4GMV A;  3TCA A;  4BKT A;  4JIO U;  3PRP B;  4HDO A;  3VTV A;  3L10 B;  2C7H A;  3VQI A;  1EF5 A;  4IWO A;  3U30 A;  1CMX B;  4DDI D;  4IUM B;  2XK5 A;  2JF5 A;  4NQK E;  2LJ5 A;  4DWF A;  3QIJ A;  2MX2 A;  2Z0E B;  2D10 A;  1QZE A;  3PRZ A;  4F1S A;  5KHQ A;  2J7Q B;  2AWT A;  1OQY A;  1WGY A;  2BYE A;  2KHW B;  3ZTC A;  3QQ8 B;  4X57 B;  4ANW A;  1IYF A;  2EMS A;  3CST A;  1LQB A;  4I6N B;  2JY6 A;  3OJ4 B;  3JSV B;  3DVN U;  3R66 C;  2KMC A;  1AAR A;  4JGH B;  4LCD E;  4XC2 A;  4BVU C;  1L7Y A; 
#chains in the Genus database with same CATH topology
 1PGA A;  1ZW7 A;  5D2M B;  2WGS A;  2QEJ C;  5DCN A;  2BKF A;  2RDG A;  3RFZ B;  1HE8 A;  2KO3 A;  2WXJ A;  3DBL B;  3H1U A;  2JVC A;  3M63 B;  4GIV A;  4BOZ B;  2J52 A;  4TQ1 A;  3D32 A;  4MT5 A;  1RAX A;  2WXN A;  2MLB A;  4BZA A;  2R2O A;  2V1Y A;  3NZ3 A;  2WLB A;  3QHT A;  4AWJ A;  2L05 A;  4E71 A;  1KRH A;  3NVZ A;  5LXH A;  2OED A;  5FR3 A;  2WU5 B;  4EZJ A;  1I4X A;  1K8R B;  3KLS X;  1J19 A;  4LJP B;  1E0Z A;  2KK8 A;  2MH7 A;  2WHI A;  2NS5 A;  1AWD A;  3N32 A;  1QLB B;  1MI0 A;  3O13 A;  3DPD A;  3A9J A;  4LDT B;  2WDT B;  3W1S A;  4GGQ A;  1MHX A;  3R2I A;  2WQY B;  2IJ0 A;  4US9 A;  1GNU A;  3CMM B;  4ZHO A;  4IM3 A;  2UYZ B;  4ACF A;  2V4L A;  2KN5 A;  2Y5C A;  3KWV A;  4B0M A;  2AL6 A;  3GB1 A;  4G50 A;  1C4C A;  3NVV A;  3VXW A;  4AQ7 A;  3V6E B;  4KSK C;  2LVO A;  4TKN A;  1TKY A;  4KIK A;  4CO7 A;  1KTK A;  2CHZ A;  5DPS A;  2XNA C;  3FKY A;  3DHH C;  4FA6 A;  4AUQ C;  1CK1 A;  4IWP A;  3UF8 A;  4M02 A;  3VTU A;  3PZ8 A;  4KV2 A;  4DHJ D;  3I3T B;  4ZYS A;  4HJK A;  4DQO C;  2LZ6 A;  5BYS A;  1KJT A;  4ITK A;  1Z5S B;  2JRI B;  3IXS A;  4JPS A;  4BKS A;  3B2F A;  1QOF A;  3MC9 A;  4K1R B;  2QSD A;  4JWS C;  1H8C A;  3RNB C;  4BKG A;  1NI3 A;  4ANV A;  2WNM A;  4NZL B;  4MSM B;  3BY4 B;  3ENE A;  5C3J B;  2CU1 A;  2QIE B;  2KDM A;  4BAX A;  3TEZ A;  1UGJ A;  1WYW B;  3KW5 B;  3DVN V;  1JAL A;  1P7F A;  1DYQ A;  2KLG A;  1OEY J;  4ASW C;  1L0V B;  4M00 A;  2WXR A;  3LXF A;  2BPS A;  1TJE A;  1S3S G;  3Q8C A;  3HRD D;  4FJV B;  1IGC A;  3L54 A;  1C76 A;  4ARI A;  3AH7 A;  2W82 A;  4WJO A;  4I6P A;  1E90 A;  2BS3 B;  1NBF C;  1TIF A;  1XF5 L;  2KYW A;  4RM8 A;  1PGB A;  2E6X A;  4HDQ A;  3QWZ B;  3I9V 1;  3ZO5 B;  2J53 A;  4FXC A;  1M4V A;  2DBY A;  3W9C B;  3CWI A;  3DVG Y;  1QOA A;  3WA0 A;  2YLM A;  4A9A A;  2LRU A;  3B08 A;  2BYT A;  2PE6 B;  2AEH A;  2L3Z A;  4R3D A;  4IC7 B;  2MBB B;  2I1K A;  4C7Z A;  1ESF A;  3R7R A;  1YN5 A;  1B9R A;  1L6U A;  2L1A A;  2CKH B;  4JL9 A;  2BTE A;  5MPO A;  3ZRC A;  2J0M A;  2NBU A;  3Q3O C;  4IKG A;  1M94 A;  2QCZ A;  5G2N A;  3SDL C;  2MWS B;  3ZXV A;  5BMH A;  3KUD B;  2YVC A;  3W1Y A;  4KGR A;  4EZL A;  2KDF B;  5E6N A;  5IOI A;  4IDI A;  3OWE B;  1V81 A;  4B95 A;  3C19 A;  2IGG A;  2KMM A;  2DZK A;  3ZYY X;  4G3X B;  1L0Y B;  2YEP B;  5HI1 A;  1WX8 A;  1T0Q C;  1TGZ B;  5DPW A;  2K25 A;  2KAN A;  1L2N A;  4MH8 A;  3TSS A;  1SSN A;  2VZK B;  1PGX A;  4JQW C;  3IT6 B;  4MAC A;  1C3T A;  3A4S C;  4IG7 B;  3HVD A;  3VUX A;  1QF6 A;  1C77 A;  2LXC A;  1WY8 A;  1F0Z A;  1Q1O A;  2DZI A;  5J2R A;  2JSV X;  4O1N A;  2LUM A;  1YQ3 B;  3AED B;  3N1X C;  3AU4 A;  3UGB B;  3VH4 B;  2ZNV B;  2WDV B;  2MBQ A;  4HLE A;  3HM6 X;  4WJQ A;  1MJD A;  2UU7 A;  4W9H A;  5J17 A;  4RF1 A;  4DK5 A;  5BO4 B;  1WH3 A;  4B6W A;  1H4R A;  5EE1 A;  3Q3M C;  2SAK A;  2KLC A;  4N6E B;  4K81 A;  2L00 B;  1HZ6 A;  3SR6 A;  1DGJ A;  2KVZ A;  1EUV B;  2LWP A;  3DBH B;  2N9L A;  4KGT A;  1OGW A;  2WXH A;  3B2G A;  1VD2 A;  3NVW A;  1UGM A;  1PQS A;  3N30 A;  1F1H A;  3DHI C;  4YSY B;  3RZF A;  1DOI A;  1FXT B;  4GXB A;  1EF1 A;  1MG4 A;  4NPN A;  1XD3 B;  1UD7 A;  2EEL A;  2PPH A;  2KVR A;  3RNE C;  4CQN A;  1I42 A;  3ZQ4 A;  2C5L C;  3ZRF A;  4L2Y A;  2LGD A;  2UWQ A;  3VDZ A;  3S2A A;  1QIL A;  4LNO A;  1YJJ A;  3EFU A;  3PTF C;  4GU2 A;  1P0R A;  2M19 A;  2D3A A;  2KTR B;  4FAD A;  3RUL A;  4LK0 M;  3EHV A;  1IP9 A;  3A9J B;  4OVU A;  3APF A;  3ZIM A;  4PK1 A;  1FIQ A;  2GBK A;  4RFB A;  2L83 A;  1GG3 A;  1WZ0 A;  4YXD B;  3AE5 B;  1L0X B;  2L0F A;  4RMA A;  4K7W A;  3M95 A;  1FPY A;  5EDS A;  4XX5 A;  1FNU A;  3RCZ A;  2GBN A;  3WAP A;  3R7Q A;  4K7U A;  3GOE A;  1QT9 A;  4DHZ E;  2O6V A;  2HJ1 A;  2H88 B;  2WYQ A;  1T6B X;  3DWG C;  2MBH A;  4N59 A;  4MM3 A;  3TCA A;  4BKT A;  3PRP B;  3VRA B;  1MFW A;  1XLQ A;  1K53 A;  4HRS A;  1EF5 A;  3VQI A;  3U30 A;  1SIJ A;  3C8Y A;  2VZK D;  3MC0 B;  1AW7 A;  3SFD B;  3PRZ A;  2J7Q B;  1OQY A;  2WXI A;  4ANW A;  1IYF A;  1VZ6 A;  2K9X A;  4B0E A;  3TL5 A;  3R66 C;  2KMC A;  4LCD E;  3AE9 B;  1E7V A;  3ZTD A;  1NEN B;  4LNF A;  3NVY A;  1Q5W B;  2KQ4 X;  3IAS 1;  3M3J A;  3N1Z C;  1WGD A;  3OAW A;  2O6V B;  4PS7 A;  3EEC A;  4MGK E;  2RDB C;  2W55 A;  4W9F A;  3R8B A;  4WQM A;  1X1M A;  2KWU B;  1N61 A;  3AI5 A;  4FJZ A;  2AYO B;  2MBE A;  1ZGU B;  2KXJ A;  3HM3 A;  5AUK A;  2I38 A;  1IPG A;  1FXA A;  1WIA A;  2MA9 B;  2QJL A;  1AN8 A;  3A1Q B;  2BYV E;  2WX0 A;  3BVM A;  5HHD G;  2D5G A;  5IAA C;  1YN4 A;  2JZP A;  2XN9 C;  2EKI A;  1EU3 A;  5G55 A;  2N7D A;  1FRR A;  3P42 A;  2JWU A;  1HTO A;  5C23 A;  2DWQ A;  5I4D A;  1L6V A;  4A8X C;  4P16 A;  4MGY E;  2Y5B B;  5HFY A;  3RNC C;  4YSZ B;  1PFD A;  2TSS A;  2AQ3 B;  3ETR A;  1KLG D;  4W9L A;  3ABV B;  4OW0 A;  2VH1 A;  1WJ4 A;  1WGK A;  2IO3 B;  4PT5 A;  2W54 A;  1ZUD 2;  3X23 A;  3JYU A;  1YX5 B;  2LHD A;  1TY0 A;  4BKS D;  2PKO A;  4D2K A;  2N9K A;  1SB3 C;  2RPV A;  4GB9 A;  2KAJ A;  4IW0 A;  2BWF A;  3BYY B;  4YTN B;  1WZ3 A;  2DYM A;  4ZRI A;  4A55 A;  4P6V F;  2QDF A;  1D5Z C;  1DOX A;  3NS8 A;  3IBE A;  3NY5 A;  3I63 C;  5H8Y E;  2JU6 X;  2KDB A;  1CQV A;  1WXA A;  2MSE D;  3ZNH B;  5FK9 C;  2DZM A;  4QAY A;  4MJS A;  2BYF A;  2KD0 A;  3KUC B;  4M0W B;  2ACZ B;  4XDC A;  5DPR A;  3QAQ A;  2B76 B;  2JYT A;  5G5G A;  4EUT A;  1IGD A;  3P1M A;  1JW9 D;  3DCG A;  5LLI A;  3AE6 B;  3AMZ A;  1D5M C;  1YJ1 A;  2LGX A;  1BXT A;  1V49 A;  1PYW D;  4MJS B;  2PLP A;  4IWQ A;  2HJ8 A;  3IFW B;  2WXK A;  1YIW A;  1YD8 U;  4ZRJ A;  3U7D A;  2LGY A;  5LXI B;  3FC4 A;  3L0W B;  2ONQ A;  3H9D A;  4E3C A;  4BBN C;  4NNJ B;  2DYO A;  5E6J A;  1WR1 A;  2IGD A;  2XK5 B;  4C4V A;  1R4N B;  1OQR A;  5EE3 A;  1ZKH A;  3SU8 X;  1E9M A;  4BBN F;  1V2Y A;  2D3G A;  4OZC A;  3SFE B;  3EA6 A;  3HUI A;  5IN7 A;  4N9F 4;  2L52 A;  3VUY A;  2GMI C;  4TQ0 A;  3L08 A;  1AYF A;  5FKA C;  1V1P B;  5JZE B;  1GJZ A;  1GUA B;  3WAL A;  4KGS A;  1WMH A;  2G4S A;  4KZ0 A;  1OEY A;  2RGF A;  1XEE A;  1WI0 A;  1WFY A;  2N9E B;  3V62 A;  1NYQ A;  4WH4 A;  2K8H A;  3B1L X;  2OJR A;  2EMT A;  2BWE S;  5D7G A;  3TEW A;  1I35 A;  1ET6 A;  1A5R A;  3ML8 A;  4RNA A;  5E6P A;  2K6Q A;  4WWP A;  1WX7 A;  1KH0 A;  5AZH A;  2NTS A;  2M0X A;  2Q5W D;  3I57 A;  2CR5 A;  5J18 A;  2CHX A;  3ZDT A;  2FIF A;  2GBM A;  4K3B A;  4F7Z A;  3AEG B;  4FN2 A;  4WWM A;  1GAQ B;  4C80 A;  3PZD A;  1V8C A;  2BBC A;  4NQL B;  1EM7 A;  3BII D;  3Q2A C;  5IP4 D;  4OZB A;  3AE8 B;  3AU5 A;  1HA5 A;  3PGE A;  3UQA A;  1WGR A;  2K22 A;  4G11 A;  1TS2 A;  5AZF A;  1GC7 A;  2M17 A;  2N9X A;  1L4D B;  2WXQ A;  1FNW A;  4MEL A;  1C79 A;  5BYR A;  5AUI A;  2NPT A;  4W9G A;  4DBG A;  2BW2 A;  3GZN I;  1WM3 A;  3BYT B;  3MFG A;  1L5P A;  3HHM A;  1FM0 D;  1NVI D;  4XZ4 A;  2V3N A;  4C56 C;  1T0Y A;  4URK A;  2JX5 A;  2LFI A;  2FUG 1;  1G6J A;  4DXA B;  3CIR B;  3LJ3 A;  3UI3 A;  2BS2 B;  3K9P B;  5BMI A;  1C4P A;  4MEM A;  2INN E;  4JLC A;  5IA7 A;  4F8C B;  4KZC A;  3EFC A;  1K50 A;  3ZNZ B;  4EOY A;  2JXX A;  1JWM D;  2LMC A;  1UNS A;  1I4Q A;  4HK2 A;  3VRB B;  1OQQ A;  3MC8 A;  1STE A;  3ZDM C;  1V80 A;  1WJN A;  3QK0 A;  1ACC A;  3IHP C;  4W9K A;  2DNF A;  3E9S A;  3MTN B;  4RCO A;  1ZXI A;  1EO6 A;  1QQR A;  4N58 A;  2MHJ A;  2QC8 A;  2V3P A;  1CZP A;  3WAN A;  1FCC C;  1WRD B;  1J7C A;  4GOC A;  1E7U A;  3IVF A;  4NJ6 A;  2GOW A;  4GDK B;  4US8 A;  2K1F A;  2CJO A;  2C60 A;  3OLM D;  3ZLZ A;  4ANU A;  2PIA A;  3PRE A;  1VZ7 A;  4LDT D;  3DBR I;  2KTF A;  2LHE A;  2LXA A;  1T5X D;  3W2D A;  4BOS C;  1C78 A;  3CF6 E;  2BGF A;  4ZRK A;  1P98 A;  2JUO A;  2GI9 A;  2WX1 A;  3AEF B;  3PV1 A;  3PT2 B;  4EFO A;  2W3S A;  3AM9 A;  2JXT A;  1E8W A;  2W3R A;  3LDZ E;  2REX A;  2Y5P A;  1MG8 A;  1P9D U;  3QX1 A;  2KC1 A;  4RH6 A;  2G9H D;  1ZPS A;  1WXV A;  3U4E G;  2KKC A;  4I6L B;  4XYC A;  2KFK B;  3V61 A;  2KNB A;  3U8Z A;  2DEN B;  3PRM B;  3V60 A;  2FCQ A;  2D07 B;  1TBE A;  1TT5 B;  1IBX B;  4HCN B;  4II2 B;  2CU3 A;  3H8H A;  4MDK E;  3CSF A;  2LD9 A;  5JHA A;  3NS1 A;  2J0J A;  2WP9 B;  2ZEQ A;  2G3Q B;  4REZ A;  4EE2 A;  2W9N A;  4IM0 A;  3AEA B;  1WRI A;  3VTV A;  4IWO A;  1JCK B;  1R7S A;  3MP9 A;  2WDR B;  2JF5 A;  3ZJT A;  2Z0E B;  2D10 A;  1FD6 A;  2KWD A;  1YMH E;  4F1S A;  2AWT A;  2Y3A A;  3ZTC A;  2Z8L A;  3JSV B;  2KJR A;  1YOV B;  1XO3 A;  1L7Y A;  2RD0 A;  4AJW A;  2JT4 B;  4A20 A;  3HVZ A;  4XWW A;  2BB6 A;  2KMA A;  1V6E A;  3VR9 B;  3ZGZ A;  2NBW B;  3AE1 B;  1LXD A;  2AQ1 B;  3PS6 A;  1FO4 A;  4WWN A;  4M01 A;  4GDL A;  2MW5 A;  2PMV A;  2BF8 B;  2CJN A;  4MGI E;  2FID A;  1RFA A;  1YN3 A;  2MJD A;  3JW0 X;  1UBI A;  2KWC A;  1YNT E;  3BWU D;  2RSU A;  2N1W A;  1E6E B;  4RGO S;  1GPX A;  1RWS A;  1UBQ A;  1JRU A;  3Q14 C;  1IBX A;  1RFK A;  4JE3 B;  4WAF A;  5C1Z A;  2O2V B;  3TEX A;  3ALB A;  4W9D A;  2PE9 A;  3ZUN A;  3URY A;  4FHJ A;  2HTM E;  1RLF A;  5KHO A;  2IZV B;  5IO9 A;  2M4N A;  3RT3 B;  4ICU A;  3AN1 A;  4YTP B;  1F2R I;  1SGH A;  2FCM A;  3AXC A;  1JQ4 A;  1HTQ A;  1C4A A;  3H7P B;  2PW9 A;  2IYD B;  1WJ6 A;  1XT9 B;  2R2Q A;  1VLB A;  3V3X A;  1ENF A;  3TUO A;  4ZHP A;  3JSV A;  4PYZ A;  2IY1 B;  1L4Z B;  4WQO B;  1SIF A;  1LFD A;  5CHW A;  2C9W B;  2C7N B;  2HTH A;  3VUW A;  1JWB D;  1ZXH A;  3ZVV A;  1J7A A;  3IG3 A;  1WE7 A;  1UH6 A;  2LRW A;  3ZJU A;  3NZU A;  1WM2 A;  5JXV A;  5G5H A;  3NHE B;  4USA A;  1GOZ A;  4JX1 C;  4XDD A;  2K5P A;  4XWT A;  2N4F A;  2N9P C;  3W5V B;  4MSQ B;  1KFY B;  3ZW3 A;  4G0N B;  2MBO A;  3UIN B;  3VAW A;  2B3A A;  1DOY A;  1V97 A;  2ZVN A;  2D3B A;  3APD A;  1ISN A;  1KLU D;  5D94 A;  4M8M A;  4M8N A;  2IGH A;  3WIM A;  3X0W A;  3PHX B;  2KC2 A;  1HZ5 A;  2RR9 A;  4MGZ E;  2EKE C;  1E8X A;  3PVL A;  3EC8 A;  1ZOY B;  2OHF A;  5HKH A;  4FLH A;  4GN1 A;  4P1B C;  5D3I B;  2A5U A;  4GDK A;  3QC8 B;  3B9J A;  3PPA A;  1WXQ A;  3Q8E A;  4YTM B;  3AE2 B;  4DXF A;  3C0R B;  4W9I A;  2DAJ A;  4CYE A;  2H89 B;  3KQ4 A;  1D5X C;  1D3Z A;  2MEK A;  1NEK B;  2IO0 B;  3U7Z A;  2JRH A;  5EE9 A;  3RD2 A;  3ZKJ C;  2DX5 B;  5DPT A;  1TY2 A;  2K8C A;  3A33 B;  4HXD A;  1FNV A;  3QA8 A;  2INC C;  2DAF A;  2J4X A;  2IBI B;  1V5T A;  4NJ7 A;  1I4R A;  1ROE A;  4ANX A;  1ZE3 D;  5C2T B;  2HE7 A;  3PLU A;  1P3Q U;  4HPM B;  2G4D B;  1VR9 A;  1UWX A;  4HEA 1;  2WXG A;  3TBL D;  3NOB A;  1A70 A;  1WX9 A;  3GS2 A;  2PJH A;  1PUT A;  2KFK A;  3DBR B;  1XLP A;  3AEC B;  3AB5 A;  2ZPN A;  3U52 E;  4OVZ A;  1K52 A;  3IAM 1;  3L4P A;  3Q8F A;  2I1J A;  1FEH A;  1RYJ A;  2YEP F;  2RDH A;  4L1B A;  5AZG A;  1E5W A;  3AEB B;  4K7S A;  4WJN A;  3W5U B;  5CHV C;  2BVC A;  2JYE A;  2LGS A;  2AL3 A;  3KWL A;  4ZRP A;  2WXM A;  4RGN A;  4W9C A;  3TEY A;  3Q3N C;  1FXI A;  4ZRQ A;  1TS3 A;  3AUL A;  4AJY B;  4ZYN A;  2KQS A;  2XEW A;  3KYD D;  3JVZ X;  1YX6 B;  1WF9 A;  2KJH B;  2MRP A;  3NRZ A;  1TKE A;  2J0K A;  2K0P A;  2L76 A;  4OVV A;  4HJG E;  4HKZ E;  3FIL B;  3A9K B;  3M62 B;  3BK1 A;  2N7J A;  4LNK A;  1I4H A;  4NAM A;  4EKU A;  5EE0 A;  1WXM A;  4KDL B;  1JWA D;  2QIL A;  3DBL I;  1HEZ E;  3Q6B A;  2Z0D B;  2PEA A;  3UIP B;  1TTN A;  4LNN A;  3GZN B;  3A9K A;  2KDI A;  2KN4 A;  1UUP A;  2LEK A;  2ZVO A;  4II3 B;  3P4P B;  3SHQ A;  3OJ3 A;  5H92 C;  2A4Z A;  1N5W A;  3P63 A;  3AEE B;  1WSP A;  2K6D B;  2ZPY A;  1QOG A;  4RGT A;  3L17 A;  1V5O A;  2WS3 B;  2OJW A;  2BB5 A;  3VFK A;  1BUI C;  3AE3 B;  3FIL A;  1SE3 A;  2KAC A;  1ZP0 B;  5TR5 A;  1KF6 B;  1V1P A;  3WAM A;  3NUH B;  3ZJV A;  3L16 A;  4LNI A;  1NDD A;  2KT7 A;  2V0G A;  1UF0 A;  3GE3 C;  1NI2 A;  4W9E A;  2HDE A;  3ZXR A;  1I7H A;  3P4Q B;  1JRP A;  2N7E A;  4AP4 C;  1TZ1 A;  1T3Q A;  3K9O B;  3MJ5 A;  2OOB B;  2KDE B;  4A3P A;  3BVG A;  1D4B A;  2PTL A;  3N1Y C;  3PHW B;  4HWI B;  1WGG A;  2GLS A;  4A6Q A;  1XLO A;  3DDC B;  2FE8 A;  2D2Q A;  4H2A A;  3RNF C;  3RZW C;  2INP E;  1KM7 A;  1V9J A;  2GBR A;  1SF0 A;  4GDL B;  3ZNI D;  2ZZP B;  1TS4 A;  2NTT A;  5JHB A;  3PO0 A;  1KLV A;  1HQR D;  1U4A A;  4LLG M;  3AE4 B;  2KFJ A;  4PS3 A;  4GMV A;  4JIO U;  4HDO A;  1JRO A;  1P7E A;  1EU4 A;  5BMG A;  2C7H A;  4C7Y A;  1TZO A;  4AS1 A;  2G1E A;  2BS4 B;  4DWF A;  1Q10 A;  2MX2 A;  3PZ7 A;  2RMM A;  5KHQ A;  2BYE A;  2KHW B;  1XCQ L;  3CST A;  2JY6 A;  4XC2 A;  1AAR A;  4JGH B;  5HG2 A;  1N5X A;  2AQ2 B;  3H7S A;  2SEB D;  3MJW A;  4MM3 B;  2HD5 B;  5AEK B;  4A90 A;  3EUB 2;  1PDX A;  1K51 A;  4GSW A;  3VR8 B;  4UDU C;  1C9F A;  2IO2 B;  1YQ4 B;  4WWO A;  1Q0W B;  1V1O A;  3SD5 A;  3RNA C;  5TSS A;  2NBV B;  1WXS A;  4WIP A;  2LI5 A;  1KOT A;  2MQJ A;  1E7P B;  5CX3 A;  3UIO B;  2RPQ A;  5JH5 C;  3WCQ A;  2QMT A;  5E6O A;  3ONS A;  5L95 C;  1I4P A;  2LJI A;  3I5J C;  1R4N I;  5IKC M;  2FCS A;  4ARC A;  3HIZ A;  2IPK D;  3E56 A;  4EEW A;  5D3D A;  2I2Y A;  3GP7 A;  4P1C C;  2KTR A;  1FMA D;  1SXT A;  2GBJ A;  4C00 A;  4FHK A;  3T3N A;  4FBJ B;  2DHZ A;  4M0W A;  1ET9 A;  1WJU A;  1CJE A;  2MJ3 A;  2CS4 A;  5CHF A;  1BML C;  4FUL A;  3P4S B;  3U2S C;  2V9H A;  5D6J B;  2MCN B;  3PLV A;  1WMH B;  4LTU A;  3P4R B;  1OTR B;  1SE2 A;  2N0S B;  2ZW0 A;  1E8Z A;  2FCN A;  1R4M I;  2IND C;  2IDY A;  4HCP B;  3BZD B;  4HKQ A;  3QAR A;  1N60 A;  4XGA B;  2ASQ A;  3N20 C;  1V86 A;  1E8Y A;  4J3O D;  5FR6 A;  3NZS A;  1Y56 A;  2L0T A;  3H7P A;  4NAW B;  2L8J A;  2BT6 A;  1VZ8 A;  4WUR A;  4HVB A;  1F9J A;  2BQQ A;  2LUE A;  3BVZ A;  1P1A A;  2JPH A;  4E74 A;  3VVW B;  4HPP A;  4HPL B;  3DBH I;  2ICI A;  1I4G A;  4HRO A;  1SJE D;  4K3C A;  2XBB C;  3WAO A;  1FRD A;  4L23 A;  3NG0 A;  3IT4 B;  3RYT A;  1R4M B;  4KVG B;  3UQB A;  3PSE B;  1SBB B;  1N63 A;  2GRI A;  1UWM A;  2V4I B;  2X8X X;  1WWT A;  3BIN A;  4KX6 B;  2MP2 B;  3ECI A;  2O6V D;  1IUE A;  1OFF A;  4W9J A;  1VJK A;  4CHK A;  5L83 A;  3NJT A;  1N6Z A;  3Q3J A;  1WYG A;  3AE7 B;  3W1S C;  2PVO D;  4JWU C;  2D11 A;  3H6N A;  4ZOH C;  1MPE A;  1BT0 A;  5LNK 1;  1XCT L;  3ML9 A;  2IY0 B;  3QJZ A;  1UEL A;  1GB1 A;  3QCA A;  3O65 B;  1D6E C;  4RF0 A;  4A3O A;  1XQQ A;  1J0G A;  4LJO B;  2V3S A;  1TKG A;  3SEB A;  2AX5 A;  2VH2 A;  5CTR C;  1LGR A;  3L13 A;  2ZCB A;  4WAA A;  2WDQ B;  3KUZ A;  3Q8A A;  2ZCC A;  4XE0 A;  1EWY C;  2ZJD A;  2M0A A;  3DWM A;  1HXY D;  3A4R A;  2LAS A;  2KOX A;  3T9L A;  5GXG B;  2KX3 A;  2KX0 A;  2FBW B;  3Q3F A;  4DHJ B;  2FNJ B;  1JML A;  4P7I A;  2NR2 A;  2CHW A;  1EWC A;  2NMQ A;  1T0S C;  2ON8 A;  2JZZ A;  1MVK A;  3OG5 A;  1Z2M A;  4S17 A;  2PVG C;  3FAH A;  5BYQ A;  1RM6 C;  4Q2J A;  2WXP A;  2K39 A;  3AV8 A;  2ZNV C;  1F52 A;  3P2B A;  3KYC D;  4DHZ B;  2WXO A;  3VHT C;  4OHJ A;  2KZR A;  2LVQ A;  4B9K A;  1ZDX A;  3DVG X;  1FCL A;  2X38 A;  1VDV A;  2WXL A;  1C1Y B;  3DBS A;  1J7B A;  3RN9 C;  1WGH A;  3T3O A;  1JWS D;  4RGM A;  4OZA A;  3EGR A;  4DXG A;  1J8C A;  2JZ3 B;  4AOF A;  1SEB D;  1S1Q B;  2QHO A;  4IM2 A;  3DHG C;  2M56 B;  2Z59 B;  5GMV A;  1T0R C;  1QOB A;  3DOW A;  1MHH E;  2MP2 A;  2E3T A;  2R61 A;  4MH0 E;  3T8M A;  2WWZ A;  3ZNG C;  1XLN A;  1E10 A;  3R2T A;  4KSL C;  4BFR A;  1FFU A;  4TUU A;  2JQR B;  1LM8 B;  1GC6 A;  4YWG G;  4GLS C;  1GB4 A;  2D3C A;  2NCN A;  4NY0 A;  3B0A A;  1QKZ A;  3MHS D;  1YQB A;  3KVF B;  4NJC A;  4J6I A;  2FAZ A;  3LYY A;  1JWU D;  3N9Y C;  2DLB A;  2KJ6 A;  3TJP A;  3RNG C;  3TIX A;  3RUI B;  3Q8B A;  4WJP A;  1UZX B;  2BKR B;  1WR6 E;  1YJI A;  2NVU I;  4ZDV A;  1SE4 A;  2JWZ A;  2L32 A;  1RRB A;  4IOI E;  2K8B A;  3RMK C;  2M1M A;  1VCB A;  4ICV A;  4RM9 A;  1SJH D;  4FJY A;  3N3K B;  2K3U A;  4KKJ A;  5T8I A;  2VRR B;  3BK2 A;  1XXG A;  4DDG D;  4YT0 B;  2DZJ A;  2LVP A;  3VTW A;  2N1V A;  2G45 B;  4KDI C;  4NAW A;  4YL8 A;  2NPT B;  4TMA B;  2FUH B;  2L7R A;  3DQV A;  4EZK A;  1WE6 A;  1FFV A;  1TYG B;  3MHZ A;  3HK0 A;  4TV3 A;  2J42 A;  3J9C A;  2KQ7 A;  2DYB A;  2KWV B;  1SE9 A;  3R3M A;  1Y8R C;  3A1Q A;  3GE8 C;  2M8S A;  3V05 A;  4S0R A;  4YSX B;  1B1Z A;  4KKI A;  1F77 A;  3TMP B;  2IO1 B;  2LGI A;  2O2V A;  2C7M B;  4PYU A;  3APC A;  3VH3 B;  2MJE A;  4KIK B;  1NYR A;  1N62 A;  2GB1 A;  1TS5 A;  4TSS A;  2WU2 B;  3V6C B;  3KH0 A;  4PS8 A;  3L10 B;  3RI7 C;  1LO5 D;  2WXF A;  3Q69 A;  1CMX B;  4DDI D;  4IUM B;  2ZW1 A;  2XK5 A;  4C4V B;  3RPF C;  4NQK E;  2LJ5 A;  3QIJ A;  1VRA B;  1ZDV A;  1F2R C;  1QZE A;  1WGY A;  3QQ8 B;  4X57 B;  2EMS A;  1LQB A;  4I6N B;  3OJ4 B;  3DVN U;  3LB8 C;  4BVU C; 
#chains in the Genus database with same CATH homology
 1ZW7 A;  3H7S A;  5D2M B;  1E7V A;  3ZTD A;  2RD0 A;  5DCN A;  3MJW A;  4AJW A;  2BKF A;  2HD5 B;  5AEK B;  1HE8 A;  2KO3 A;  2JT4 B;  4GSW A;  4A20 A;  3H1U A;  2JVC A;  2IO2 B;  3M63 B;  2KMA A;  4GIV A;  1V6E A;  4BOZ B;  4TQ1 A;  2NBW B;  1Q5W B;  3D32 A;  3M3J A;  1RAX A;  4WWO A;  1Q0W B;  1LXD A;  1WGD A;  3OAW A;  3SD5 A;  2MLB A;  2O6V B;  4PS7 A;  3EEC A;  4MGK E;  3PS6 A;  2R2O A;  2NBV B;  4W9F A;  2V1Y A;  1WXS A;  4WWN A;  1X1M A;  4GDL A;  2KWU B;  2MW5 A;  2LI5 A;  1KOT A;  3AI5 A;  4FJZ A;  2MQJ A;  3QHT A;  2BF8 B;  4AWJ A;  2L05 A;  4MGI E;  2FID A;  2AYO B;  1RFA A;  2MBE A;  5CX3 A;  3UIO B;  4E71 A;  2RPQ A;  5JH5 C;  1ZGU B;  2KXJ A;  3HM3 A;  1UBI A;  3JW0 X;  2KWC A;  5E6O A;  1IPG A;  1WIA A;  2MA9 B;  3ONS A;  5L95 C;  3A1Q B;  1R4N I;  2BYV E;  2FCS A;  2WX0 A;  3HIZ A;  2RSU A;  2N1W A;  5IAA C;  4EEW A;  1UBQ A;  1JRU A;  2KTR A;  5G55 A;  5LXH A;  2N7D A;  5C1Z A;  2GBJ A;  2O2V B;  4EZJ A;  1K8R B;  4FHK A;  1J19 A;  5C23 A;  4LJP B;  4FBJ B;  2DHZ A;  3ALB A;  4W9D A;  2PE9 A;  1WJU A;  2KK8 A;  4MGY E;  2NS5 A;  3ZUN A;  2CS4 A;  3N32 A;  4FHJ A;  2Y5B B;  5CHF A;  4FUL A;  1RLF A;  5KHO A;  3DPD A;  2IZV B;  5D6J B;  2MCN B;  2M4N A;  3A9J A;  4LDT B;  3RT3 B;  2WDT B;  3PLV A;  4ICU A;  1WMH B;  3W1S A;  1OTR B;  4GGQ A;  1SGH A;  2FCM A;  3AXC A;  4W9L A;  1WJ4 A;  2IO3 B;  1E8Z A;  2FCN A;  3X23 A;  3H7P B;  1R4M I;  2IYD B;  1WJ6 A;  3JYU A;  1YX5 B;  1XT9 B;  2R2Q A;  4BKS D;  4HCP B;  3QAR A;  1GNU A;  3CMM B;  4GB9 A;  4IW0 A;  3JSV A;  2BWF A;  4IM3 A;  4PYZ A;  2UYZ B;  2ASQ A;  2V4L A;  1V86 A;  1E8Y A;  2IY1 B;  1WZ3 A;  2KN5 A;  2DYM A;  3NZS A;  4WQO B;  5FR6 A;  2AL6 A;  2L0T A;  4G50 A;  1SIF A;  3H7P A;  4NAW B;  4ZRI A;  1LFD A;  2L8J A;  5CHW A;  2C9W B;  2C7N B;  3VXW A;  3NS8 A;  4HVB A;  3IBE A;  3NY5 A;  3V6E B;  1F9J A;  4KSK C;  2LVO A;  4TKN A;  2LUE A;  2HTH A;  3VUW A;  4KIK A;  4CO7 A;  3ZVV A;  1P1A A;  2KDB A;  2CHZ A;  5DPS A;  2JPH A;  3IG3 A;  1WE7 A;  1WXA A;  2MSE D;  4FA6 A;  4AUQ C;  3ZNH B;  1UH6 A;  2LRW A;  4IWP A;  3UF8 A;  3VTU A;  3VVW B;  4E74 A;  2DZM A;  3NZU A;  1WM2 A;  3DBH I;  4HPL B;  4MJS A;  2BYF A;  3NHE B;  4KV2 A;  2KD0 A;  2N4F A;  2XBB C;  3KUC B;  4M0W B;  3WAO A;  5DPR A;  3QAQ A;  4DHJ D;  3RYT A;  2N9P C;  4KVG B;  3I3T B;  4MSQ B;  3UQB A;  3PSE B;  4HJK A;  3ZW3 A;  4G0N B;  4EUT A;  2LZ6 A;  2MBO A;  3BIN A;  1KJT A;  3DCG A;  3UIN B;  1Z5S B;  2JRI B;  5LLI A;  2B3A A;  3VAW A;  4BKS A;  2LGX A;  1YJ1 A;  2MP2 B;  2ZVN A;  3ECI A;  4K1R B;  1V49 A;  2O6V D;  3APD A;  4W9J A;  1ISN A;  1H8C A;  4CHK A;  5D94 A;  5L83 A;  4M8M A;  4M8N A;  4BKG A;  4MJS B;  3Q3J A;  4IWQ A;  4ANV A;  4MSM B;  2HJ8 A;  3WIM A;  3IFW B;  3BY4 B;  3ENE A;  3X0W A;  1YIW A;  3PHX B;  1YD8 U;  2KC2 A;  2CU1 A;  4ZRJ A;  3W1S C;  2RR9 A;  3U7D A;  2LGY A;  5LXI B;  4MGZ E;  2EKE C;  2D11 A;  1E8X A;  3PVL A;  3H6N A;  3L0W B;  3EC8 A;  1BT0 A;  3H9D A;  4E3C A;  1WYW B;  3KW5 B;  3DVN V;  4BBN C;  4NNJ B;  5HKH A;  4FLH A;  2DYO A;  3ML9 A;  2IY0 B;  4GN1 A;  1WR1 A;  2XK5 B;  2KLG A;  3QJZ A;  2A5U A;  4GDK A;  1OEY J;  3QC8 B;  1UEL A;  3PPA A;  4ASW C;  3QCA A;  3O65 B;  1ZKH A;  3SU8 X;  4BBN F;  2BPS A;  1V2Y A;  1S3S G;  2D3G A;  4A3O A;  4FJV B;  1XQQ A;  3L54 A;  3C0R B;  4W9I A;  2DAJ A;  4CYE A;  1J0G A;  4LJO B;  2V3S A;  4N9F 4;  3VUY A;  1D3Z A;  4WJO A;  2IO0 B;  2GMI C;  4TQ0 A;  3L08 A;  5JZE B;  5CTR C;  1GJZ A;  3L13 A;  2JRH A;  1GUA B;  1E90 A;  2ZCB A;  4I6P A;  1NBF C;  4WAA A;  3WAL A;  4RM8 A;  1WMH A;  3KUZ A;  4HDQ A;  2G4S A;  3QWZ B;  3RD2 A;  4KZ0 A;  3ZKJ C;  3ZO5 B;  1OEY A;  2RGF A;  2DX5 B;  5DPT A;  2K8C A;  1WI0 A;  2ZCC A;  1WFY A;  2N9E B;  3V62 A;  3A33 B;  4HXD A;  2K8H A;  3B1L X;  3QA8 A;  3DVG Y;  2OJR A;  2ZJD A;  3WA0 A;  2DAF A;  2YLM A;  2IBI B;  1V5T A;  2EMT A;  3A4R A;  2LAS A;  2LRU A;  2BWE S;  2KOX A;  4NJ7 A;  3B08 A;  5D7G A;  3ML8 A;  3T9L A;  1A5R A;  1I35 A;  2PE6 B;  2KX3 A;  2KX0 A;  2AEH A;  2L3Z A;  4ANX A;  4IC7 B;  5E6P A;  2MBB B;  2K6Q A;  4WWP A;  2HE7 A;  1WX7 A;  3PLU A;  1P3Q U;  2I1K A;  5AZH A;  4HPM B;  3R7R A;  3Q3F A;  2M0X A;  4DHJ B;  2CR5 A;  2FNJ B;  2G4D B;  4P7I A;  2NR2 A;  3TBL D;  3NOB A;  2CHW A;  5J18 A;  2CKH B;  1WX9 A;  2CHX A;  4JL9 A;  3ZDT A;  2FIF A;  2GBM A;  2JZZ A;  2PJH A;  2KFK A;  3ZRC A;  4F7Z A;  1Z2M A;  2J0M A;  2NBU A;  2ZPN A;  4FN2 A;  2I1J A;  1M94 A;  2K39 A;  5G2N A;  2KJR A;  2ZNV C;  3PZD A;  3SDL C;  3P2B A;  3KYC D;  4DHZ B;  5AZG A;  1E5W A;  2MWS B;  4NQL B;  4K7S A;  4WJN A;  3VHT C;  3KUD B;  2YVC A;  2KZR A;  5CHV C;  2LVQ A;  4B9K A;  3W1Y A;  3AU5 A;  3DVG X;  2AL3 A;  4EZL A;  3PGE A;  3UQA A;  1WGR A;  4G11 A;  2KDF B;  5E6N A;  1GC7 A;  5AZF A;  1C1Y B;  2M17 A;  2N9X A;  3DBS A;  1V81 A;  4W9C A;  1WGH A;  4MEL A;  4B95 A;  2DZK A;  3AUL A;  4G3X B;  2NPT A;  4AJY B;  4W9G A;  4ZYN A;  1WX8 A;  1J8C A;  2JZ3 B;  2KQS A;  4DBG A;  1TGZ B;  2XEW A;  4AOF A;  5DPW A;  3KYD D;  2K25 A;  2KAN A;  3GZN I;  1WM3 A;  3JVZ X;  1YX6 B;  1L2N A;  1S1Q B;  1WF9 A;  2KJH B;  2MRP A;  2J0K A;  2L76 A;  2QHO A;  4IM2 A;  2Z59 B;  4OVV A;  4JQW C;  5GMV A;  3HHM A;  1C3T A;  3A4S C;  4IG7 B;  3VUX A;  4XZ4 A;  3A9K B;  3DOW A;  3M62 B;  2MP2 A;  1T0Y A;  1WY8 A;  2LXC A;  4MH0 E;  4URK A;  1Q1O A;  2DZI A;  5J2R A;  1G6J A;  3T8M A;  2WWZ A;  4DXA B;  3ZNG C;  4KSL C;  3LJ3 A;  4BFR A;  3K9P B;  3AU4 A;  4TUU A;  3UGB B;  1LM8 B;  3VH4 B;  1GC6 A;  4MEM A;  2ZNV B;  4EKU A;  4JLC A;  5IA7 A;  1WXM A;  4KZC A;  4F8C B;  2NCN A;  4KDL B;  2MBQ A;  3B0A A;  4NY0 A;  2JXX A;  3ZNZ B;  4EOY A;  4HLE A;  3HM6 X;  3MHS D;  4WJQ A;  3DBL I;  1YQB A;  3KVF B;  4W9H A;  2Z0D B;  4J6I A;  2PEA A;  2FAZ A;  1TTN A;  3UIP B;  5J17 A;  4HK2 A;  3A9K A;  4DK5 A;  5BO4 B;  1WH3 A;  2KDI A;  2KJ6 A;  3TJP A;  3ZDM C;  3TIX A;  4B6W A;  1V80 A;  3RUI B;  1H4R A;  1WJN A;  2ZVO A;  4II3 B;  2KLC A;  4WJP A;  3SHQ A;  3OJ3 A;  1UZX B;  3QK0 A;  4K81 A;  2BKR B;  2L00 B;  3IHP C;  2A4Z A;  4W9K A;  1EUV B;  1WR6 E;  2NVU I;  2LWP A;  4ZDV A;  3MTN B;  2JWZ A;  1OGW A;  1RRB A;  1EO6 A;  2K8B A;  1VD2 A;  2M1M A;  1VCB A;  2K6D B;  1UGM A;  2ZPY A;  1PQS A;  3N30 A;  4ICV A;  4RM9 A;  4FJY A;  3L17 A;  3WAN A;  1V5O A;  3N3K B;  3RZF A;  3VFK A;  1WRD B;  2VRR B;  1FXT B;  4GOC A;  4GXB A;  1E7U A;  1EF1 A;  3IVF A;  4NJ6 A;  4NPN A;  1XD3 B;  2GOW A;  4GDK B;  2K1F A;  4DDG D;  1UD7 A;  2C60 A;  2PPH A;  5TR5 A;  3OLM D;  3WAM A;  2KVR A;  3ZLZ A;  2DZJ A;  2LVP A;  3PRE A;  4ANU A;  3VTW A;  2N1V A;  2G45 B;  4KDI C;  4NAW A;  4YL8 A;  3L16 A;  4LDT D;  2NPT B;  1NDD A;  1I42 A;  3DBR I;  2FUH B;  2KTF A;  2L7R A;  3DQV A;  1NI2 A;  4EZK A;  2LXA A;  4W9E A;  1WE6 A;  2C5L C;  3ZRF A;  4BOS C;  2LGD A;  2UWQ A;  3VDZ A;  3S2A A;  3CF6 E;  2BGF A;  4ZRK A;  1P98 A;  3HK0 A;  2JUO A;  2N7E A;  4TV3 A;  2WX1 A;  4AP4 C;  1TZ1 A;  3EFU A;  3K9O B;  3PV1 A;  3PTF C;  2KQ7 A;  3PT2 B;  4GU2 A;  1P0R A;  2OOB B;  2KDE B;  4A3P A;  4EFO A;  2KTR B;  4FAD A;  1E8W A;  2DYB A;  3RUL A;  2KWV B;  1SE9 A;  3EHV A;  3LDZ E;  3PHW B;  3R3M A;  1IP9 A;  2REX A;  3A9J B;  4OVU A;  3APF A;  3ZIM A;  1MG8 A;  1P9D U;  2GBK A;  4HWI B;  1Y8R C;  1GG3 A;  1WGG A;  1WZ0 A;  3A1Q A;  3DDC B;  3QX1 A;  2KC1 A;  2D2Q A;  2M8S A;  2L0F A;  3TL5 A;  1WXV A;  3RZW C;  4RMA A;  4K7W A;  2KKC A;  4I6L B;  3M95 A;  2KFK B;  3TMP B;  1KM7 A;  5EDS A;  4XX5 A;  1V9J A;  3RCZ A;  2KNB A;  3U8Z A;  3V61 A;  2DEN B;  2GBR A;  2IO1 B;  3PRM B;  2GBN A;  3V60 A;  2O2V A;  3WAP A;  3R7Q A;  4GDL B;  3ZNI D;  2FCQ A;  2ZZP B;  4K7U A;  2D07 B;  1TBE A;  3GOE A;  2C7M B;  4DHZ E;  4PYU A;  2O6V A;  3APC A;  3VH3 B;  5JHB A;  4HCN B;  4KIK B;  4II2 B;  1KLV A;  4MDK E;  1U4A A;  3CSF A;  2LD9 A;  5JHA A;  2J0J A;  2ZEQ A;  2G3Q B;  2WYQ A;  3V6C B;  2W9N A;  4IM0 A;  3KH0 A;  4PS8 A;  2KFJ A;  2MBH A;  4MM3 A;  4PS3 A;  4GMV A;  3TCA A;  4BKT A;  4JIO U;  3PRP B;  4HDO A;  3VTV A;  3L10 B;  2C7H A;  3VQI A;  1EF5 A;  4IWO A;  3U30 A;  1CMX B;  4DDI D;  4IUM B;  2XK5 A;  2JF5 A;  4NQK E;  2LJ5 A;  4DWF A;  3QIJ A;  2MX2 A;  2Z0E B;  2D10 A;  1QZE A;  3PRZ A;  4F1S A;  5KHQ A;  2J7Q B;  2AWT A;  1OQY A;  1WGY A;  2BYE A;  2KHW B;  3ZTC A;  3QQ8 B;  4X57 B;  4ANW A;  1IYF A;  2EMS A;  3CST A;  1LQB A;  4I6N B;  2JY6 A;  3OJ4 B;  3JSV B;  3DVN U;  3R66 C;  2KMC A;  1AAR A;  4JGH B;  4LCD E;  4XC2 A;  4BVU C;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...