2LGYA

Ubiquitin-like domain from hoil-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
b'MPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title Solution structure of the E3 ligase HOIL-1 Ubl domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lgyA00
2CHXA 4W9IA 2KDEB 2KZRA 3PS6A 1LFDA 3KUZA 1X1MA 1WR1A 4AOFA 3LJ3A 4N9F4 1ZKHA 5E6NA 2KLGA 4NQKE 1J19A 1P3QU 2JF5A 2LZ6A 1WX7A 4ICVA 5IA7A 2FCNA 2AYOB 2LUEA 4LDTD 1YQBA 2K39A 2LASA 4PS3A 3SU8X 4FADA 2UYZB 3PZDA 4ANUA 3V6EB 5DPTA 2GOWA 3M63B 2MBEA 2IYDB 4MGIE 4BKSA 2Z0EB 2N1VA 2ZCBA 2AL6A 3ZUNA 4LJPB 3ZRFA 2HD5B 1GNUA 1LQBA 2WYQA 3V6CB 3A33B 4HDOA 3MHSD 4DDGD 4NPNA 5C1ZA 2KK8A 3EHVA 2ZNVB 3LDZE 2FUHB 3SDLC 2NBUA 1K8RB 4NJ7A 2MX2A 3IG3A 2KC2A 2KC1A 2LRUA 2LVQA 2QHOA 4GDLA 4PYZA 3B1LX 1WFYA 3QJZA 2DYMA 4DDID 4PS8A 2N7EA 2FAZA 2LD9A 4KIKB 3H1UA 2KANA 4KV2A 1XT9B 2Z59B 2W9NA 3L16A 3IBEA 4I6PA 5AZFA 2KMCA 2KTFA 3R66C 4E71A 3TJPA 4HVBA 2NVUI 2DENB 1H8CA 3PLUA 1UGMA 5C23A 1E7UA 3BY4B 4WJNA 2ZZPB 1WMHB 3VH3B 3PV1A 1V5TA 2BYFA 2GBMA 1UD7A 2KJRA 1OQYA 2C7MB 1TBEA 3NOBA 2HJ8A 3U30A 2IY1B 1UBIA 2PEAA 3N3KB 1SIFA 3NZSA 1WX8A 1UH6A 3VUXA 3PREA 1GC7A 3ZNGC 3VDZA 4WWNA 2V4LA 4HDQA 3DVNU 2MBBB 3D32A 2ZPNA 1M94A 3PHWB 2KNBA 4TUUA 1YJ1A 4MGZE 3HK0A 3JSVA 4WJOA 4NAWB 4K1RB 2MWSB 2K8CA 3RULA 2A4ZA 2J0MA 3U8ZA 2J7QB 3MTNB 2C7NB 4XC2A 3SD5A 2BKRB 4A20A 3VTUA 3AULA 2A5UA 2O6VB 3A9JA 3B0AA 2ZEQA 3HHMA 4AWJA 4TV3A 4DK5A 3ONSA 2L3ZA 4AUQC 2R2OA 1I42A 3Q3FA 2KLCA 3H7SA 2K6QA 4B6WA 4J6IA 3A9KB 2LXCA 1UELA 3WAPA 5LLIA 4GB9A 4ANWA 3IFWB 2MW5A 2LWPA 3DVGY 1OTRB 2RSUA 2KTRB 1XD3B 2GMIC 3NZUA 2IO0B 4PYUA 2N9XA 1WGRA 4KZ0A 3APFA 2MBHA 2VRRB 3W1YA 5JHBA 1WH3A 4NQLB 1KOTA 4I6LB 2WX1A 1AARA 3M3JA 3EC8A 5CTRC 4FBJB 5LXIB 3H7PB 4FHJA 3HM3A 2D3GA 4GDKA 4W9JA 2JPHA 2DAFA 4GIVA 3DQVA 2KN5A 2KXJA 2O2VB 2WDTB 1ZW7A 3WA0A 4F1SA 4WWPA 3VXWA 2BYEA 4K7SA 2HE7A 3OJ4B 1YIWA 4BKGA 4DBGA 2KKCA 3PRPB 3RT3B 4IWPA 3PLVA 2K25A 2EKEC 4EKUA 3DOWA 2D07B 3L13A 1WRDB 1WIAA 2KDFB 3APDA 5D6JB 5DCNA 2YLMA 4ZDVA 2DZMA 5JH5C 4MGYE 1OEYA 1WZ3A 1E8WA 2NBWB 3A9JB 4ZRJA 3HM6X 3S2AA 1EF1A 1S3SG 1Z5SB 2KJHB 2NPTA 2AL3A 3DDCB 3L17A 4W9HA 2IZVB 2KX3A 1V6EA 4HCPB 1WX9A 1F9JA 1JRUA 4IM0A 4ANVA 1C1YB 2FIFA 2Z0DB 2M1MA 1P0RA 3DBHI 4RM8A 3T9LA 3ENEA 3UQAA 4IG7B 1G6JA 2CKHB 1HE8A 3A1QA 1LM8B 3ZDMC 1YX6B 3H6NA 1U4AA 4URKA 1KM7A 2JUOA 2IO3B 2KVRA 3ZVVA 3R3MA 1WXVA 1PQSA 3L10B 4KVGB 3QWZB 2O6VD 4FJVB 1ZGUB 3V62A 2NS5A 2DHZA 2CHZA 4FULA 4JLCA 4X57B 1RAXA 3ZO5B 3KYDD 5KHOA 3HIZA 1WGYA 2FCQA 3APCA 4E3CA 1V2YA 4GMVA 5J17A 4HCNB 2REXA 3K9OB 5AEKB 4XZ4A 2ZVNA 2MP2A 4I6NB 3WALA 3ZNZB 4TKNA 1TTNA 3KYCD 3QAQA 2B3AA 2JXXA 2KJ6A 2DZIA 4JL9A 4KDLB 2XK5A 3RZWC 3UIPB 2IY0B 3V61A 2KMAA 1L2NA 3VTWA 2K6DB 3VFKA 3UIOB 2LXAA 3VHTC 1XQQA 1E8XA 3CMMB 3ZNHB 2C7HA 2XEWA 1E90A 2L8JA 3EECA 3ML8A 5CX3A 3ALBA 4IUMB 3WIMA 4BVUC 4MJSA 1EUVB 1J8CA 1TGZB 3PPAA 1OEYJ 3UINB 4W9DA 3DVGX 2LRWA 5E6OA 4ZRKA 2ZNVC 4HK2A 4G0NB 3UF8A 1SGHA 4NY0A 2HTHA 2GBNA 3DVNV 2KQ7A 4RMAA 4BOSC 3RCZA 3RYTA 4HWIB 1R4NI 2L00B 3PHXB 4EFOA 3ECIA 2IO1B 4WQOB 4W9CA 4KSLC 1Z2MA 2MQJA 4GOCA 2FIDA 3PSEB 2L0FA 1V49A 2CS4A 1WF9A 3VVWB 3AU4A 2KDIA 2LVPA 4JIOU 4WAAA 4EZJA 2DAJA 1S1QB 4GDLB 4MDKE 4B9KA 1UBQA 4OVVA 4GN1A 4MSQB 1CMXB 4ZRIA 3QHTA 2LGYA 1IP9A 5L83A 4M8MA 5FR6A 2DZKA 1LXDA 4FLHA 2BWES 4DWFA 1IYFA 3OLMD 4IC7B 2J0KA 3A4RA 1RFAA 4MJSB 3VTVA 3QA8A 2RD0A 3VUWA 1OGWA 4DHJB 4HLEA 1SE9A 3KH0A 2G3QB 2L7RA 3ZTCA 1E7VA 2D11A 3UQBA 1V80A 4KZCA 3SHQA 4RM9A 4E74A 2KWVB 1Q0WB 1WJ6A 4FJYA 5D94A 4EZKA 2CU1A 1GC6A 1V86A 3NS8A 2EMTA 4AJWA 1GJZA 3IVFA 4XX5A 3C0RB 3BINA 1E8YA 4GXBA 1WE6A 3L0WB 2RGFA 1MG8A 1WJNA 2NR2A 4G11A 1WYWB 5DPWA 4F7ZA 2G4DB 4IWQA 4BFRA 2EMSA 1WJUA 2JZ3B 5L95C 2GBKA 2N4FA 2Y5BB 1IPGA 4JGHB 4W9EA 3CF6E 3NY5A 2BGFA 4GSWA 1WXSA 3JSVB 5DPRA 3M62B 3CSTA 5TR5A 2BWFA 3TIXA 4BBNC 2LVOA 1NBFC 1E5WA 5KHQA 3H9DA 4EEWA 4EZLA 2KD0A 3UGBB 4G3XB 2L76A 1H4RA 2WWZA 3KW5B 4HPMB 4BKSD 2JZZA 2DYBA 4CYEA 4NJ6A 5D7GA 1R4MI 2V1YA 3K9PB 4YL8A 5JHAA 5LXHA 4GU2A 4ANXA 1D3ZA 2KFKA 2IO2B 3ZW3A 2C9WB 2XBBC 5G2NA 2ASQA 3KUDB 3QC8B 3OJ3A 2MBOA 1WJ4A 3R7QA 3QK0A 1J0GA 1KJTA 3B08A 2LGDA 3KUCB 2CR5A 3ZDTA 1V5OA 5HKHA 1NI2A 2J0JA 2L05A 1WXMA 2ZCCA 3PVLA 4IM2A 4K7UA 1WR6E 4GDKB 3TCAA 3VH4B 4KIKA 2L0TA 4MELA 2AEHA 2BYVE 4FHKA 4WWOA 3VAWA 3WAMA 2M0XA 3ZRCA 3ZIMA 4WJPA 2I1KA 1WY8A 3DCGA 1VD2A 2OOBB 3L08A 4MH0E 4DHJD 3PTFC 4G50A 2KX0A 4KDIC 5CHWA 3TBLD 3DBLI 4HJKA 1NDDA 4AP4C 2RPQA 1RLFA 5EDSA 1WMHA 3GZNI 3VUYA 1GUAB 3RUIB 3W1SC 3KVFB 2NPTB 3A4SC 5CHVC 1UZXB 3DPDA 4BKTA 2M4NA 5BO4B 2NCNA 4B95A 2KDBA 3PGEA 2LGXA 2KFKB 1Q1OA 2N1WA 1YD8U 3QX1A 4MM3A 1V81A 1FXTB 2DYOA 2LI5A 4FN2A 2D2QA 4WJQA 4W9LA 2CHWA 3A1QB 4MEMA 2KOXA 3OAWA 2WX0A 2FCSA 4A3PA 3X0WA 2IBIB 2DX5B 4NAWA 2GBRA 1WM2A 3MJWA 2ZJDA 3DBSA 3EFUA 5CHFA 2NBVB 2K8BA 3QARA 2KQSA 2N9PC 2RR9A 2MSED 2JT4B 2V3SA 4II3B 5G55A 3ZLZA 2UWQA 4ASWC 1ISNA 1WGHA 3RD2A 2O6VA 3M95A 3IHPC 3Q3JA 4JQWC 4EUTA 3WAOA 2G45B 4EOYA 4DXAB 3PT2B 2PE6B 2LJ5A 2JRIB 3WANA 2MP2B 1V9JA 4DHZB 3PRZA 2KWUB 3A9KA 2FNJB 3GOEA 2PPHA 2FCMA 4W9KA 2XK5B 3L54A 3ZKJC 2KTRA 4GGQA 4PS7A 1L7YA 2G4SA 3PRMB 2GBJA 3JVZX 3AU5A 4W9FA 4BBNF 2KFJA 2M8SA 2MRPA 3U7DA 3R7RA 3ML9A 1EO6A 4MGKE 3QQ8B 2JWZA 1P9DU 2KHWB 2C60A 4KSKC 3H7PA 3N32A 2JRHA 4FA6A 2O2VA 4F8CB 2YVCA 3V60A 4LDTB 2PE9A 4P7IA 5D2MB 5GMVA 4HXDA 1QZEA 4A3OA 3I3TB 2M17A 5AZHA 4M0WB 2K8HA 2KO3A 3CSFA 1P98A 4IWOA 2MA9B 1WGDA 2AWTA 2C5LC 3JYUA 4HPLB 1WM3A 3RZFA 4OVUA 4M8NA 1WZ0A 2JVCA 4IW0A 2K1FA 2PJHA 5J2RA 2ZVOA 1WI0A 1RRBA 1WE7A 3AXCA 4K81A 5AZGA 1GG3A 3JW0X 3TL5A 1TZ1A 1YX5B 2OJRA 1KLVA 4BOZB 1I35A 2MLBA 2DZJA 5J18A 3QCAA 4CHKA 2BPSA 2MCNB 3ZNID 3QIJA 4MSMB 4NNJB 4TQ0A 1T0YA 2BF8B 4AJYB 4DHZE 2D10A 2N7DA 4LCDE 5E6PA 1A5RA 1BT0A 1WGGA 4FJZA 3W1SA 1E8ZA 4W9GA 4II2B 3P2BA 1P1AA 3DBRI 4ICUA 4TQ1A 4ZYNA 2R2QA 3NHEB 3VQIA 1VCBA 3O65B 2ZPYA 4LJOB 5JZEB 5IAAC 4IM3A 2MBQA 3ZTDA 4CO7A 1EF5A 4K7WA 3TMPB 1C3TA 2BKFA 1Y8RC 3T8MA 3N30A 2I1JA 3AI5A 1Q5WB 2JY6A 3X23A 5DPSA 2KWCA 2N9EB 1WXAA
chains in the Genus database with same CATH superfamily
2BT6A 1X1MA 1WR1A 4OHJA 3LJ3A 4N9F4 2ON8A 2JF5A 2GB1A 5FR3A 1HTQA 5HFYA 2UYZB 2JX5A 1D6EC 1TIFA 3AEFB 2LEKA 1YN3A 4IDIA 2N1VA 3LYYA 4JWSC 1TY0A 4LJPB 3A33B 3MHSD 2KK8A 3EHVA 2ZNVB 3LDZE 3SDLC 1K8RB 1SIJA 3IG3A 2WXQA 4PYZA 1C76A 3B1LX 4H2AA 2DYMA 1WXQA 2GI9A 4A8XC 2FAZA 2LD9A 2KANA 3R2TA 2VH1A 1L4ZB 3LB8C 1BMLC 1IUEA 3IBEA 4I6PA 2Y5PA 2KMCA 3TJPA 1UGMA 3NUHB 2ZZPB 1WMHB 3PV1A 1F0ZA 3BVGA 1N61A 1TBEA 2HJ8A 3MC8A 3N3KB 4LTUA 1AYFA 1SIFA 2PIAA 2K0PA 2V4LA 3DVNU 2ZPNA 3HK0A 2K8CA 1P7FA 1MJDA 4ZYSA 2BKRB 4UDUC 3AULA 2A5UA 3VRBB 3A9JA 3B0AA 3NVZA 4QAYA 3ONSA 1I42A 1N6ZA 2ACZB 4ANWA 2LWPA 2RSUA 2W3SA 5BYSA 4K3BA 2MBHA 2Q5WD 4YTPB 1K52A 3M3JA 3H7PB 2D3GA 3V3XA 4GIVA 3DQVA 2KN5A 2O2VB 4WWPA 3VXWA 3OJ4B 4ZHPA 4LNOA 3RT3B 3ETRA 3PLVA 4EKUA 1HZ6A 4KGTA 4ZDVA 3MC0B 5D6JB 5DCNA 2YLMA 2DZMA 1WZ3A 2WDVB 3A9JB 3HRDD 3HM6X 1S3SG 1Z5SB 1KTKA 2AL3A 4W9HA 1V6EA 3AEGB 1WX9A 1F9JA 1JRUA 3I57A 4ANVA 1KF6B 1C1YB 1J7AA 2M1MA 5E6JA 3T9LA 3UQAA 1G6JA 3ENEA 4IG7B 4US9A 2JYTA 1HE8A 3A1QA 2WXGA 3ZDMC 3AEAB 3H6NA 2XNAC 3ZJTA 2KVRA 4DXGA 1D5XC 1PQSA 3RN9C 3V62A 1ZGUB 1RAXA 3ZO5B 5KHOA 4LNKA 3RI7C 2JU6X 5J17A 4E3CA 4GMVA 2WP9B 4BZAA 2REXA 2ZVNA 1TKGA 1PYWD 2H88B 2IPKD 1TTNA 3QAQA 2JXXA 3RZWC 3UIPB 4B0MA 3EUB2 3VFKA 1NEKB 2LXAA 1FMAD 1D4BA 1WYGA 4MJSA 2NTTA 1F2RC 1OEYJ 3UINB 2QCZA 1XCTL 4HK2A 4G0NB 1SGHA 1TYGB 4N59A 4RMAA 1IGDA 3AV8A 3R2IA 1JWBD 4HWIB 1R4NI 1UWXA 3P42A 3B9JA 3AE5B 2FIDA 1V49A 1WF9A 2BB6A 1DOYA 2LVPA 5IKCM 4L2YA 1KRHA 1CMXB 1QQRA 4ZRIA 2LGYA 2E3TA 1UWMA 5L83A 3AE8B 3AE1B 3VR9B 1KLGD 2BW2A 4IC7B 4AS1A 2I2YA 1E0ZA 4K3CA 4MJSB 2RD0A 4JPSA 1E7VA 2D11A 3RNGC 2CU1A 1GC6A 4XX5A 1E8YA 1WE6A 4DQOC 4REZA 1WYWB 4F7ZA 2EELA 4P1CC 5MPOA 3TEXA 2JZ3B 4XWWA 2GBKA 4LK0M 4P6VF 2N4FA 1IPGA 1R4MB 4JGHB 5BMGA 2BGFA 4BAXA 2AQ3B 3GS2A 2BWFA 3NS1A 3Q14C 2ZW1A 3FILA 1IGCA 2BTEA 2D3BA 4EEWA 3IAM1 2WWZA 2W3RA 3BVMA 4NJ6A 5JHAA 1I4QA 2G1EA 3ZW3A 1SF0A 3KUDB 4C00A 1C77A 1Q10A 3OJ3A 1J0GA 3TEWA 4XGAB 2WU2B 2K3UA 5HKHA 1NI2A 3VH4B 2L0TA 1NVID 1I4RA 1NYQA 2QIEB 1N60A 4MACA 2OOBB 3SR6A 1JRPA 1ACCA 3PTFC 4G50A 3SEBA 4J3OD 2PLPA 4HJKA 1GUAB 3RUIB 1MPEA 1RFKA 2VH2A 3I9V1 5CHVC 2HTME 3AEDB 5BO4B 2DYOA 2D2QA 1F77A 4WJQA 3EGRA 2CHWA 2Y3AA 2KOXA 2FCSA 2IBIB 1WM2A 3IT6B 1C78A 1JWUD 2WXLA 2RR9A 2MSED 2IGGA 5G55A 3ZLZA 1YJJA 3M95A 4MT5A 1L0XB 1M4VA 1HQRD 2LJ5A 2BB5A 2KWUB 3GOEA 2FCMA 3P4PB 2KTRA 4GGQA 4LNIA 1KH0A 3PRMB 1UGJA 4W9FA 4ARCA 2M8SA 2MRPA 4B0EA 1FCLA 4DXFA 2PW9A 2JWZA 2C60A 3H8HA 2JRHA 4FA6A 3ZXVA 2JYEA 2M17A 5TSSA 2RDHA 2AWTA 2C5LC 1JWSD 4OVUA 3HVZA 4IW0A 1ZE3D 3JW0X 3TL5A 1T5XD 2OJRA 2LHEA 2JXTA 2WXFA 2MLBA 1T0YA 3C8YA 3B2FA 4FJZA 3MC9A 3P2BA 1P1AA 4ZYNA 3RFZB 3L4PA 4LJOB 2ZPYA 5JZEB 2J52A 5IAAC 3IXSA 3ZTDA 2SEBD 4CO7A 3DHGC 3CWIA 1FXIA 3AI5A 5C2TB 4L1BA 2JY6A 1MHHE 4P16A 1OQQA 2KWCA 2N9EB 2D5GA 2CHXA 1JW9D 3O13A 4W9IA 2KDEB 2KZRA 3PS6A 4JWUC 2L1AA 1ZKHA 1KFYB 4ICVA 5IA7A 1WX7A 2FCNA 2KN4A 3Q3OC 3SFDB 2K39A 5IO9A 2J42A 1FRRA 2WXIA 3V6EB 1C4CA 1VR9A 5IP4D 2MBEA 4BKSA 2Z0EB 1GNUA 2WNMA 1EWCA 1CJEA 4HDOA 4DDGD 5G5HA 2CJOA 4NJ7A 4HEA1 2LRUA 2LVQA 4GDLA 1WFYA 1XXGA 4PS8A 3H1UA 1PGBA 4KV2A 3UI3A 2Z59B 2LHDA 1R4NB 2IGDA 2KTFA 4E71A 1QOBA 1E7UA 2BS4B 1HZ5A 1UD7A 2KJRA 3I5JC 1OQYA 4LNFA 2QC8A 3AE3B 2WXPA 1UH6A 3VUXA 5HHDG 1GPXA 2MBBB 4MGZE 4WJOA 4NAWB 2DLBA 3RULA 4PT5A 1T6BX 2J0MA 3PZ7A 2SAKA 2WXKA 3OG5A 3MJ5A 3HHMA 4TV3A 4AUQC 2R2OA 3P63A 3Q3FA 2KLCA 4J6IA 4KKIA 2IJ0A 5FKAC 3IFWB 2MW5A 2V0GA 3DVGY 1XD3B 1FNVA 2IO0B 4PYUA 2TSSA 1WGRA 3APFA 2VRRB 4I6LB 2WX1A 3FAHA 1JCKB 2BYEA 4BKGA 1YIWA 3ZGZA 2KKCA 2K25A 3L13A 1E8WA 2NBWB 1A70A 3OWEB 3S2AA 1EF1A 2LGIA 4RGTA 2NPTA 1NENB 4HCPB 2BVCA 4IM0A 1T0RC 2HJ1A 4RM8A 4C4VA 3Q8AA 4JE3B 1KM7A 2JUOA 1EU3A 3ZVVA 1WXVA 5EE0A 3U2SC 3QWZB 4FJVB 2DHZA 4FULA 1MI0A 4JLCA 1TZOA 3HIZA 1TJEA 1VDVA 2DNFA 5AEKB 4I6NB 4TKNA 3KYCD 4JL9A 1XO3A 2KMAA 2L83A 3UIOB 2W55A 2L8JA 3ML8A 4BVUC 2NMQA 1ZP0B 4WQMA 4C7YA 1T3QA 1ZDVA 2MH7A 3DVNV 3RCZA 3RYTA 2L00B 3ECIA 4KSLC 1Z2MA 4GOCA 3N20C 1IBXA 2CS4A 4JIOU 1ESFA 2KVZA 3IAS1 1UBQA 1IP9A 1SJED 4A6QA 2DZKA 2AX5A 3RNEC 4PK1A 4FLHA 1IYFA 3OLMD 1XLNA 3A4RA 3VTVA 3VUWA 4HLEA 2L7RA 1Y56A 2AQ1B 2WXHA 3UQBA 1V80A 3DWMA 4KZCA 4YSXB 1FIQA 4RF0A 4RM9A 2KWVB 4WIPA 2QILA 4EZKA 1V86A 1GJZA 2JWUA 3NJTA 1V97A 4GXBA 1F52A 2G4DB 4IWQA 1WJUA 2Y5BB 1FO4A 3NY5A 3CSTA 5TR5A 1HXYD 1FRDA 4WH4A 2LVOA 5KHQA 3H9DA 4RH6A 1GAQB 3UGBB 2L76A 1H4RA 4BKSD 3KW5B 2DYBA 1JROA 1HEZE 5D7GA 1YQ4B 2V1YA 4GU2A 3NVYA 1YN5A 1JWMD 2M56B 2KFKA 1E6EB 1TY2A 2KACA 3W5VB 2D3AA 1SEBD 1R7SA 2XBBC 1UNSA 5G2NA 2ASQA 2QSDA 1FEHA 3IT4B 1L6VA 3NRZA 3Q3MC 1ZXHA 2LGDA 2CR5A 3LXFA 1V5OA 2V4IB 3PVLA 3GZNB 1YJIA 4KIKA 4MELA 2AEHA 4FHKA 4WWOA 1V1PA 2M0XA 3ZIMA 4WJPA 1HA5A 3DCGA 4DHJD 4KDIC 5CHWA 3TBLD 3DBLI 4WURA 4AP4C 1FNUA 2RPQA 3W9CB 1SE3A 3KVFB 1B9RA 1YOVB 1RWSA 5LNK1 2KFKB 1Q1OA 2N7JA 4MM3A 4FN2A 3A1QB 4MEMA 2WX0A 3BYYB 4M01A 1XLOA 3Q8CA 2NBVB 2OHFA 4ASWC 2O6VA 4JQWC 3WAOA 3URYA 4DXAB 3PT2B 2JRIB 3WANA 4ZHOA 2MHJA 3PRZA 3A9KA 2PPHA 4W9KA 3L54A 3ZKJC 5G5GA 3AU5A 3RMKC 3DWGC 3ML9A 1KLUD 1TS4A 3QQ8B 4XWTA 2X38A 2N9LA 2VZKD 1L5PA 2K22A 5H92C 2YVCA 1K50A 3V05A 2PE9A 5D2MB 4IKGA 4M00A 3U4EG 1WGDA 4O1NA 3JYUA 3RZFA 2PJHA 1L4DB 2ZVOA 3DBRB 1RRBA 1WE7A 2DBYA 2D3CA 5AZGA 1ROEA 1HTOA 1YX5B 3ZQ4A 4ZRPA 2DZJA 3ZNID 4AJYB 1SXTA 2X8XX 3AM9A 1A5RA 4C56C 1E8ZA 1XCQL 2R2QA 3NHEB 1E9MA 3VQIA 4IM3A 2MBQA 1L6UA 3VR8B 4K7WA 3TMPB 2INCC 1RYJA 1C3TA 3T8MA 1WRIA 2I1JA 1MG4A 5DPSA 1QKZA 1WXAA 3NG0A 4LLGM 1LFDA 5BMHA 3KUZA 4AOFA 1EWYC 5E6NA 2HDEA 4NQKE 3Q2AC 3R8BA 1XEEA 4HROA 2WXNA 1J19A 2LZ6A 1I7HA 2AYOB 3FILB 2LUEA 1PGAA 1LO5D 1SB3C 2LASA 3SU8X 2BS2B 4WAFA 1XLQA 1D5MC 2WHIA 2WS3B 1QILA 2IYDB 1PDXA 3ZUNA 2MJEA 2HD5B 2WYQA 3MHZA 4NPNA 5C1ZA 3P1MA 2UU7A 2NBUA 2KC2A 2QHOA 3QJZA 2KDMA 4DDID 1XF5L 4ZOHC 3HUIA 1XT9B 1JMLA 3L16A 3R66C 1WGKA 3Q3NC 3RNBC 2DENB 1H8CA 2INPE 3PLUA 3BY4B 2ICIA 3ZJUA 3VH3B 2PKOA 2G9HD 1V5TA 2LGSA 2C7MB 3U30A 1UBIA 3Q8BA 3TSSA 1YNTE 1WX8A 3P4SB 3VDZA 4WWNA 2K9XA 4HDQA 3PHWB 3JSVA 4K1RB 3ZJVA 2E6XA 2J53A 2J7QB 3MTNB 4XC2A 3CIRB 3SD5A 2ZEQA 4AWJA 2L3ZA 4B6WA 3H7SA 2MEKA 5BYRA 4YSZB 2LXCA 3NZUA 2KTRB 2GMIC 3TEZA 2N9XA 1FPYA 3W1YA 1K51A 4NQLB 1KOTA 1AARA 5LXIB 3EC8A 4FBJB 2KQ4X 3PO0A 3WCQA 4FHJA 3HM3A 4GDKA 4HPPA 1ZW7A 5AUKA 4F1SA 1E10A 4DBGA 1RM6C 2V3PA 4IWPA 2EKEC 3RPFC 2WXJA 3DOWA 1WRDB 1WIAA 2KDFB 4RGMA 4MGYE 1OEYA 1VRAB 4ZRJA 2WDRB 3DDCB 2L32A 3L17A 2IZVB 2KX3A 3T3OA 4XDDA 1PGXA 1P0RA 3DBHI 4RF1A 2KWDA 3T3NA 1U4AA 4ARIA 1OQRA 3R3MA 1ZDXA 1CK1A 4HRSA 2IDYA 2O6VD 4TMAB 2CHZA 5JXVA 1UUPA 4RGNA 3BK2A 1TS5A 2GRIA 1V2YA 2M19A 4HCNB 2MP2A 5IOIA 3WALA 2PMVA 1QLBB 1V1OA 4RCOA 2B3AA 4KDLB 2DZIA 2XK5A 3V61A 1L2NA 3VHTC 1E8XA 2XEWA 1J7BA 1E90A 3WIMA 4IUMB 1J8CA 1BUIC 2KT7A 2LJIA 3PPAA 3DVGX 5E6OA 2B76B 3UF8A 4NY0A 2HTHA 2GBNA 2KQ7A 4M0WA 3BYTB 3PHXB 4EFOA 3EFCA 2L0FA 3GP7A 2KDIA 4WAAA 4EZJA 2OEDA 1S1QB 4GDLB 4B9KA 2EKIA 4OVVA 2BBCA 4GN1A 1YMHE 3GB1A 3QHTA 4M8MA 1LXDA 2BWES 4DWFA 2DWQA 4KX6B 4DHJB 1SE4A 3KH0A 1TS2A 3SHQA 4E74A 3PZ8A 5D94A 1ZXIA 4XE0A 1YQ3B 5HG2A 2FBWB 4AJWA 2WXOA 2LFIA 3BINA 1MG8A 1WJNA 2NR2A 5DPWA 3N1YC 2QEJC 1FD6A 4W9EA 3CF6E 4YTNB 3AE6B 3SFEB 1WXSA 3M62B 2J4XA 2GLSA 1C4AA 1B1ZA 1NBFC 1E5WA 4EZLA 2KD0A 3NZ3A 2Y5CA 4G3XB 4HPMB 1ET6A 5H8YE 1FFVA 1R4MI 2L52A 3K9PB 1D3ZA 2OJWA 2C9WB 3R7QA 2MBOA 1KJTA 3KUCB 3AE9B 2WXMA 2J0JA 2L05A 1WXMA 4IM2A 1WR6E 3TCAA 3VAWA 1N5XA 3WAMA 3ZRCA 2VZKB 2I1KA 3L08A 3ABVB 3W2DA 3MFGA 1TS3A 4A90A 5D3IB 1NDDA 4LNNA 5EDSA 1WMHA 3VUYA 1SBBB 1DOIA 5EE1A 1I4HA 2NPTB 3DPDA 4BKTA 2KDBA 1MVKA 1QOFA 1YD8U 1SSNA 3QX1A 1V81A 1FXTB 4C4VB 4A55A 2W82A 3OAWA 1CZPA 4A3PA 2DX5B 1N5WA 2N0SB 2ZJDA 3DBSA 3EFUA 2QMTA 2K8BA 1GB4A 2N9PC 3I63C 2JT4B 2V3SA 4II3B 1FFUA 1JQ4A 3IHPC 2G45B 1T0SC 4EOYA 2PE6B 2FNJB 3N1XC 1L7YA 4N58A 2GBJA 3JVZX 3U7DA 1VZ6A 1EO6A 4MGKE 3FKYA 1P9DU 2KHWB 1ENFA 4KSKC 3H7PA 3AEBB 2O2VA 4CQNA 4P7IA 5GMVA 1QZEA 4A3OA 3I3TB 2KYWA 2K8HA 2KO3A 1P98A 4IWOA 2MA9B 1VLBA 4OZAA 1C79A 1QF6A 1WZ0A 3AEEB 1IBXB 4KGSA 1GG3A 4L23A 1TZ1A 3QCAA 4CHKA 2BPSA 2MCNB 3QIJA 2BYTA 4NNJB 2BF8B 4DHZE 2D10A 5GXGB 3AMZA 4LCDE 1WGGA 1QT9A 1EM7A 3W1SA 4W9GA 4TQ1A 1J7CA 1BXTA 1STEA 4OZBA 1EF5A 2QJLA 3NVWA 3AE2B 3N30A 1Q5WB 3Q69A 3DBHB 1FNWA 1ET9A 3BWUD 5AUIA 2KLGA 1P3QU 1P7EA 4LDTD 1YQBA 2WU5B 4N6EB 4FADA 4PS3A 1WWTA 1NI3A 3PZDA 4ANUA 2I38A 5DPTA 3AH7A 2QDFA 2GOWA 3M63B 4MGIE 5BMIA 2ZCBA 2AL6A 3ZRFA 1LQBA 3V6CB 1DOXA 4OW0A 3B2GA 2FUHB 1MFWA 1OFFA 2MX2A 4US8A 2KC1A 2N7EA 2FUG1 4KIKB 1V1PB 2WGSA 1GB1A 2W9NA 5AZFA 1F2RI 2YEPF 2Z8LA 4HVBA 4ACFA 2NVUI 2INNE 5C23A 4WJNA 3P4RB 2BYFA 2GBMA 3NOBA 2XN9C 2IY1B 2N9KA 2PEAA 4MM3B 3NZSA 3PREA 1GC7A 3ZNGC 3D32A 4OVZA 1M94A 2JQRB 1C9FA 2KNBA 4TUUA 1YJ1A 4OZCA 2MWSB 2LMCA 2A4ZA 3U8ZA 2C7NB 4KKJA 5IN7A 4A20A 3AN1A 3VTUA 2O6VB 3Q8FA 3BVZA 4DK5A 1TT5B 4M02A 2K6QA 3A9KB 1UELA 3WAPA 5LLIA 4GB9A 1OTRB 4P1BC 3ZYYX 1AN8A 2MJ3A 4KZ0A 1DYQA 1FXAA 2PVOD 5I4DA 5JHBA 1WH3A 2INDC 2RDBC 5CTRC 4W9JA 1QOAA 2JPHA 2DAFA 2KXJA 2WDTB 3WA0A 4K7SA 2HE7A 4IOIE 3PRPB 4RFBA 3VRAB 4KGRA 4FXCA 2D07B 5FK9C 4AQ7A 3APDA 5JH5C 1I4XA 2KJHB 3NVVA 1VJKA 1T0QC 2PTLA 2RDGA 4NAMA 2FIFA 2Z0DB 1TKEA 1ZPSA 1YN4A 2CKHB 4JX1C 4YT0B 2CU3A 1LM8B 1FM0D 1YX6B 4URKA 2IO3B 4Q2JA 4NJCA 2NTSA 3L10B 4KVGB 2NS5A 3MP9A 4XDCA 4X57B 3KYDD 3BK1A 1SE2A 1WGYA 2FCQA 3APCA 1L0VB 3K9OB 4XZ4A 3DHIC 3ZNZB 4YWGG 4R3DA 2KJ6A 3E56A 2PVGC 2IY0B 3U52E 1K53A 1E7PB 3VTWA 4WWMA 2K6DB 3BZDB 4A9AA 3Q6BA 1XQQA 3CMMB 3ZNHB 2C7HA 4D2KA 3EECA 5CX3A 2IGHA 3ALBA 3Q8EA 1EUVB 1TGZB 4W9DA 2LRWA 4ZRKA 3RNCC 2ZNVC 3KWVA 4HJGE 4YTMB 4BOSC 3KQ4A 2RMMA 2LUMA 4NZLB 3AB5A 3AE4B 2IO1B 4WQOB 4W9CA 2MQJA 3PSEB 3VVWB 3AU4A 2DAJA 4MDKE 4ZRQA 3ZXRA 1CQVA 4RNAA 3P4QB 4MSQB 5EE3A 1C4PA 2YEPB 3DHHC 4EE2A 1I4GA 4RGOS 5HI1A 4HKZE 5FR6A 2BQQA 3GE8C 1WSPA 4ITKA 2J0KA 3W5UB 1RFAA 1TKYA 3QA8A 1OGWA 1SE9A 2G3QB 3ZTCA 4GLSC 1Q0WB 1WJ6A 4FJYA 1SJHD 3NS8A 2EMTA 3IVFA 3C0RB 3L0WB 2RGFA 4G11A 5BYQA 1EU4A 4BFRA 2EMSA 5L95C 1ZOYB 2RPVA 1FCCC 1ZUD2 2MJDA 4GSWA 1L0YB 3JSVB 5DPRA 4USAA 3TIXA 2ZW0A 4BBNC 2JZPA 1VZ7A 1JALA 2JZZA 4CYEA 4YL8A 1LGRA 3U7ZA 5LXHA 2JSVX 4ANXA 4YXDB 3E9SA 3N9YC 2IO2B 3QC8B 1WJ4A 3QK0A 1F1HA 3DBLB 3B08A 1VZ8A 3ZDTA 2H89B 2K5PA 2ZCCA 4K7UA 3KLSX 4GDKB 5EE9A 2BYVE 1I4PA 2WQYB 1WY8A 1VD2A 4MH0E 2KX0A 2M0AA 4C7ZA 1RLFA 3GZNI 3N1ZC 2ONQA 4S17A 3KWLA 3W1SC 3A4SC 1UZXB 2M4NA 2NCNA 4B95A 3PGEA 2LGXA 3J9CA 2N1WA 4MH8A 1N63A 1XLPA 2LI5A 2WLBA 3TEYA 1MHXA 4W9LA 3TUOA 1QOGA 4HKQA 3RNAC 2W54A 3X0WA 4NAWA 2GBRA 3MJWA 2CJNA 5CHFA 3QARA 1AW7A 5C3JB 2KQSA 1DGJA 1V8CA 2UWQA 1ISNA 1WGHA 3RD2A 3Q3JA 2V9HA 4EUTA 4S0RA 5T8IA 2MP2B 1V9JA 1AWDA 4DHZB 1GOZA 4TSSA 1PUTA 2XK5B 4XYCA 4PS7A 2G4SA 2V3NA 4BBNF 2KFJA 3R7RA 3AECB 3N32A 1D5ZC 4F8CB 3GE3C 3V60A 4LDTB 1PFDA 2KMMA 1N62A 4HXDA 2KAJA 5AZHA 4M0WB 3FC4A 3CSFA 1NYRA 4HPLB 1WM3A 4M8NA 2JVCA 4YSYB 2K1FA 5J2RA 1WI0A 3BIID 3RNFC 3AE7B 3AXCA 4K81A 1KLVA 2WXRA 4BOZB 1I35A 5J18A 4MSMB 4TQ0A 2N7DA 5E6PA 2AQ2B 1BT0A 2BS3B 2R61A 3C19A 4II2B 4ICUA 3DBRI 1VCBA 3O65B 2FE8A 1UF0A 2WDQB 2BKFA 1Y8RC 1JWAD 3HVDA 5D3DA 3X23A 4C80A 3EA6A
chains in the Genus database with same CATH topology
2CHXA 4W9IA 2KDEB 2KZRA 3PS6A 1LFDA 3KUZA 1X1MA 1WR1A 4AOFA 3LJ3A 4N9F4 1ZKHA 5E6NA 2KLGA 4NQKE 1J19A 1P3QU 2JF5A 2LZ6A 1WX7A 4ICVA 5IA7A 2FCNA 2AYOB 2LUEA 4LDTD 1YQBA 2K39A 2LASA 4PS3A 3SU8X 4FADA 2UYZB 3PZDA 4ANUA 3V6EB 5DPTA 2GOWA 3M63B 2MBEA 2IYDB 4MGIE 4BKSA 2Z0EB 2N1VA 2ZCBA 2AL6A 3ZUNA 4LJPB 3ZRFA 2HD5B 1GNUA 1LQBA 2WYQA 3V6CB 3A33B 4HDOA 3MHSD 4DDGD 4NPNA 5C1ZA 2KK8A 3EHVA 2ZNVB 3LDZE 2FUHB 3SDLC 2NBUA 1K8RB 4NJ7A 2MX2A 3IG3A 2KC2A 2KC1A 2LRUA 2LVQA 2QHOA 4GDLA 4PYZA 3B1LX 1WFYA 3QJZA 2DYMA 4DDID 4PS8A 2N7EA 2FAZA 2LD9A 4KIKB 3H1UA 2KANA 4KV2A 1XT9B 2Z59B 2W9NA 3L16A 3IBEA 4I6PA 5AZFA 2KMCA 2KTFA 3R66C 4E71A 3TJPA 4HVBA 2NVUI 2DENB 1H8CA 3PLUA 1UGMA 5C23A 1E7UA 3BY4B 4WJNA 2ZZPB 1WMHB 3VH3B 3PV1A 1V5TA 2BYFA 2GBMA 1UD7A 2KJRA 1OQYA 2C7MB 1TBEA 3NOBA 2HJ8A 3U30A 2IY1B 1UBIA 2PEAA 3N3KB 1SIFA 3NZSA 1WX8A 1UH6A 3VUXA 3PREA 1GC7A 3ZNGC 3VDZA 4WWNA 2V4LA 4HDQA 3DVNU 2MBBB 3D32A 2ZPNA 1M94A 3PHWB 2KNBA 4TUUA 1YJ1A 4MGZE 3HK0A 3JSVA 4WJOA 4NAWB 4K1RB 2MWSB 2K8CA 3RULA 2A4ZA 2J0MA 3U8ZA 2J7QB 3MTNB 2C7NB 4XC2A 3SD5A 2BKRB 4A20A 3VTUA 3AULA 2A5UA 2O6VB 3A9JA 3B0AA 2ZEQA 3HHMA 4AWJA 4TV3A 4DK5A 3ONSA 2L3ZA 4AUQC 2R2OA 1I42A 3Q3FA 2KLCA 3H7SA 2K6QA 4B6WA 4J6IA 3A9KB 2LXCA 1UELA 3WAPA 5LLIA 4GB9A 4ANWA 3IFWB 2MW5A 2LWPA 3DVGY 1OTRB 2RSUA 2KTRB 1XD3B 2GMIC 3NZUA 2IO0B 4PYUA 2N9XA 1WGRA 4KZ0A 3APFA 2MBHA 2VRRB 3W1YA 5JHBA 1WH3A 4NQLB 1KOTA 4I6LB 2WX1A 1AARA 3M3JA 3EC8A 5CTRC 4FBJB 5LXIB 3H7PB 4FHJA 3HM3A 2D3GA 4GDKA 4W9JA 2JPHA 2DAFA 4GIVA 3DQVA 2KN5A 2KXJA 2O2VB 2WDTB 1ZW7A 3WA0A 4F1SA 4WWPA 3VXWA 2BYEA 4K7SA 2HE7A 3OJ4B 1YIWA 4BKGA 4DBGA 2KKCA 3PRPB 3RT3B 4IWPA 3PLVA 2K25A 2EKEC 4EKUA 3DOWA 2D07B 3L13A 1WRDB 1WIAA 2KDFB 3APDA 5D6JB 5DCNA 2YLMA 4ZDVA 2DZMA 5JH5C 4MGYE 1OEYA 1WZ3A 1E8WA 2NBWB 3A9JB 4ZRJA 3HM6X 3S2AA 1EF1A 1S3SG 1Z5SB 2KJHB 2NPTA 2AL3A 3DDCB 3L17A 4W9HA 2IZVB 2KX3A 1V6EA 4HCPB 1WX9A 1F9JA 1JRUA 4IM0A 4ANVA 1C1YB 2FIFA 2Z0DB 2M1MA 1P0RA 3DBHI 4RM8A 3T9LA 3ENEA 3UQAA 4IG7B 1G6JA 2CKHB 1HE8A 3A1QA 1LM8B 3ZDMC 1YX6B 3H6NA 1U4AA 4URKA 1KM7A 2JUOA 2IO3B 2KVRA 3ZVVA 3R3MA 1WXVA 1PQSA 3L10B 4KVGB 3QWZB 2O6VD 4FJVB 1ZGUB 3V62A 2NS5A 2DHZA 2CHZA 4FULA 4JLCA 4X57B 1RAXA 3ZO5B 3KYDD 5KHOA 3HIZA 1WGYA 2FCQA 3APCA 4E3CA 1V2YA 4GMVA 5J17A 4HCNB 2REXA 3K9OB 5AEKB 4XZ4A 2ZVNA 2MP2A 4I6NB 3WALA 3ZNZB 4TKNA 1TTNA 3KYCD 3QAQA 2B3AA 2JXXA 2KJ6A 2DZIA 4JL9A 4KDLB 2XK5A 3RZWC 3UIPB 2IY0B 3V61A 2KMAA 1L2NA 3VTWA 2K6DB 3VFKA 3UIOB 2LXAA 3VHTC 1XQQA 1E8XA 3CMMB 3ZNHB 2C7HA 2XEWA 1E90A 2L8JA 3EECA 3ML8A 5CX3A 3ALBA 4IUMB 3WIMA 4BVUC 4MJSA 1EUVB 1J8CA 1TGZB 3PPAA 1OEYJ 3UINB 4W9DA 3DVGX 2LRWA 5E6OA 4ZRKA 2ZNVC 4HK2A 4G0NB 3UF8A 1SGHA 4NY0A 2HTHA 2GBNA 3DVNV 2KQ7A 4RMAA 4BOSC 3RCZA 3RYTA 4HWIB 1R4NI 2L00B 3PHXB 4EFOA 3ECIA 2IO1B 4WQOB 4W9CA 4KSLC 1Z2MA 2MQJA 4GOCA 2FIDA 3PSEB 2L0FA 1V49A 2CS4A 1WF9A 3VVWB 3AU4A 2KDIA 2LVPA 4JIOU 4WAAA 4EZJA 2DAJA 1S1QB 4GDLB 4MDKE 4B9KA 1UBQA 4OVVA 4GN1A 4MSQB 1CMXB 4ZRIA 3QHTA 2LGYA 1IP9A 5L83A 4M8MA 5FR6A 2DZKA 1LXDA 4FLHA 2BWES 4DWFA 1IYFA 3OLMD 4IC7B 2J0KA 3A4RA 1RFAA 4MJSB 3VTVA 3QA8A 2RD0A 3VUWA 1OGWA 4DHJB 4HLEA 1SE9A 3KH0A 2G3QB 2L7RA 3ZTCA 1E7VA 2D11A 3UQBA 1V80A 4KZCA 3SHQA 4RM9A 4E74A 2KWVB 1Q0WB 1WJ6A 4FJYA 5D94A 4EZKA 2CU1A 1GC6A 1V86A 3NS8A 2EMTA 4AJWA 1GJZA 3IVFA 4XX5A 3C0RB 3BINA 1E8YA 4GXBA 1WE6A 3L0WB 2RGFA 1MG8A 1WJNA 2NR2A 4G11A 1WYWB 5DPWA 4F7ZA 2G4DB 4IWQA 4BFRA 2EMSA 1WJUA 2JZ3B 5L95C 2GBKA 2N4FA 2Y5BB 1IPGA 4JGHB 4W9EA 3CF6E 3NY5A 2BGFA 4GSWA 1WXSA 3JSVB 5DPRA 3M62B 3CSTA 5TR5A 2BWFA 3TIXA 4BBNC 2LVOA 1NBFC 1E5WA 5KHQA 3H9DA 4EEWA 4EZLA 2KD0A 3UGBB 4G3XB 2L76A 1H4RA 2WWZA 3KW5B 4HPMB 4BKSD 2JZZA 2DYBA 4CYEA 4NJ6A 5D7GA 1R4MI 2V1YA 3K9PB 4YL8A 5JHAA 5LXHA 4GU2A 4ANXA 1D3ZA 2KFKA 2IO2B 3ZW3A 2C9WB 2XBBC 5G2NA 2ASQA 3KUDB 3QC8B 3OJ3A 2MBOA 1WJ4A 3R7QA 3QK0A 1J0GA 1KJTA 3B08A 2LGDA 3KUCB 2CR5A 3ZDTA 1V5OA 5HKHA 1NI2A 2J0JA 2L05A 1WXMA 2ZCCA 3PVLA 4IM2A 4K7UA 1WR6E 4GDKB 3TCAA 3VH4B 4KIKA 2L0TA 4MELA 2AEHA 2BYVE 4FHKA 4WWOA 3VAWA 3WAMA 2M0XA 3ZRCA 3ZIMA 4WJPA 2I1KA 1WY8A 3DCGA 1VD2A 2OOBB 3L08A 4MH0E 4DHJD 3PTFC 4G50A 2KX0A 4KDIC 5CHWA 3TBLD 3DBLI 4HJKA 1NDDA 4AP4C 2RPQA 1RLFA 5EDSA 1WMHA 3GZNI 3VUYA 1GUAB 3RUIB 3W1SC 3KVFB 2NPTB 3A4SC 5CHVC 1UZXB 3DPDA 4BKTA 2M4NA 5BO4B 2NCNA 4B95A 2KDBA 3PGEA 2LGXA 2KFKB 1Q1OA 2N1WA 1YD8U 3QX1A 4MM3A 1V81A 1FXTB 2DYOA 2LI5A 4FN2A 2D2QA 4WJQA 4W9LA 2CHWA 3A1QB 4MEMA 2KOXA 3OAWA 2WX0A 2FCSA 4A3PA 3X0WA 2IBIB 2DX5B 4NAWA 2GBRA 1WM2A 3MJWA 2ZJDA 3DBSA 3EFUA 5CHFA 2NBVB 2K8BA 3QARA 2KQSA 2N9PC 2RR9A 2MSED 2JT4B 2V3SA 4II3B 5G55A 3ZLZA 2UWQA 4ASWC 1ISNA 1WGHA 3RD2A 2O6VA 3M95A 3IHPC 3Q3JA 4JQWC 4EUTA 3WAOA 2G45B 4EOYA 4DXAB 3PT2B 2PE6B 2LJ5A 2JRIB 3WANA 2MP2B 1V9JA 4DHZB 3PRZA 2KWUB 3A9KA 2FNJB 3GOEA 2PPHA 2FCMA 4W9KA 2XK5B 3L54A 3ZKJC 2KTRA 4GGQA 4PS7A 1L7YA 2G4SA 3PRMB 2GBJA 3JVZX 3AU5A 4W9FA 4BBNF 2KFJA 2M8SA 2MRPA 3U7DA 3R7RA 3ML9A 1EO6A 4MGKE 3QQ8B 2JWZA 1P9DU 2KHWB 2C60A 4KSKC 3H7PA 3N32A 2JRHA 4FA6A 2O2VA 4F8CB 2YVCA 3V60A 4LDTB 2PE9A 4P7IA 5D2MB 5GMVA 4HXDA 1QZEA 4A3OA 3I3TB 2M17A 5AZHA 4M0WB 2K8HA 2KO3A 3CSFA 1P98A 4IWOA 2MA9B 1WGDA 2AWTA 2C5LC 3JYUA 4HPLB 1WM3A 3RZFA 4OVUA 4M8NA 1WZ0A 2JVCA 4IW0A 2K1FA 2PJHA 5J2RA 2ZVOA 1WI0A 1RRBA 1WE7A 3AXCA 4K81A 5AZGA 1GG3A 3JW0X 3TL5A 1TZ1A 1YX5B 2OJRA 1KLVA 4BOZB 1I35A 2MLBA 2DZJA 5J18A 3QCAA 4CHKA 2BPSA 2MCNB 3ZNID 3QIJA 4MSMB 4NNJB 4TQ0A 1T0YA 2BF8B 4AJYB 4DHZE 2D10A 2N7DA 4LCDE 5E6PA 1A5RA 1BT0A 1WGGA 4FJZA 3W1SA 1E8ZA 4W9GA 4II2B 3P2BA 1P1AA 3DBRI 4ICUA 4TQ1A 4ZYNA 2R2QA 3NHEB 3VQIA 1VCBA 3O65B 2ZPYA 4LJOB 5JZEB 5IAAC 4IM3A 2MBQA 3ZTDA 4CO7A 1EF5A 4K7WA 3TMPB 1C3TA 2BKFA 1Y8RC 3T8MA 3N30A 2I1JA 3AI5A 1Q5WB 2JY6A 3X23A 5DPSA 2KWCA 2N9EB 1WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHX A;  4W9I A;  2KDE B;  2KZR A;  3PS6 A;  1LFD A;  3KUZ A;  1X1M A;  1WR1 A;  4AOF A;  3LJ3 A;  4N9F 4;  1ZKH A;  5E6N A;  2KLG A;  4NQK E;  1J19 A;  1P3Q U;  2JF5 A;  2LZ6 A;  1WX7 A;  4ICV A;  5IA7 A;  2FCN A;  2AYO B;  2LUE A;  4LDT D;  1YQB A;  2K39 A;  2LAS A;  4PS3 A;  3SU8 X;  4FAD A;  2UYZ B;  3PZD A;  4ANU A;  3V6E B;  5DPT A;  2GOW A;  3M63 B;  2MBE A;  2IYD B;  4MGI E;  4BKS A;  2Z0E B;  2N1V A;  2ZCB A;  2AL6 A;  3ZUN A;  4LJP B;  3ZRF A;  2HD5 B;  1GNU A;  1LQB A;  2WYQ A;  3V6C B;  3A33 B;  4HDO A;  3MHS D;  4DDG D;  4NPN A;  5C1Z A;  2KK8 A;  3EHV A;  2ZNV B;  3LDZ E;  2FUH B;  3SDL C;  2NBU A;  1K8R B;  4NJ7 A;  2MX2 A;  3IG3 A;  2KC2 A;  2KC1 A;  2LRU A;  2LVQ A;  2QHO A;  4GDL A;  4PYZ A;  3B1L X;  1WFY A;  3QJZ A;  2DYM A;  4DDI D;  4PS8 A;  2N7E A;  2FAZ A;  2LD9 A;  4KIK B;  3H1U A;  2KAN A;  4KV2 A;  1XT9 B;  2Z59 B;  2W9N A;  3L16 A;  3IBE A;  4I6P A;  5AZF A;  2KMC A;  2KTF A;  3R66 C;  4E71 A;  3TJP A;  4HVB A;  2NVU I;  2DEN B;  1H8C A;  3PLU A;  1UGM A;  5C23 A;  1E7U A;  3BY4 B;  4WJN A;  2ZZP B;  1WMH B;  3VH3 B;  3PV1 A;  1V5T A;  2BYF A;  2GBM A;  1UD7 A;  2KJR A;  1OQY A;  2C7M B;  1TBE A;  3NOB A;  2HJ8 A;  3U30 A;  2IY1 B;  1UBI A;  2PEA A;  3N3K B;  1SIF A;  3NZS A;  1WX8 A;  1UH6 A;  3VUX A;  3PRE A;  1GC7 A;  3ZNG C;  3VDZ A;  4WWN A;  2V4L A;  4HDQ A;  3DVN U;  2MBB B;  3D32 A;  2ZPN A;  1M94 A;  3PHW B;  2KNB A;  4TUU A;  1YJ1 A;  4MGZ E;  3HK0 A;  3JSV A;  4WJO A;  4NAW B;  4K1R B;  2MWS B;  2K8C A;  3RUL A;  2A4Z A;  2J0M A;  3U8Z A;  2J7Q B;  3MTN B;  2C7N B;  4XC2 A;  3SD5 A;  2BKR B;  4A20 A;  3VTU A;  3AUL A;  2A5U A;  2O6V B;  3A9J A;  3B0A A;  2ZEQ A;  3HHM A;  4AWJ A;  4TV3 A;  4DK5 A;  3ONS A;  2L3Z A;  4AUQ C;  2R2O A;  1I42 A;  3Q3F A;  2KLC A;  3H7S A;  2K6Q A;  4B6W A;  4J6I A;  3A9K B;  2LXC A;  1UEL A;  3WAP A;  5LLI A;  4GB9 A;  4ANW A;  3IFW B;  2MW5 A;  2LWP A;  3DVG Y;  1OTR B;  2RSU A;  2KTR B;  1XD3 B;  2GMI C;  3NZU A;  2IO0 B;  4PYU A;  2N9X A;  1WGR A;  4KZ0 A;  3APF A;  2MBH A;  2VRR B;  3W1Y A;  5JHB A;  1WH3 A;  4NQL B;  1KOT A;  4I6L B;  2WX1 A;  1AAR A;  3M3J A;  3EC8 A;  5CTR C;  4FBJ B;  5LXI B;  3H7P B;  4FHJ A;  3HM3 A;  2D3G A;  4GDK A;  4W9J A;  2JPH A;  2DAF A;  4GIV A;  3DQV A;  2KN5 A;  2KXJ A;  2O2V B;  2WDT B;  1ZW7 A;  3WA0 A;  4F1S A;  4WWP A;  3VXW A;  2BYE A;  4K7S A;  2HE7 A;  3OJ4 B;  1YIW A;  4BKG A;  4DBG A;  2KKC A;  3PRP B;  3RT3 B;  4IWP A;  3PLV A;  2K25 A;  2EKE C;  4EKU A;  3DOW A;  2D07 B;  3L13 A;  1WRD B;  1WIA A;  2KDF B;  3APD A;  5D6J B;  5DCN A;  2YLM A;  4ZDV A;  2DZM A;  5JH5 C;  4MGY E;  1OEY A;  1WZ3 A;  1E8W A;  2NBW B;  3A9J B;  4ZRJ A;  3HM6 X;  3S2A A;  1EF1 A;  1S3S G;  1Z5S B;  2KJH B;  2NPT A;  2AL3 A;  3DDC B;  3L17 A;  4W9H A;  2IZV B;  2KX3 A;  1V6E A;  4HCP B;  1WX9 A;  1F9J A;  1JRU A;  4IM0 A;  4ANV A;  1C1Y B;  2FIF A;  2Z0D B;  2M1M A;  1P0R A;  3DBH I;  4RM8 A;  3T9L A;  3ENE A;  3UQA A;  4IG7 B;  1G6J A;  2CKH B;  1HE8 A;  3A1Q A;  1LM8 B;  3ZDM C;  1YX6 B;  3H6N A;  1U4A A;  4URK A;  1KM7 A;  2JUO A;  2IO3 B;  2KVR A;  3ZVV A;  3R3M A;  1WXV A;  1PQS A;  3L10 B;  4KVG B;  3QWZ B;  2O6V D;  4FJV B;  1ZGU B;  3V62 A;  2NS5 A;  2DHZ A;  2CHZ A;  4FUL A;  4JLC A;  4X57 B;  1RAX A;  3ZO5 B;  3KYD D;  5KHO A;  3HIZ A;  1WGY A;  2FCQ A;  3APC A;  4E3C A;  1V2Y A;  4GMV A;  5J17 A;  4HCN B;  2REX A;  3K9O B;  5AEK B;  4XZ4 A;  2ZVN A;  2MP2 A;  4I6N B;  3WAL A;  3ZNZ B;  4TKN A;  1TTN A;  3KYC D;  3QAQ A;  2B3A A;  2JXX A;  2KJ6 A;  2DZI A;  4JL9 A;  4KDL B;  2XK5 A;  3RZW C;  3UIP B;  2IY0 B;  3V61 A;  2KMA A;  1L2N A;  3VTW A;  2K6D B;  3VFK A;  3UIO B;  2LXA A;  3VHT C;  1XQQ A;  1E8X A;  3CMM B;  3ZNH B;  2C7H A;  2XEW A;  1E90 A;  2L8J A;  3EEC A;  3ML8 A;  5CX3 A;  3ALB A;  4IUM B;  3WIM A;  4BVU C;  4MJS A;  1EUV B;  1J8C A;  1TGZ B;  3PPA A;  1OEY J;  3UIN B;  4W9D A;  3DVG X;  2LRW A;  5E6O A;  4ZRK A;  2ZNV C;  4HK2 A;  4G0N B;  3UF8 A;  1SGH A;  4NY0 A;  2HTH A;  2GBN A;  3DVN V;  2KQ7 A;  4RMA A;  4BOS C;  3RCZ A;  3RYT A;  4HWI B;  1R4N I;  2L00 B;  3PHX B;  4EFO A;  3ECI A;  2IO1 B;  4WQO B;  4W9C A;  4KSL C;  1Z2M A;  2MQJ A;  4GOC A;  2FID A;  3PSE B;  2L0F A;  1V49 A;  2CS4 A;  1WF9 A;  3VVW B;  3AU4 A;  2KDI A;  2LVP A;  4JIO U;  4WAA A;  4EZJ A;  2DAJ A;  1S1Q B;  4GDL B;  4MDK E;  4B9K A;  1UBQ A;  4OVV A;  4GN1 A;  4MSQ B;  1CMX B;  4ZRI A;  3QHT A;  2LGY A;  1IP9 A;  5L83 A;  4M8M A;  5FR6 A;  2DZK A;  1LXD A;  4FLH A;  2BWE S;  4DWF A;  1IYF A;  3OLM D;  4IC7 B;  2J0K A;  3A4R A;  1RFA A;  4MJS B;  3VTV A;  3QA8 A;  2RD0 A;  3VUW A;  1OGW A;  4DHJ B;  4HLE A;  1SE9 A;  3KH0 A;  2G3Q B;  2L7R A;  3ZTC A;  1E7V A;  2D11 A;  3UQB A;  1V80 A;  4KZC A;  3SHQ A;  4RM9 A;  4E74 A;  2KWV B;  1Q0W B;  1WJ6 A;  4FJY A;  5D94 A;  4EZK A;  2CU1 A;  1GC6 A;  1V86 A;  3NS8 A;  2EMT A;  4AJW A;  1GJZ A;  3IVF A;  4XX5 A;  3C0R B;  3BIN A;  1E8Y A;  4GXB A;  1WE6 A;  3L0W B;  2RGF A;  1MG8 A;  1WJN A;  2NR2 A;  4G11 A;  1WYW B;  5DPW A;  4F7Z A;  2G4D B;  4IWQ A;  4BFR A;  2EMS A;  1WJU A;  2JZ3 B;  5L95 C;  2GBK A;  2N4F A;  2Y5B B;  1IPG A;  4JGH B;  4W9E A;  3CF6 E;  3NY5 A;  2BGF A;  4GSW A;  1WXS A;  3JSV B;  5DPR A;  3M62 B;  3CST A;  5TR5 A;  2BWF A;  3TIX A;  4BBN C;  2LVO A;  1NBF C;  1E5W A;  5KHQ A;  3H9D A;  4EEW A;  4EZL A;  2KD0 A;  3UGB B;  4G3X B;  2L76 A;  1H4R A;  2WWZ A;  3KW5 B;  4HPM B;  4BKS D;  2JZZ A;  2DYB A;  4CYE A;  4NJ6 A;  5D7G A;  1R4M I;  2V1Y A;  3K9P B;  4YL8 A;  5JHA A;  5LXH A;  4GU2 A;  4ANX A;  1D3Z A;  2KFK A;  2IO2 B;  3ZW3 A;  2C9W B;  2XBB C;  5G2N A;  2ASQ A;  3KUD B;  3QC8 B;  3OJ3 A;  2MBO A;  1WJ4 A;  3R7Q A;  3QK0 A;  1J0G A;  1KJT A;  3B08 A;  2LGD A;  3KUC B;  2CR5 A;  3ZDT A;  1V5O A;  5HKH A;  1NI2 A;  2J0J A;  2L05 A;  1WXM A;  2ZCC A;  3PVL A;  4IM2 A;  4K7U A;  1WR6 E;  4GDK B;  3TCA A;  3VH4 B;  4KIK A;  2L0T A;  4MEL A;  2AEH A;  2BYV E;  4FHK A;  4WWO A;  3VAW A;  3WAM A;  2M0X A;  3ZRC A;  3ZIM A;  4WJP A;  2I1K A;  1WY8 A;  3DCG A;  1VD2 A;  2OOB B;  3L08 A;  4MH0 E;  4DHJ D;  3PTF C;  4G50 A;  2KX0 A;  4KDI C;  5CHW A;  3TBL D;  3DBL I;  4HJK A;  1NDD A;  4AP4 C;  2RPQ A;  1RLF A;  5EDS A;  1WMH A;  3GZN I;  3VUY A;  1GUA B;  3RUI B;  3W1S C;  3KVF B;  2NPT B;  3A4S C;  5CHV C;  1UZX B;  3DPD A;  4BKT A;  2M4N A;  5BO4 B;  2NCN A;  4B95 A;  2KDB A;  3PGE A;  2LGX A;  2KFK B;  1Q1O A;  2N1W A;  1YD8 U;  3QX1 A;  4MM3 A;  1V81 A;  1FXT B;  2DYO A;  2LI5 A;  4FN2 A;  2D2Q A;  4WJQ A;  4W9L A;  2CHW A;  3A1Q B;  4MEM A;  2KOX A;  3OAW A;  2WX0 A;  2FCS A;  4A3P A;  3X0W A;  2IBI B;  2DX5 B;  4NAW A;  2GBR A;  1WM2 A;  3MJW A;  2ZJD A;  3DBS A;  3EFU A;  5CHF A;  2NBV B;  2K8B A;  3QAR A;  2KQS A;  2N9P C;  2RR9 A;  2MSE D;  2JT4 B;  2V3S A;  4II3 B;  5G55 A;  3ZLZ A;  2UWQ A;  4ASW C;  1ISN A;  1WGH A;  3RD2 A;  2O6V A;  3M95 A;  3IHP C;  3Q3J A;  4JQW C;  4EUT A;  3WAO A;  2G45 B;  4EOY A;  4DXA B;  3PT2 B;  2PE6 B;  2LJ5 A;  2JRI B;  3WAN A;  2MP2 B;  1V9J A;  4DHZ B;  3PRZ A;  2KWU B;  3A9K A;  2FNJ B;  3GOE A;  2PPH A;  2FCM A;  4W9K A;  2XK5 B;  3L54 A;  3ZKJ C;  2KTR A;  4GGQ A;  4PS7 A;  1L7Y A;  2G4S A;  3PRM B;  2GBJ A;  3JVZ X;  3AU5 A;  4W9F A;  4BBN F;  2KFJ A;  2M8S A;  2MRP A;  3U7D A;  3R7R A;  3ML9 A;  1EO6 A;  4MGK E;  3QQ8 B;  2JWZ A;  1P9D U;  2KHW B;  2C60 A;  4KSK C;  3H7P A;  3N32 A;  2JRH A;  4FA6 A;  2O2V A;  4F8C B;  2YVC A;  3V60 A;  4LDT B;  2PE9 A;  4P7I A;  5D2M B;  5GMV A;  4HXD A;  1QZE A;  4A3O A;  3I3T B;  2M17 A;  5AZH A;  4M0W B;  2K8H A;  2KO3 A;  3CSF A;  1P98 A;  4IWO A;  2MA9 B;  1WGD A;  2AWT A;  2C5L C;  3JYU A;  4HPL B;  1WM3 A;  3RZF A;  4OVU A;  4M8N A;  1WZ0 A;  2JVC A;  4IW0 A;  2K1F A;  2PJH A;  5J2R A;  2ZVO A;  1WI0 A;  1RRB A;  1WE7 A;  3AXC A;  4K81 A;  5AZG A;  1GG3 A;  3JW0 X;  3TL5 A;  1TZ1 A;  1YX5 B;  2OJR A;  1KLV A;  4BOZ B;  1I35 A;  2MLB A;  2DZJ A;  5J18 A;  3QCA A;  4CHK A;  2BPS A;  2MCN B;  3ZNI D;  3QIJ A;  4MSM B;  4NNJ B;  4TQ0 A;  1T0Y A;  2BF8 B;  4AJY B;  4DHZ E;  2D10 A;  2N7D A;  4LCD E;  5E6P A;  1A5R A;  1BT0 A;  1WGG A;  4FJZ A;  3W1S A;  1E8Z A;  4W9G A;  4II2 B;  3P2B A;  1P1A A;  3DBR I;  4ICU A;  4TQ1 A;  4ZYN A;  2R2Q A;  3NHE B;  3VQI A;  1VCB A;  3O65 B;  2ZPY A;  4LJO B;  5JZE B;  5IAA C;  4IM3 A;  2MBQ A;  3ZTD A;  4CO7 A;  1EF5 A;  4K7W A;  3TMP B;  1C3T A;  2BKF A;  1Y8R C;  3T8M A;  3N30 A;  2I1J A;  3AI5 A;  1Q5W B;  2JY6 A;  3X23 A;  5DPS A;  2KWC A;  2N9E B;  1WXA A; 
#chains in the Genus database with same CATH topology
 2BT6 A;  1X1M A;  1WR1 A;  4OHJ A;  3LJ3 A;  4N9F 4;  2ON8 A;  2JF5 A;  2GB1 A;  5FR3 A;  1HTQ A;  5HFY A;  2UYZ B;  2JX5 A;  1D6E C;  1TIF A;  3AEF B;  2LEK A;  1YN3 A;  4IDI A;  2N1V A;  3LYY A;  4JWS C;  1TY0 A;  4LJP B;  3A33 B;  3MHS D;  2KK8 A;  3EHV A;  2ZNV B;  3LDZ E;  3SDL C;  1K8R B;  1SIJ A;  3IG3 A;  2WXQ A;  4PYZ A;  1C76 A;  3B1L X;  4H2A A;  2DYM A;  1WXQ A;  2GI9 A;  4A8X C;  2FAZ A;  2LD9 A;  2KAN A;  3R2T A;  2VH1 A;  1L4Z B;  3LB8 C;  1BML C;  1IUE A;  3IBE A;  4I6P A;  2Y5P A;  2KMC A;  3TJP A;  1UGM A;  3NUH B;  2ZZP B;  1WMH B;  3PV1 A;  1F0Z A;  3BVG A;  1N61 A;  1TBE A;  2HJ8 A;  3MC8 A;  3N3K B;  4LTU A;  1AYF A;  1SIF A;  2PIA A;  2K0P A;  2V4L A;  3DVN U;  2ZPN A;  3HK0 A;  2K8C A;  1P7F A;  1MJD A;  4ZYS A;  2BKR B;  4UDU C;  3AUL A;  2A5U A;  3VRB B;  3A9J A;  3B0A A;  3NVZ A;  4QAY A;  3ONS A;  1I42 A;  1N6Z A;  2ACZ B;  4ANW A;  2LWP A;  2RSU A;  2W3S A;  5BYS A;  4K3B A;  2MBH A;  2Q5W D;  4YTP B;  1K52 A;  3M3J A;  3H7P B;  2D3G A;  3V3X A;  4GIV A;  3DQV A;  2KN5 A;  2O2V B;  4WWP A;  3VXW A;  3OJ4 B;  4ZHP A;  4LNO A;  3RT3 B;  3ETR A;  3PLV A;  4EKU A;  1HZ6 A;  4KGT A;  4ZDV A;  3MC0 B;  5D6J B;  5DCN A;  2YLM A;  2DZM A;  1WZ3 A;  2WDV B;  3A9J B;  3HRD D;  3HM6 X;  1S3S G;  1Z5S B;  1KTK A;  2AL3 A;  4W9H A;  1V6E A;  3AEG B;  1WX9 A;  1F9J A;  1JRU A;  3I57 A;  4ANV A;  1KF6 B;  1C1Y B;  1J7A A;  2M1M A;  5E6J A;  3T9L A;  3UQA A;  1G6J A;  3ENE A;  4IG7 B;  4US9 A;  2JYT A;  1HE8 A;  3A1Q A;  2WXG A;  3ZDM C;  3AEA B;  3H6N A;  2XNA C;  3ZJT A;  2KVR A;  4DXG A;  1D5X C;  1PQS A;  3RN9 C;  3V62 A;  1ZGU B;  1RAX A;  3ZO5 B;  5KHO A;  4LNK A;  3RI7 C;  2JU6 X;  5J17 A;  4E3C A;  4GMV A;  2WP9 B;  4BZA A;  2REX A;  2ZVN A;  1TKG A;  1PYW D;  2H88 B;  2IPK D;  1TTN A;  3QAQ A;  2JXX A;  3RZW C;  3UIP B;  4B0M A;  3EUB 2;  3VFK A;  1NEK B;  2LXA A;  1FMA D;  1D4B A;  1WYG A;  4MJS A;  2NTT A;  1F2R C;  1OEY J;  3UIN B;  2QCZ A;  1XCT L;  4HK2 A;  4G0N B;  1SGH A;  1TYG B;  4N59 A;  4RMA A;  1IGD A;  3AV8 A;  3R2I A;  1JWB D;  4HWI B;  1R4N I;  1UWX A;  3P42 A;  3B9J A;  3AE5 B;  2FID A;  1V49 A;  1WF9 A;  2BB6 A;  1DOY A;  2LVP A;  5IKC M;  4L2Y A;  1KRH A;  1CMX B;  1QQR A;  4ZRI A;  2LGY A;  2E3T A;  1UWM A;  5L83 A;  3AE8 B;  3AE1 B;  3VR9 B;  1KLG D;  2BW2 A;  4IC7 B;  4AS1 A;  2I2Y A;  1E0Z A;  4K3C A;  4MJS B;  2RD0 A;  4JPS A;  1E7V A;  2D11 A;  3RNG C;  2CU1 A;  1GC6 A;  4XX5 A;  1E8Y A;  1WE6 A;  4DQO C;  4REZ A;  1WYW B;  4F7Z A;  2EEL A;  4P1C C;  5MPO A;  3TEX A;  2JZ3 B;  4XWW A;  2GBK A;  4LK0 M;  4P6V F;  2N4F A;  1IPG A;  1R4M B;  4JGH B;  5BMG A;  2BGF A;  4BAX A;  2AQ3 B;  3GS2 A;  2BWF A;  3NS1 A;  3Q14 C;  2ZW1 A;  3FIL A;  1IGC A;  2BTE A;  2D3B A;  4EEW A;  3IAM 1;  2WWZ A;  2W3R A;  3BVM A;  4NJ6 A;  5JHA A;  1I4Q A;  2G1E A;  3ZW3 A;  1SF0 A;  3KUD B;  4C00 A;  1C77 A;  1Q10 A;  3OJ3 A;  1J0G A;  3TEW A;  4XGA B;  2WU2 B;  2K3U A;  5HKH A;  1NI2 A;  3VH4 B;  2L0T A;  1NVI D;  1I4R A;  1NYQ A;  2QIE B;  1N60 A;  4MAC A;  2OOB B;  3SR6 A;  1JRP A;  1ACC A;  3PTF C;  4G50 A;  3SEB A;  4J3O D;  2PLP A;  4HJK A;  1GUA B;  3RUI B;  1MPE A;  1RFK A;  2VH2 A;  3I9V 1;  5CHV C;  2HTM E;  3AED B;  5BO4 B;  2DYO A;  2D2Q A;  1F77 A;  4WJQ A;  3EGR A;  2CHW A;  2Y3A A;  2KOX A;  2FCS A;  2IBI B;  1WM2 A;  3IT6 B;  1C78 A;  1JWU D;  2WXL A;  2RR9 A;  2MSE D;  2IGG A;  5G55 A;  3ZLZ A;  1YJJ A;  3M95 A;  4MT5 A;  1L0X B;  1M4V A;  1HQR D;  2LJ5 A;  2BB5 A;  2KWU B;  3GOE A;  2FCM A;  3P4P B;  2KTR A;  4GGQ A;  4LNI A;  1KH0 A;  3PRM B;  1UGJ A;  4W9F A;  4ARC A;  2M8S A;  2MRP A;  4B0E A;  1FCL A;  4DXF A;  2PW9 A;  2JWZ A;  2C60 A;  3H8H A;  2JRH A;  4FA6 A;  3ZXV A;  2JYE A;  2M17 A;  5TSS A;  2RDH A;  2AWT A;  2C5L C;  1JWS D;  4OVU A;  3HVZ A;  4IW0 A;  1ZE3 D;  3JW0 X;  3TL5 A;  1T5X D;  2OJR A;  2LHE A;  2JXT A;  2WXF A;  2MLB A;  1T0Y A;  3C8Y A;  3B2F A;  4FJZ A;  3MC9 A;  3P2B A;  1P1A A;  4ZYN A;  3RFZ B;  3L4P A;  4LJO B;  2ZPY A;  5JZE B;  2J52 A;  5IAA C;  3IXS A;  3ZTD A;  2SEB D;  4CO7 A;  3DHG C;  3CWI A;  1FXI A;  3AI5 A;  5C2T B;  4L1B A;  2JY6 A;  1MHH E;  4P16 A;  1OQQ A;  2KWC A;  2N9E B;  2D5G A;  2CHX A;  1JW9 D;  3O13 A;  4W9I A;  2KDE B;  2KZR A;  3PS6 A;  4JWU C;  2L1A A;  1ZKH A;  1KFY B;  4ICV A;  5IA7 A;  1WX7 A;  2FCN A;  2KN4 A;  3Q3O C;  3SFD B;  2K39 A;  5IO9 A;  2J42 A;  1FRR A;  2WXI A;  3V6E B;  1C4C A;  1VR9 A;  5IP4 D;  2MBE A;  4BKS A;  2Z0E B;  1GNU A;  2WNM A;  1EWC A;  1CJE A;  4HDO A;  4DDG D;  5G5H A;  2CJO A;  4NJ7 A;  4HEA 1;  2LRU A;  2LVQ A;  4GDL A;  1WFY A;  1XXG A;  4PS8 A;  3H1U A;  1PGB A;  4KV2 A;  3UI3 A;  2Z59 B;  2LHD A;  1R4N B;  2IGD A;  2KTF A;  4E71 A;  1QOB A;  1E7U A;  2BS4 B;  1HZ5 A;  1UD7 A;  2KJR A;  3I5J C;  1OQY A;  4LNF A;  2QC8 A;  3AE3 B;  2WXP A;  1UH6 A;  3VUX A;  5HHD G;  1GPX A;  2MBB B;  4MGZ E;  4WJO A;  4NAW B;  2DLB A;  3RUL A;  4PT5 A;  1T6B X;  2J0M A;  3PZ7 A;  2SAK A;  2WXK A;  3OG5 A;  3MJ5 A;  3HHM A;  4TV3 A;  4AUQ C;  2R2O A;  3P63 A;  3Q3F A;  2KLC A;  4J6I A;  4KKI A;  2IJ0 A;  5FKA C;  3IFW B;  2MW5 A;  2V0G A;  3DVG Y;  1XD3 B;  1FNV A;  2IO0 B;  4PYU A;  2TSS A;  1WGR A;  3APF A;  2VRR B;  4I6L B;  2WX1 A;  3FAH A;  1JCK B;  2BYE A;  4BKG A;  1YIW A;  3ZGZ A;  2KKC A;  2K25 A;  3L13 A;  1E8W A;  2NBW B;  1A70 A;  3OWE B;  3S2A A;  1EF1 A;  2LGI A;  4RGT A;  2NPT A;  1NEN B;  4HCP B;  2BVC A;  4IM0 A;  1T0R C;  2HJ1 A;  4RM8 A;  4C4V A;  3Q8A A;  4JE3 B;  1KM7 A;  2JUO A;  1EU3 A;  3ZVV A;  1WXV A;  5EE0 A;  3U2S C;  3QWZ B;  4FJV B;  2DHZ A;  4FUL A;  1MI0 A;  4JLC A;  1TZO A;  3HIZ A;  1TJE A;  1VDV A;  2DNF A;  5AEK B;  4I6N B;  4TKN A;  3KYC D;  4JL9 A;  1XO3 A;  2KMA A;  2L83 A;  3UIO B;  2W55 A;  2L8J A;  3ML8 A;  4BVU C;  2NMQ A;  1ZP0 B;  4WQM A;  4C7Y A;  1T3Q A;  1ZDV A;  2MH7 A;  3DVN V;  3RCZ A;  3RYT A;  2L00 B;  3ECI A;  4KSL C;  1Z2M A;  4GOC A;  3N20 C;  1IBX A;  2CS4 A;  4JIO U;  1ESF A;  2KVZ A;  3IAS 1;  1UBQ A;  1IP9 A;  1SJE D;  4A6Q A;  2DZK A;  2AX5 A;  3RNE C;  4PK1 A;  4FLH A;  1IYF A;  3OLM D;  1XLN A;  3A4R A;  3VTV A;  3VUW A;  4HLE A;  2L7R A;  1Y56 A;  2AQ1 B;  2WXH A;  3UQB A;  1V80 A;  3DWM A;  4KZC A;  4YSX B;  1FIQ A;  4RF0 A;  4RM9 A;  2KWV B;  4WIP A;  2QIL A;  4EZK A;  1V86 A;  1GJZ A;  2JWU A;  3NJT A;  1V97 A;  4GXB A;  1F52 A;  2G4D B;  4IWQ A;  1WJU A;  2Y5B B;  1FO4 A;  3NY5 A;  3CST A;  5TR5 A;  1HXY D;  1FRD A;  4WH4 A;  2LVO A;  5KHQ A;  3H9D A;  4RH6 A;  1GAQ B;  3UGB B;  2L76 A;  1H4R A;  4BKS D;  3KW5 B;  2DYB A;  1JRO A;  1HEZ E;  5D7G A;  1YQ4 B;  2V1Y A;  4GU2 A;  3NVY A;  1YN5 A;  1JWM D;  2M56 B;  2KFK A;  1E6E B;  1TY2 A;  2KAC A;  3W5V B;  2D3A A;  1SEB D;  1R7S A;  2XBB C;  1UNS A;  5G2N A;  2ASQ A;  2QSD A;  1FEH A;  3IT4 B;  1L6V A;  3NRZ A;  3Q3M C;  1ZXH A;  2LGD A;  2CR5 A;  3LXF A;  1V5O A;  2V4I B;  3PVL A;  3GZN B;  1YJI A;  4KIK A;  4MEL A;  2AEH A;  4FHK A;  4WWO A;  1V1P A;  2M0X A;  3ZIM A;  4WJP A;  1HA5 A;  3DCG A;  4DHJ D;  4KDI C;  5CHW A;  3TBL D;  3DBL I;  4WUR A;  4AP4 C;  1FNU A;  2RPQ A;  3W9C B;  1SE3 A;  3KVF B;  1B9R A;  1YOV B;  1RWS A;  5LNK 1;  2KFK B;  1Q1O A;  2N7J A;  4MM3 A;  4FN2 A;  3A1Q B;  4MEM A;  2WX0 A;  3BYY B;  4M01 A;  1XLO A;  3Q8C A;  2NBV B;  2OHF A;  4ASW C;  2O6V A;  4JQW C;  3WAO A;  3URY A;  4DXA B;  3PT2 B;  2JRI B;  3WAN A;  4ZHO A;  2MHJ A;  3PRZ A;  3A9K A;  2PPH A;  4W9K A;  3L54 A;  3ZKJ C;  5G5G A;  3AU5 A;  3RMK C;  3DWG C;  3ML9 A;  1KLU D;  1TS4 A;  3QQ8 B;  4XWT A;  2X38 A;  2N9L A;  2VZK D;  1L5P A;  2K22 A;  5H92 C;  2YVC A;  1K50 A;  3V05 A;  2PE9 A;  5D2M B;  4IKG A;  4M00 A;  3U4E G;  1WGD A;  4O1N A;  3JYU A;  3RZF A;  2PJH A;  1L4D B;  2ZVO A;  3DBR B;  1RRB A;  1WE7 A;  2DBY A;  2D3C A;  5AZG A;  1ROE A;  1HTO A;  1YX5 B;  3ZQ4 A;  4ZRP A;  2DZJ A;  3ZNI D;  4AJY B;  1SXT A;  2X8X X;  3AM9 A;  1A5R A;  4C56 C;  1E8Z A;  1XCQ L;  2R2Q A;  3NHE B;  1E9M A;  3VQI A;  4IM3 A;  2MBQ A;  1L6U A;  3VR8 B;  4K7W A;  3TMP B;  2INC C;  1RYJ A;  1C3T A;  3T8M A;  1WRI A;  2I1J A;  1MG4 A;  5DPS A;  1QKZ A;  1WXA A;  3NG0 A;  4LLG M;  1LFD A;  5BMH A;  3KUZ A;  4AOF A;  1EWY C;  5E6N A;  2HDE A;  4NQK E;  3Q2A C;  3R8B A;  1XEE A;  4HRO A;  2WXN A;  1J19 A;  2LZ6 A;  1I7H A;  2AYO B;  3FIL B;  2LUE A;  1PGA A;  1LO5 D;  1SB3 C;  2LAS A;  3SU8 X;  2BS2 B;  4WAF A;  1XLQ A;  1D5M C;  2WHI A;  2WS3 B;  1QIL A;  2IYD B;  1PDX A;  3ZUN A;  2MJE A;  2HD5 B;  2WYQ A;  3MHZ A;  4NPN A;  5C1Z A;  3P1M A;  2UU7 A;  2NBU A;  2KC2 A;  2QHO A;  3QJZ A;  2KDM A;  4DDI D;  1XF5 L;  4ZOH C;  3HUI A;  1XT9 B;  1JML A;  3L16 A;  3R66 C;  1WGK A;  3Q3N C;  3RNB C;  2DEN B;  1H8C A;  2INP E;  3PLU A;  3BY4 B;  2ICI A;  3ZJU A;  3VH3 B;  2PKO A;  2G9H D;  1V5T A;  2LGS A;  2C7M B;  3U30 A;  1UBI A;  3Q8B A;  3TSS A;  1YNT E;  1WX8 A;  3P4S B;  3VDZ A;  4WWN A;  2K9X A;  4HDQ A;  3PHW B;  3JSV A;  4K1R B;  3ZJV A;  2E6X A;  2J53 A;  2J7Q B;  3MTN B;  4XC2 A;  3CIR B;  3SD5 A;  2ZEQ A;  4AWJ A;  2L3Z A;  4B6W A;  3H7S A;  2MEK A;  5BYR A;  4YSZ B;  2LXC A;  3NZU A;  2KTR B;  2GMI C;  3TEZ A;  2N9X A;  1FPY A;  3W1Y A;  1K51 A;  4NQL B;  1KOT A;  1AAR A;  5LXI B;  3EC8 A;  4FBJ B;  2KQ4 X;  3PO0 A;  3WCQ A;  4FHJ A;  3HM3 A;  4GDK A;  4HPP A;  1ZW7 A;  5AUK A;  4F1S A;  1E10 A;  4DBG A;  1RM6 C;  2V3P A;  4IWP A;  2EKE C;  3RPF C;  2WXJ A;  3DOW A;  1WRD B;  1WIA A;  2KDF B;  4RGM A;  4MGY E;  1OEY A;  1VRA B;  4ZRJ A;  2WDR B;  3DDC B;  2L32 A;  3L17 A;  2IZV B;  2KX3 A;  3T3O A;  4XDD A;  1PGX A;  1P0R A;  3DBH I;  4RF1 A;  2KWD A;  3T3N A;  1U4A A;  4ARI A;  1OQR A;  3R3M A;  1ZDX A;  1CK1 A;  4HRS A;  2IDY A;  2O6V D;  4TMA B;  2CHZ A;  5JXV A;  1UUP A;  4RGN A;  3BK2 A;  1TS5 A;  2GRI A;  1V2Y A;  2M19 A;  4HCN B;  2MP2 A;  5IOI A;  3WAL A;  2PMV A;  1QLB B;  1V1O A;  4RCO A;  2B3A A;  4KDL B;  2DZI A;  2XK5 A;  3V61 A;  1L2N A;  3VHT C;  1E8X A;  2XEW A;  1J7B A;  1E90 A;  3WIM A;  4IUM B;  1J8C A;  1BUI C;  2KT7 A;  2LJI A;  3PPA A;  3DVG X;  5E6O A;  2B76 B;  3UF8 A;  4NY0 A;  2HTH A;  2GBN A;  2KQ7 A;  4M0W A;  3BYT B;  3PHX B;  4EFO A;  3EFC A;  2L0F A;  3GP7 A;  2KDI A;  4WAA A;  4EZJ A;  2OED A;  1S1Q B;  4GDL B;  4B9K A;  2EKI A;  4OVV A;  2BBC A;  4GN1 A;  1YMH E;  3GB1 A;  3QHT A;  4M8M A;  1LXD A;  2BWE S;  4DWF A;  2DWQ A;  4KX6 B;  4DHJ B;  1SE4 A;  3KH0 A;  1TS2 A;  3SHQ A;  4E74 A;  3PZ8 A;  5D94 A;  1ZXI A;  4XE0 A;  1YQ3 B;  5HG2 A;  2FBW B;  4AJW A;  2WXO A;  2LFI A;  3BIN A;  1MG8 A;  1WJN A;  2NR2 A;  5DPW A;  3N1Y C;  2QEJ C;  1FD6 A;  4W9E A;  3CF6 E;  4YTN B;  3AE6 B;  3SFE B;  1WXS A;  3M62 B;  2J4X A;  2GLS A;  1C4A A;  1B1Z A;  1NBF C;  1E5W A;  4EZL A;  2KD0 A;  3NZ3 A;  2Y5C A;  4G3X B;  4HPM B;  1ET6 A;  5H8Y E;  1FFV A;  1R4M I;  2L52 A;  3K9P B;  1D3Z A;  2OJW A;  2C9W B;  3R7Q A;  2MBO A;  1KJT A;  3KUC B;  3AE9 B;  2WXM A;  2J0J A;  2L05 A;  1WXM A;  4IM2 A;  1WR6 E;  3TCA A;  3VAW A;  1N5X A;  3WAM A;  3ZRC A;  2VZK B;  2I1K A;  3L08 A;  3ABV B;  3W2D A;  3MFG A;  1TS3 A;  4A90 A;  5D3I B;  1NDD A;  4LNN A;  5EDS A;  1WMH A;  3VUY A;  1SBB B;  1DOI A;  5EE1 A;  1I4H A;  2NPT B;  3DPD A;  4BKT A;  2KDB A;  1MVK A;  1QOF A;  1YD8 U;  1SSN A;  3QX1 A;  1V81 A;  1FXT B;  4C4V B;  4A55 A;  2W82 A;  3OAW A;  1CZP A;  4A3P A;  2DX5 B;  1N5W A;  2N0S B;  2ZJD A;  3DBS A;  3EFU A;  2QMT A;  2K8B A;  1GB4 A;  2N9P C;  3I63 C;  2JT4 B;  2V3S A;  4II3 B;  1FFU A;  1JQ4 A;  3IHP C;  2G45 B;  1T0S C;  4EOY A;  2PE6 B;  2FNJ B;  3N1X C;  1L7Y A;  4N58 A;  2GBJ A;  3JVZ X;  3U7D A;  1VZ6 A;  1EO6 A;  4MGK E;  3FKY A;  1P9D U;  2KHW B;  1ENF A;  4KSK C;  3H7P A;  3AEB B;  2O2V A;  4CQN A;  4P7I A;  5GMV A;  1QZE A;  4A3O A;  3I3T B;  2KYW A;  2K8H A;  2KO3 A;  1P98 A;  4IWO A;  2MA9 B;  1VLB A;  4OZA A;  1C79 A;  1QF6 A;  1WZ0 A;  3AEE B;  1IBX B;  4KGS A;  1GG3 A;  4L23 A;  1TZ1 A;  3QCA A;  4CHK A;  2BPS A;  2MCN B;  3QIJ A;  2BYT A;  4NNJ B;  2BF8 B;  4DHZ E;  2D10 A;  5GXG B;  3AMZ A;  4LCD E;  1WGG A;  1QT9 A;  1EM7 A;  3W1S A;  4W9G A;  4TQ1 A;  1J7C A;  1BXT A;  1STE A;  4OZB A;  1EF5 A;  2QJL A;  3NVW A;  3AE2 B;  3N30 A;  1Q5W B;  3Q69 A;  3DBH B;  1FNW A;  1ET9 A;  3BWU D;  5AUI A;  2KLG A;  1P3Q U;  1P7E A;  4LDT D;  1YQB A;  2WU5 B;  4N6E B;  4FAD A;  4PS3 A;  1WWT A;  1NI3 A;  3PZD A;  4ANU A;  2I38 A;  5DPT A;  3AH7 A;  2QDF A;  2GOW A;  3M63 B;  4MGI E;  5BMI A;  2ZCB A;  2AL6 A;  3ZRF A;  1LQB A;  3V6C B;  1DOX A;  4OW0 A;  3B2G A;  2FUH B;  1MFW A;  1OFF A;  2MX2 A;  4US8 A;  2KC1 A;  2N7E A;  2FUG 1;  4KIK B;  1V1P B;  2WGS A;  1GB1 A;  2W9N A;  5AZF A;  1F2R I;  2YEP F;  2Z8L A;  4HVB A;  4ACF A;  2NVU I;  2INN E;  5C23 A;  4WJN A;  3P4R B;  2BYF A;  2GBM A;  3NOB A;  2XN9 C;  2IY1 B;  2N9K A;  2PEA A;  4MM3 B;  3NZS A;  3PRE A;  1GC7 A;  3ZNG C;  3D32 A;  4OVZ A;  1M94 A;  2JQR B;  1C9F A;  2KNB A;  4TUU A;  1YJ1 A;  4OZC A;  2MWS B;  2LMC A;  2A4Z A;  3U8Z A;  2C7N B;  4KKJ A;  5IN7 A;  4A20 A;  3AN1 A;  3VTU A;  2O6V B;  3Q8F A;  3BVZ A;  4DK5 A;  1TT5 B;  4M02 A;  2K6Q A;  3A9K B;  1UEL A;  3WAP A;  5LLI A;  4GB9 A;  1OTR B;  4P1B C;  3ZYY X;  1AN8 A;  2MJ3 A;  4KZ0 A;  1DYQ A;  1FXA A;  2PVO D;  5I4D A;  5JHB A;  1WH3 A;  2IND C;  2RDB C;  5CTR C;  4W9J A;  1QOA A;  2JPH A;  2DAF A;  2KXJ A;  2WDT B;  3WA0 A;  4K7S A;  2HE7 A;  4IOI E;  3PRP B;  4RFB A;  3VRA B;  4KGR A;  4FXC A;  2D07 B;  5FK9 C;  4AQ7 A;  3APD A;  5JH5 C;  1I4X A;  2KJH B;  3NVV A;  1VJK A;  1T0Q C;  2PTL A;  2RDG A;  4NAM A;  2FIF A;  2Z0D B;  1TKE A;  1ZPS A;  1YN4 A;  2CKH B;  4JX1 C;  4YT0 B;  2CU3 A;  1LM8 B;  1FM0 D;  1YX6 B;  4URK A;  2IO3 B;  4Q2J A;  4NJC A;  2NTS A;  3L10 B;  4KVG B;  2NS5 A;  3MP9 A;  4XDC A;  4X57 B;  3KYD D;  3BK1 A;  1SE2 A;  1WGY A;  2FCQ A;  3APC A;  1L0V B;  3K9O B;  4XZ4 A;  3DHI C;  3ZNZ B;  4YWG G;  4R3D A;  2KJ6 A;  3E56 A;  2PVG C;  2IY0 B;  3U52 E;  1K53 A;  1E7P B;  3VTW A;  4WWM A;  2K6D B;  3BZD B;  4A9A A;  3Q6B A;  1XQQ A;  3CMM B;  3ZNH B;  2C7H A;  4D2K A;  3EEC A;  5CX3 A;  2IGH A;  3ALB A;  3Q8E A;  1EUV B;  1TGZ B;  4W9D A;  2LRW A;  4ZRK A;  3RNC C;  2ZNV C;  3KWV A;  4HJG E;  4YTM B;  4BOS C;  3KQ4 A;  2RMM A;  2LUM A;  4NZL B;  3AB5 A;  3AE4 B;  2IO1 B;  4WQO B;  4W9C A;  2MQJ A;  3PSE B;  3VVW B;  3AU4 A;  2DAJ A;  4MDK E;  4ZRQ A;  3ZXR A;  1CQV A;  4RNA A;  3P4Q B;  4MSQ B;  5EE3 A;  1C4P A;  2YEP B;  3DHH C;  4EE2 A;  1I4G A;  4RGO S;  5HI1 A;  4HKZ E;  5FR6 A;  2BQQ A;  3GE8 C;  1WSP A;  4ITK A;  2J0K A;  3W5U B;  1RFA A;  1TKY A;  3QA8 A;  1OGW A;  1SE9 A;  2G3Q B;  3ZTC A;  4GLS C;  1Q0W B;  1WJ6 A;  4FJY A;  1SJH D;  3NS8 A;  2EMT A;  3IVF A;  3C0R B;  3L0W B;  2RGF A;  4G11 A;  5BYQ A;  1EU4 A;  4BFR A;  2EMS A;  5L95 C;  1ZOY B;  2RPV A;  1FCC C;  1ZUD 2;  2MJD A;  4GSW A;  1L0Y B;  3JSV B;  5DPR A;  4USA A;  3TIX A;  2ZW0 A;  4BBN C;  2JZP A;  1VZ7 A;  1JAL A;  2JZZ A;  4CYE A;  4YL8 A;  1LGR A;  3U7Z A;  5LXH A;  2JSV X;  4ANX A;  4YXD B;  3E9S A;  3N9Y C;  2IO2 B;  3QC8 B;  1WJ4 A;  3QK0 A;  1F1H A;  3DBL B;  3B08 A;  1VZ8 A;  3ZDT A;  2H89 B;  2K5P A;  2ZCC A;  4K7U A;  3KLS X;  4GDK B;  5EE9 A;  2BYV E;  1I4P A;  2WQY B;  1WY8 A;  1VD2 A;  4MH0 E;  2KX0 A;  2M0A A;  4C7Z A;  1RLF A;  3GZN I;  3N1Z C;  2ONQ A;  4S17 A;  3KWL A;  3W1S C;  3A4S C;  1UZX B;  2M4N A;  2NCN A;  4B95 A;  3PGE A;  2LGX A;  3J9C A;  2N1W A;  4MH8 A;  1N63 A;  1XLP A;  2LI5 A;  2WLB A;  3TEY A;  1MHX A;  4W9L A;  3TUO A;  1QOG A;  4HKQ A;  3RNA C;  2W54 A;  3X0W A;  4NAW A;  2GBR A;  3MJW A;  2CJN A;  5CHF A;  3QAR A;  1AW7 A;  5C3J B;  2KQS A;  1DGJ A;  1V8C A;  2UWQ A;  1ISN A;  1WGH A;  3RD2 A;  3Q3J A;  2V9H A;  4EUT A;  4S0R A;  5T8I A;  2MP2 B;  1V9J A;  1AWD A;  4DHZ B;  1GOZ A;  4TSS A;  1PUT A;  2XK5 B;  4XYC A;  4PS7 A;  2G4S A;  2V3N A;  4BBN F;  2KFJ A;  3R7R A;  3AEC B;  3N32 A;  1D5Z C;  4F8C B;  3GE3 C;  3V60 A;  4LDT B;  1PFD A;  2KMM A;  1N62 A;  4HXD A;  2KAJ A;  5AZH A;  4M0W B;  3FC4 A;  3CSF A;  1NYR A;  4HPL B;  1WM3 A;  4M8N A;  2JVC A;  4YSY B;  2K1F A;  5J2R A;  1WI0 A;  3BII D;  3RNF C;  3AE7 B;  3AXC A;  4K81 A;  1KLV A;  2WXR A;  4BOZ B;  1I35 A;  5J18 A;  4MSM B;  4TQ0 A;  2N7D A;  5E6P A;  2AQ2 B;  1BT0 A;  2BS3 B;  2R61 A;  3C19 A;  4II2 B;  4ICU A;  3DBR I;  1VCB A;  3O65 B;  2FE8 A;  1UF0 A;  2WDQ B;  2BKF A;  1Y8R C;  1JWA D;  3HVD A;  5D3D A;  3X23 A;  4C80 A;  3EA6 A; 
#chains in the Genus database with same CATH homology
 2CHX A;  4W9I A;  2KDE B;  2KZR A;  3PS6 A;  1LFD A;  3KUZ A;  1X1M A;  1WR1 A;  4AOF A;  3LJ3 A;  4N9F 4;  1ZKH A;  5E6N A;  2KLG A;  4NQK E;  1J19 A;  1P3Q U;  2JF5 A;  2LZ6 A;  1WX7 A;  4ICV A;  5IA7 A;  2FCN A;  2AYO B;  2LUE A;  4LDT D;  1YQB A;  2K39 A;  2LAS A;  4PS3 A;  3SU8 X;  4FAD A;  2UYZ B;  3PZD A;  4ANU A;  3V6E B;  5DPT A;  2GOW A;  3M63 B;  2MBE A;  2IYD B;  4MGI E;  4BKS A;  2Z0E B;  2N1V A;  2ZCB A;  2AL6 A;  3ZUN A;  4LJP B;  3ZRF A;  2HD5 B;  1GNU A;  1LQB A;  2WYQ A;  3V6C B;  3A33 B;  4HDO A;  3MHS D;  4DDG D;  4NPN A;  5C1Z A;  2KK8 A;  3EHV A;  2ZNV B;  3LDZ E;  2FUH B;  3SDL C;  2NBU A;  1K8R B;  4NJ7 A;  2MX2 A;  3IG3 A;  2KC2 A;  2KC1 A;  2LRU A;  2LVQ A;  2QHO A;  4GDL A;  4PYZ A;  3B1L X;  1WFY A;  3QJZ A;  2DYM A;  4DDI D;  4PS8 A;  2N7E A;  2FAZ A;  2LD9 A;  4KIK B;  3H1U A;  2KAN A;  4KV2 A;  1XT9 B;  2Z59 B;  2W9N A;  3L16 A;  3IBE A;  4I6P A;  5AZF A;  2KMC A;  2KTF A;  3R66 C;  4E71 A;  3TJP A;  4HVB A;  2NVU I;  2DEN B;  1H8C A;  3PLU A;  1UGM A;  5C23 A;  1E7U A;  3BY4 B;  4WJN A;  2ZZP B;  1WMH B;  3VH3 B;  3PV1 A;  1V5T A;  2BYF A;  2GBM A;  1UD7 A;  2KJR A;  1OQY A;  2C7M B;  1TBE A;  3NOB A;  2HJ8 A;  3U30 A;  2IY1 B;  1UBI A;  2PEA A;  3N3K B;  1SIF A;  3NZS A;  1WX8 A;  1UH6 A;  3VUX A;  3PRE A;  1GC7 A;  3ZNG C;  3VDZ A;  4WWN A;  2V4L A;  4HDQ A;  3DVN U;  2MBB B;  3D32 A;  2ZPN A;  1M94 A;  3PHW B;  2KNB A;  4TUU A;  1YJ1 A;  4MGZ E;  3HK0 A;  3JSV A;  4WJO A;  4NAW B;  4K1R B;  2MWS B;  2K8C A;  3RUL A;  2A4Z A;  2J0M A;  3U8Z A;  2J7Q B;  3MTN B;  2C7N B;  4XC2 A;  3SD5 A;  2BKR B;  4A20 A;  3VTU A;  3AUL A;  2A5U A;  2O6V B;  3A9J A;  3B0A A;  2ZEQ A;  3HHM A;  4AWJ A;  4TV3 A;  4DK5 A;  3ONS A;  2L3Z A;  4AUQ C;  2R2O A;  1I42 A;  3Q3F A;  2KLC A;  3H7S A;  2K6Q A;  4B6W A;  4J6I A;  3A9K B;  2LXC A;  1UEL A;  3WAP A;  5LLI A;  4GB9 A;  4ANW A;  3IFW B;  2MW5 A;  2LWP A;  3DVG Y;  1OTR B;  2RSU A;  2KTR B;  1XD3 B;  2GMI C;  3NZU A;  2IO0 B;  4PYU A;  2N9X A;  1WGR A;  4KZ0 A;  3APF A;  2MBH A;  2VRR B;  3W1Y A;  5JHB A;  1WH3 A;  4NQL B;  1KOT A;  4I6L B;  2WX1 A;  1AAR A;  3M3J A;  3EC8 A;  5CTR C;  4FBJ B;  5LXI B;  3H7P B;  4FHJ A;  3HM3 A;  2D3G A;  4GDK A;  4W9J A;  2JPH A;  2DAF A;  4GIV A;  3DQV A;  2KN5 A;  2KXJ A;  2O2V B;  2WDT B;  1ZW7 A;  3WA0 A;  4F1S A;  4WWP A;  3VXW A;  2BYE A;  4K7S A;  2HE7 A;  3OJ4 B;  1YIW A;  4BKG A;  4DBG A;  2KKC A;  3PRP B;  3RT3 B;  4IWP A;  3PLV A;  2K25 A;  2EKE C;  4EKU A;  3DOW A;  2D07 B;  3L13 A;  1WRD B;  1WIA A;  2KDF B;  3APD A;  5D6J B;  5DCN A;  2YLM A;  4ZDV A;  2DZM A;  5JH5 C;  4MGY E;  1OEY A;  1WZ3 A;  1E8W A;  2NBW B;  3A9J B;  4ZRJ A;  3HM6 X;  3S2A A;  1EF1 A;  1S3S G;  1Z5S B;  2KJH B;  2NPT A;  2AL3 A;  3DDC B;  3L17 A;  4W9H A;  2IZV B;  2KX3 A;  1V6E A;  4HCP B;  1WX9 A;  1F9J A;  1JRU A;  4IM0 A;  4ANV A;  1C1Y B;  2FIF A;  2Z0D B;  2M1M A;  1P0R A;  3DBH I;  4RM8 A;  3T9L A;  3ENE A;  3UQA A;  4IG7 B;  1G6J A;  2CKH B;  1HE8 A;  3A1Q A;  1LM8 B;  3ZDM C;  1YX6 B;  3H6N A;  1U4A A;  4URK A;  1KM7 A;  2JUO A;  2IO3 B;  2KVR A;  3ZVV A;  3R3M A;  1WXV A;  1PQS A;  3L10 B;  4KVG B;  3QWZ B;  2O6V D;  4FJV B;  1ZGU B;  3V62 A;  2NS5 A;  2DHZ A;  2CHZ A;  4FUL A;  4JLC A;  4X57 B;  1RAX A;  3ZO5 B;  3KYD D;  5KHO A;  3HIZ A;  1WGY A;  2FCQ A;  3APC A;  4E3C A;  1V2Y A;  4GMV A;  5J17 A;  4HCN B;  2REX A;  3K9O B;  5AEK B;  4XZ4 A;  2ZVN A;  2MP2 A;  4I6N B;  3WAL A;  3ZNZ B;  4TKN A;  1TTN A;  3KYC D;  3QAQ A;  2B3A A;  2JXX A;  2KJ6 A;  2DZI A;  4JL9 A;  4KDL B;  2XK5 A;  3RZW C;  3UIP B;  2IY0 B;  3V61 A;  2KMA A;  1L2N A;  3VTW A;  2K6D B;  3VFK A;  3UIO B;  2LXA A;  3VHT C;  1XQQ A;  1E8X A;  3CMM B;  3ZNH B;  2C7H A;  2XEW A;  1E90 A;  2L8J A;  3EEC A;  3ML8 A;  5CX3 A;  3ALB A;  4IUM B;  3WIM A;  4BVU C;  4MJS A;  1EUV B;  1J8C A;  1TGZ B;  3PPA A;  1OEY J;  3UIN B;  4W9D A;  3DVG X;  2LRW A;  5E6O A;  4ZRK A;  2ZNV C;  4HK2 A;  4G0N B;  3UF8 A;  1SGH A;  4NY0 A;  2HTH A;  2GBN A;  3DVN V;  2KQ7 A;  4RMA A;  4BOS C;  3RCZ A;  3RYT A;  4HWI B;  1R4N I;  2L00 B;  3PHX B;  4EFO A;  3ECI A;  2IO1 B;  4WQO B;  4W9C A;  4KSL C;  1Z2M A;  2MQJ A;  4GOC A;  2FID A;  3PSE B;  2L0F A;  1V49 A;  2CS4 A;  1WF9 A;  3VVW B;  3AU4 A;  2KDI A;  2LVP A;  4JIO U;  4WAA A;  4EZJ A;  2DAJ A;  1S1Q B;  4GDL B;  4MDK E;  4B9K A;  1UBQ A;  4OVV A;  4GN1 A;  4MSQ B;  1CMX B;  4ZRI A;  3QHT A;  2LGY A;  1IP9 A;  5L83 A;  4M8M A;  5FR6 A;  2DZK A;  1LXD A;  4FLH A;  2BWE S;  4DWF A;  1IYF A;  3OLM D;  4IC7 B;  2J0K A;  3A4R A;  1RFA A;  4MJS B;  3VTV A;  3QA8 A;  2RD0 A;  3VUW A;  1OGW A;  4DHJ B;  4HLE A;  1SE9 A;  3KH0 A;  2G3Q B;  2L7R A;  3ZTC A;  1E7V A;  2D11 A;  3UQB A;  1V80 A;  4KZC A;  3SHQ A;  4RM9 A;  4E74 A;  2KWV B;  1Q0W B;  1WJ6 A;  4FJY A;  5D94 A;  4EZK A;  2CU1 A;  1GC6 A;  1V86 A;  3NS8 A;  2EMT A;  4AJW A;  1GJZ A;  3IVF A;  4XX5 A;  3C0R B;  3BIN A;  1E8Y A;  4GXB A;  1WE6 A;  3L0W B;  2RGF A;  1MG8 A;  1WJN A;  2NR2 A;  4G11 A;  1WYW B;  5DPW A;  4F7Z A;  2G4D B;  4IWQ A;  4BFR A;  2EMS A;  1WJU A;  2JZ3 B;  5L95 C;  2GBK A;  2N4F A;  2Y5B B;  1IPG A;  4JGH B;  4W9E A;  3CF6 E;  3NY5 A;  2BGF A;  4GSW A;  1WXS A;  3JSV B;  5DPR A;  3M62 B;  3CST A;  5TR5 A;  2BWF A;  3TIX A;  4BBN C;  2LVO A;  1NBF C;  1E5W A;  5KHQ A;  3H9D A;  4EEW A;  4EZL A;  2KD0 A;  3UGB B;  4G3X B;  2L76 A;  1H4R A;  2WWZ A;  3KW5 B;  4HPM B;  4BKS D;  2JZZ A;  2DYB A;  4CYE A;  4NJ6 A;  5D7G A;  1R4M I;  2V1Y A;  3K9P B;  4YL8 A;  5JHA A;  5LXH A;  4GU2 A;  4ANX A;  1D3Z A;  2KFK A;  2IO2 B;  3ZW3 A;  2C9W B;  2XBB C;  5G2N A;  2ASQ A;  3KUD B;  3QC8 B;  3OJ3 A;  2MBO A;  1WJ4 A;  3R7Q A;  3QK0 A;  1J0G A;  1KJT A;  3B08 A;  2LGD A;  3KUC B;  2CR5 A;  3ZDT A;  1V5O A;  5HKH A;  1NI2 A;  2J0J A;  2L05 A;  1WXM A;  2ZCC A;  3PVL A;  4IM2 A;  4K7U A;  1WR6 E;  4GDK B;  3TCA A;  3VH4 B;  4KIK A;  2L0T A;  4MEL A;  2AEH A;  2BYV E;  4FHK A;  4WWO A;  3VAW A;  3WAM A;  2M0X A;  3ZRC A;  3ZIM A;  4WJP A;  2I1K A;  1WY8 A;  3DCG A;  1VD2 A;  2OOB B;  3L08 A;  4MH0 E;  4DHJ D;  3PTF C;  4G50 A;  2KX0 A;  4KDI C;  5CHW A;  3TBL D;  3DBL I;  4HJK A;  1NDD A;  4AP4 C;  2RPQ A;  1RLF A;  5EDS A;  1WMH A;  3GZN I;  3VUY A;  1GUA B;  3RUI B;  3W1S C;  3KVF B;  2NPT B;  3A4S C;  5CHV C;  1UZX B;  3DPD A;  4BKT A;  2M4N A;  5BO4 B;  2NCN A;  4B95 A;  2KDB A;  3PGE A;  2LGX A;  2KFK B;  1Q1O A;  2N1W A;  1YD8 U;  3QX1 A;  4MM3 A;  1V81 A;  1FXT B;  2DYO A;  2LI5 A;  4FN2 A;  2D2Q A;  4WJQ A;  4W9L A;  2CHW A;  3A1Q B;  4MEM A;  2KOX A;  3OAW A;  2WX0 A;  2FCS A;  4A3P A;  3X0W A;  2IBI B;  2DX5 B;  4NAW A;  2GBR A;  1WM2 A;  3MJW A;  2ZJD A;  3DBS A;  3EFU A;  5CHF A;  2NBV B;  2K8B A;  3QAR A;  2KQS A;  2N9P C;  2RR9 A;  2MSE D;  2JT4 B;  2V3S A;  4II3 B;  5G55 A;  3ZLZ A;  2UWQ A;  4ASW C;  1ISN A;  1WGH A;  3RD2 A;  2O6V A;  3M95 A;  3IHP C;  3Q3J A;  4JQW C;  4EUT A;  3WAO A;  2G45 B;  4EOY A;  4DXA B;  3PT2 B;  2PE6 B;  2LJ5 A;  2JRI B;  3WAN A;  2MP2 B;  1V9J A;  4DHZ B;  3PRZ A;  2KWU B;  3A9K A;  2FNJ B;  3GOE A;  2PPH A;  2FCM A;  4W9K A;  2XK5 B;  3L54 A;  3ZKJ C;  2KTR A;  4GGQ A;  4PS7 A;  1L7Y A;  2G4S A;  3PRM B;  2GBJ A;  3JVZ X;  3AU5 A;  4W9F A;  4BBN F;  2KFJ A;  2M8S A;  2MRP A;  3U7D A;  3R7R A;  3ML9 A;  1EO6 A;  4MGK E;  3QQ8 B;  2JWZ A;  1P9D U;  2KHW B;  2C60 A;  4KSK C;  3H7P A;  3N32 A;  2JRH A;  4FA6 A;  2O2V A;  4F8C B;  2YVC A;  3V60 A;  4LDT B;  2PE9 A;  4P7I A;  5D2M B;  5GMV A;  4HXD A;  1QZE A;  4A3O A;  3I3T B;  2M17 A;  5AZH A;  4M0W B;  2K8H A;  2KO3 A;  3CSF A;  1P98 A;  4IWO A;  2MA9 B;  1WGD A;  2AWT A;  2C5L C;  3JYU A;  4HPL B;  1WM3 A;  3RZF A;  4OVU A;  4M8N A;  1WZ0 A;  2JVC A;  4IW0 A;  2K1F A;  2PJH A;  5J2R A;  2ZVO A;  1WI0 A;  1RRB A;  1WE7 A;  3AXC A;  4K81 A;  5AZG A;  1GG3 A;  3JW0 X;  3TL5 A;  1TZ1 A;  1YX5 B;  2OJR A;  1KLV A;  4BOZ B;  1I35 A;  2MLB A;  2DZJ A;  5J18 A;  3QCA A;  4CHK A;  2BPS A;  2MCN B;  3ZNI D;  3QIJ A;  4MSM B;  4NNJ B;  4TQ0 A;  1T0Y A;  2BF8 B;  4AJY B;  4DHZ E;  2D10 A;  2N7D A;  4LCD E;  5E6P A;  1A5R A;  1BT0 A;  1WGG A;  4FJZ A;  3W1S A;  1E8Z A;  4W9G A;  4II2 B;  3P2B A;  1P1A A;  3DBR I;  4ICU A;  4TQ1 A;  4ZYN A;  2R2Q A;  3NHE B;  3VQI A;  1VCB A;  3O65 B;  2ZPY A;  4LJO B;  5JZE B;  5IAA C;  4IM3 A;  2MBQ A;  3ZTD A;  4CO7 A;  1EF5 A;  4K7W A;  3TMP B;  1C3T A;  2BKF A;  1Y8R C;  3T8M A;  3N30 A;  2I1J A;  3AI5 A;  1Q5W B;  2JY6 A;  3X23 A;  5DPS A;  2KWC A;  2N9E B;  1WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...