2LHAA

Solution structure of c2b with ip6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
EKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptotagmin-1
publication title Molecular Level Interaction of Inositol Hexaphosphate with the C2B Domain of Human Synaptotagmin I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2lhaA00
4G11A 3QK0A 4EZJA 3L54A 1QATA 4KZCA 2CHXA 4PS8A 5H4YA 2N1TE 4AOFA 2Q0ZX 4QJ3B 2A5UA 3QR1A 3KWTA 3ML9A 2WXMA 2NSQA 3ZVVA 3TL5A 1DJZA 5H4ZA 5EDSA 5JHAA 2ISDA 3ZW3A 3GPEA 4TV3A 3F01A 2KI6A 2WXOA 3L13A 4Y1SA 2LHAA 2ZKMX 3QJZA 1DSYA 3NZUA 4FULA 3SD5A 3M7FB 2WXJA 4L1BA 3CSFA 1DJGA 4F1SA 4L23A 5CCJA 4F93B 3W56A 4FJYA 4JPSA 2DMHA 3RDJA 5CCGE 2WXKA 4EZKA 1BYNA 2CM5A 1QASA 1E8WA 2CHDA 5CCHE 3L17A 3ML8A 4LT7A 2FK9A 5JHBA 4IHBA 3L9BA 1RH8A 3PS6A 4FA6A 1CJYA 2WXNA 4GNKB 4F92B 1RSYA 2CHZA 4J6IA 1RLWA 3PFQA 1E90A 2K4AA 2WXRA 3LJ3A 4FHKA 1A25A 2A4ZA 3P2BA 4ANVA 1E8ZA 2K45A 1V27A 4L2YA 4ANWA 1E7VA 2B3RA 2QZ5A 2YRBA 3L16A 4ICWA 4ANUA 3R7RA 4QJ5B 1DJIA 4WAFA 2X38A 4QAMB 4V11A 2ENPA 3TWYA 3PRZA 1DQVA 1W16A 1DJYA 3IM1A 1DJXA 3OAWA 4TS6A 3R7QA 4Y1TA 2CJSA 2WXGA 1HE8A 3NZSA 3TJPA 4ICXA 1UGKA 4OVVA 3QR0A 4EZLA 2WXLA 4WEEA 5G55A 4KITB 2ENQA 1WFJA 2CM6A 3HHMA 2WXPA 3KWUA 4KZ0A 4NPKA 1DJWA 2WXFA 2R83A 3F00A 4FLHA 4OVUA 4FJZA 4IQHA 1WFMA 4LCVA 4PS7A 4XE0A 4BFRA 2WXQA 1UOVA 2K3HA 3DBSA 3MJWA 2NQ3A 5T8IA 4URKA 4ANXA 2CJTA 2DMGA 1E7UA 3NSJA 3HN8A 2Y3AA 2BWQA 3F05A 3APDA 2RD0A 3CSTA 4L1LA 3ZIMA 4HLEA 2V4LA 3QAQA 5G2NA 1TJXA 1TJMA 1BDYA 3B7YA 3L4CA 4DNLA 4GB9A 3PYCA 1BCIA 3F04A 2YOAA 3T8MA 4QJ4B 2JQZA 2WXIA 3L08A 4LDCA 1DJHA 4NP9A 2QZQA 2D8KA 4PS3A 1E8XA 4A55A 4MJJA 3N5AA 5KJ7E 3IBEA 3S2AA 2Q3XA 4HVBA 1UOWA 4DK5A 2K8MA 4XX5A 3W57A 4WWOA 4AJWA 4TUUA 3JZYA 2Z0UA 3FBKA 1E8YA 2CHWA 3ENEA 4FHJA 4NPJA 2ENJA 2EP6A 3APCA 2WXHA 1K5WA 3HIZA 4BGDA 3OHMB 1YRKA 4WWNA 3FDWA 4WWPA 3DPDA 1W15A 3QARA 1GMIA 3RPBA 4FADA 2NCEA 2FJUB 3APFA 2UZPA 4F91B 4XZ4A 3PREA 4NS0A
chains in the Genus database with same CATH superfamily
1IAOB 5GISH 1KEGL 1N5YH 1G1OA 2EE9A 1BP3B 2WLMA 5IHBA 3MLYH 1P7QB 2I9TA 3DMMD 4JM4L 4MA7H 4Q89A 3UXFA 4U6HA 4OGAD 4QPEA 2OK0H 4UQCA 4WU5B 4XCNB 3ZK0A 3MRFB 3L3KB 1ZVHA 3QI9B 1D9KA 3ESUF 3H3PL 3UIYA 1KSRA 3RGHA 3ULVD 3QH3A 1XR9A 3W56A 5IGXH 2W0KA 3MV7A 1I85A 1MJ7H 4ZNEE 3LKNA 3DUUA 1T6VN 1KJ2A 2BVOB 3L7FA 4GXUM 3B43A 4HGWB 2XIBA 3K81A 1KYAA 1UKQA 2QDVA 4A6YA 3AWEA 1I82A 3B9DA 5FDYA 2F5BL 4DO4A 2FE0A 3AY2A 3W81A 4ZXBD 4ATWA 2NDGA 2YEZA 1RZGB 1AY1H 2OMVB 1EAPA 2ATKB 4PTUA 5CSGA 1RZIB 3CDZB 3TCLB 1QLEL 3GS7A 4G3YH 1EUUA 4MJ6A 3SDXA 3QDJE 2YA0A 4AVJA 5I0WA 1FL6B 4U1LB 4JAMB 4PRAB 1ZJBA 4ZUTA 3BQUA 1QKZH 2C9QA 4JR9H 3V7MA 3BKCH 3GSWA 3QJSB 4PRNA 3BO8B 12E8H 1NGQH 3WHE1 1OIOA 3LHAA 4OCSH 5D2NE 3LRKA 4KROB 7CGTA 3HG1A 4HJ0C 2NY3D 5DWUL 4X7TB 3U6RB 1EAQA 4PJGB 1YQVH 3I3EA 3ZIYA 1XGTB 4FI6A 2VN3A 4MSWA 2OR9L 5FHAL 1N18A 4KQ0A 4ADGA 3GSRB 2F8OA 1IQWL 3UAFA 2ORBL 1XD1A 4D0CB 3BQUD 1I8MA 2WIIA 4NO2B 3QHTC 4ALAC 2YAMA 1QLEB 4XP5H 1E4WH 5JIDA 3ARBB 3UO1L 3DX1A 4PBDA 4X80H 2CLRA 3L95A 4LEXH 5ETUB 4MTMA 1Q0YH 4OFKA 1QFUH 4MMXA 2XVKA 2F74B 4H2AA 1RFDH 3S96B 1LTXA 2W07B 1PD1A 4NUGL 4IOIA 3QXUA 3ZMNA 5A3IC 2ARJA 2A4EA 5LO7A 5ANHA 2PR4H 4HT1L 5IJBC 3DVIA 3HRPA 2OYPA 3FSVA 5TE4L 1G0XA 3CDYA 1MWOA 1VFAA 2FJUB 4QNPF 5JXAH 1VFBB 5L4FA 3T0EC 2PUQT 4D8PB 2WY3B 1C16B 1WFUA 2MEJB 3QQ9C 1E50A 5D5MF 1PL3A 3QR1A 2J72A 2W91A 4DUXA 3BQVA 3T5WA 4IKKA 4MXVF 4HZLA 5D2LF 5JYMA 5EIVA 4GKZB 3Q2CA 3JTTB 2BP0A 5EC2A 1GPOL 3RIFF 3CJJA 1J87A 3MFGB 2HLAB 2OW7A 3MTXA 1FYTA 2J8OA 3ARVA 4O5LL 1JGIA 1I9JH 2VDPH 1ASQA 4N3UA 5L0QB 4MQXC 1ZLUH 4QCIB 2PPCA 5SWSA 4U3CA 2R4RL 3M1BA 1KDIA 2EXSA 3EGSB 4OCYL 2FGZA 3T2OA 3ZGHA 3HE6A 1G84A 3FUKA 2JELL 3B5HA 3DXAA 3IGFA 4LRIC 1VACB 1J5OH 4PBXA 4S1QL 4D7PA 4FA6A 1MQKH 5BS0B 1NDMB 1U8IA 4GQQA 5B1JC 4U7MA 5FO9B 1Q94A 2Q8BH 3WEAA 32C2B 2B1AL 2JE8A 2YHGA 4G6KL 3TEZA 3NT0A 1PNDA 4LP5A 4ANWA 1VB9A 3CFKB 4UNIA 1QLFA 5CZRA 2ZP8A 5JLZB 4S0TD 1SXNA 1KCSH 1A66A 4P2RB 5CEYA 4BH7A 3A47A 4NQCE 1GTNA 1FNEA 3CG8A 4R3SA 2H32B 1FF5A 1S9XB 2BVPB 2NW2B 3TJPA 1TSRA 3DXAD 4WK0B 3DJSA 3L3HA 3OGCB 1ET7A 5DFTA 1XO8A 2XY2A 5CR8A 1LEKA 3U4EB 1OGSA 4QRAA 2BFGA 1YYLL 2D7TH 5F9WB 3I75B 2Q6WA 3ESNA 3MI6A 3FFOA 1U4EA 4OM1H 4RMBA 4G9DB 5LNDA 2JJWA 5JHLA 2GIXA 4J27A 5JQ6H 4P05A 4H0IA 3HNTL 3CLEH 4GAFB 4JKLA 2DM7A 1H8SA 5A2KH 5M94B 5IJVA 1ZHLB 2YRZA 5J6SA 1X5KA 3Q44A 4JANB 4NXSA 4NPYB 3SYAA 3APDA 4GUOA 5CILH 5GJSH 1MW2A 2EUZA 3D39A 1R3KA 1QHOA 4IRJC 4LSRH 3GBLA 3LCYA 2HMIC 4DZ8A 3QXAB 1A7RL 3P1VA 5EPMA 3QWOA 4YSQA 3BP4A 4PJCF 3UROR 3GKWL 4O2CA 4JG0H 1CG9B 3FSWA 4N9GB 5T3ZD 3HI6L 2HG0A 2ZWKA 3VFMB 4OIAA 4CC4C 2C1PA 2QTVA 2QKIA 4LVNB 2F54E 1YRKA 4HWEH 3OKDB 5T5FL 1JHTB 3C9NA 2FLBT 4ZTPL 4MVBD 1SVCP 4ELMB 4OI9A 5ELIA 3S9DB 5D7IE 5JHDE 2F19H 3BE1L 3AG1B 3T9WA 4JJOA 5C0BB 2ZPKL 4NX0A 3JWNC 3NCMA 3L54A 2F54B 1D5XA 1MFAH 3BIKB 4HWBL 5A7BA 5LQBL 1RZJH 1TQSA 5L4IA 3ATFA 2WTRA 4LHUA 3S6CA 1F13A 3X14B 4P2AA 1G7QA 1LWJA 1QO3B 4DEWA 5GGSB 1L9PA 2A74C 4TV3A 3V4PL 4G9FA 3ZQWA 1SM3H 2GY7B 5GHWH 5SV3A 2IG2H 3DX9B 2OSLB 5CCJA 3UAEA 1A5FL 1T20B 1P7QA 4QHKI 3G6JF 4QRUA 4LHUD 2GJZB 4KNQA 2NNCA 2Y7SA 3BVTA 3P0VL 2PW1B 1ZGLA 4XCNA 2DF3A 3FK3A 4BFGA 3KLHC 1J8KA 4KZDH 3VMOA 1IMHC 2DQGL 1LGVA 2P5EE 4X9YA 2XN1A 5GSRB 3F7VA 1P7QD 3MC0A 1KJ2H 2ZCZA 3V4PB 4D9RD 4HGWA 2XBDA 3MCYA 3HNVH 4XRCA 2D2CC 3SDAB 5F6IB 4A6YH 5IUCA 3M17B 1X6NA 1IE4A 4DGYL 4ZNEA 1QNZH 5KYWA 4UV7H 5DGRA 4PJEB 3KWUA 5I19H 1RZGA 1UM6L 3QI9D 1UACL 3DIVA 2I25N 4OAWB 2ATKA 3I3BA 3TCLA 3HC0B 2OULB 3EJZC 4FJ6A 4ES8A 2R0WH 4F7EB 1UA7A 4PRAA 4BK5C 1DQML 3K4AA 1AH1A 3NJIA 1UH2A 1IL1B 3BO8A 4X7CC 3K2UL 3IETA 2QPEB 1KIRB 3DV4B 3QDJA 3L8QA 1IJ9A 3UEQA 4L48A 4XPGH 2QPSA 1SDYA 3OHXA 3U6RA 2EDQA 1T6WA 2B08A 2W5PA 5CJQH 2GPZA 4M7KL 2NMSA 1INQA 2BOBB 3ETTA 2WLLB 1GMEA 3F04A 1P7KB 4ZFOA 4PJ8A 2CGZA 5HDQH 5D2NA 1BSIA 4FNPA 2VDRH 4PS3A 1IJNA 2WINB 4O2FA 4PHZA 3RUGE 3BFQG 5EZIL 2K8MA 1FVCA 3ARBA 2DLGA 4P2QE 3TASA 3UTPE 3VFTB 4FQXC 1E8YA 2X9WA 4KROD 5E4EB 2B4CC 2EE0A 2HT3C 2Y06L 4MBRA 3ZLQC 5JIQA 3ZXAC 3WSQH 4AZUA 1JWUB 2WWKT 5J1TC 4BZ2L 4GO6B 3PL6B 1W0WB 5I1GH 2C4XA 3PREA 3S96A 1FLRL 4QD2E 1IKNC 5DQJA 3LIZA 4M5SA 4WDIB 4NCDA 3VTTA 1ZA3B 3ARBD 1AR1B 4J3OC 2NXYB 1EDHA 3O45A 3O0RH 5FLUA 1WJ3A 1HCFX 5FYLH 3T0XA 1GJIA 1AXIB 1E2WA 4QKXB 4GRLA 1VFBA 3QCUH 5F7KC 3QJZA 1S9YB 1BQKA 3VFRA 4ZUVB 3NAAL 2L7QA 3QRBA 5DJDA 1B4JH 5E03A 3NIFB 1XCWA 1RUQL 2YGNA 1TVHA 1YUHB 4ZJ9A 3HMWH 5C09E 5J1AB 3OB0K 3QIBA 4X6DB 1HQ4A 4N2MA 1AMXA 4GKZA 5C6TH 1ROWA 3JTTA 4F92B 1HSAB 1R3IH 2BW5A 4QTHA 1E4XL 3HE7C 3PFQA 5C09B 4GXFA 1YEDA 3ZDWA 1F3RB 4Y2OB 2DMBA 5C0DB 2HXAA 3UTTE 1KCBA 1HEZB 3VD4A 2IH8A 1SHSA 1GAFL 2OI9C 3AAZB 5EOCJ 4QCIA 5IEKB 4P4KA 1XEDA 4QJ5B 1LO2H 3H9HA 5HHXH 1DEEB 4HS6B 1UASA 4JHWH 4YSDA 1V10A 4UDTA 1VACA 5DURB 1NDMA 2I5YH 2UUDK 4KDTA 2QHLA 3ESPA 4LRNL 4QRTB 2V5YA 1MRFH 3FFDB 4QWWD 1CVSC 3MJ8B 4W6XB 3FB5A 1MJJA 5HGHA 3UGXA 2KLTA 1FWXA 32C2A 5I30L 2X4SB 1M6OB 3EADA 5F93C 3LZFL 4JGMA 5C0EB 1GYVA 5DUPL 3WU1A 1RMFH 3BN3B 1CO1A 1JOIA 2N59A 5JLZA 1IEBA 4P2RA 1XIWA 2JKSA 4FXGB 2H32A 1S9XA 4BQCA 1T1YB 3FU8A 4NP4H 3RRQA 2WCSA 2WV3A 3U4EA 2IGLA 3H6AA 2RHEA 1PS3A 2NQDA 4HEPA 4AT6B 1NCCH 1ZWIA 3I75A 4HCFA 4B0MB 4Y8AA 1DFBH 4OIBA 3ZMRA 5JHLH 2WVTA 2CIKA 1II4E 4P2RD 1PZSA 1XIWD 4BFFA 5F44A 4HIJA 1S9WA 1IV8A 4DH2A 4XXCA 2YWZA 1GIGH 1X4XA 1K5WA 1F1DA 5CD3A 3CFQA 5JPNC 1JHKL 5DMIH 3DETD 5C0AB 3QXAA 2D3VA 4YHZH 4JFEB 4F8TA 3HFMH 4LF3A 4TMPA 2ZJSL 1HWHB 4KXCA 4Z3JA 2BIQA 4NS0A 2HKHH 3DUHA 4PD4J 5LBGA 2NR6C 1W91A 4ZMWA 5CKAA 3MHZA 3VFMA 2C4FU 1FE8L 1S2EA 4Q6YA 2HYMA 3M86A 1Z9PA 4LSPH 4Z0BL 5DFVC 5KUMA 3WNJA 1RIHH 3B9KA 1JHTA 4TQ8A 4AYID 5DRZB 1M7IB 5H4ZA 5FFLA 3BAIA 2DRUA 4ELMA 4CVZA 3SEPA 5EOQL 2ALWA 1OHQA 2DQTH 4ODXB 2F54A 2XWBB 1ZT7B 1N5AA 3IRZA 3QUMA 3TA3C 1O0VA 5KOVC 3X14A 2EIDA 4HG4K 1QO3A 4JFSA 5D7IA 5JHDA 1CLCA 4DQOL 2N56A 4LCCB 5GGSA 2EUWA 2DMCA 2HVBA 1I8UA 4ZW5A 2H45A 2WLKA 3D18B 2VISA 5DQ9B 5C6WH 5KVEH 1BVLA 1HIMH 2EQDA 3GBML 3P0YH 2VW6A 4Z7QE 5C0BD 2DDQH 1T20A 5T5FA 2PCXA 2F54D 4WW2F 4I1RA 5KS9F 2Q20A 4MAYA 2OBGA 4YK4B 3CFCL 4PJFE 2NY5C 3CQFA 2O6CA 4XNUH 2PW1A 4IBUA 4Z7QB 3X17A 4HWBA 2ZUSA 3QPXL 1INDH 1ZAGA 4P5KB 1T66C 1O6SB 2D7QA 2YS4A 2ZNXA 3P3UA 3DRTB 4PJFB 4BRJA 1YHPA 2CLZB 5G4OA 5GSRA 3QJTB 2WN3A 1U36A 2J55A 2KZKA 3RY6A 2FHCA 3V4PA 4KNUA 2DLHA 2KC0A 5DVNA 5IJKA 1UOVA 5E5UB 1SEBB 3G5WA 4P49A 2M26A 4JKMA 3HG4A 4LARL 4NUPA 3M17A 4QHUA 4JDEB 2P5EA 3CC1A 4XP9H 2D73A 4M3HA 2NOYA 3DV6B 3UZEC 4FAAB 5L6YL 3OKOA 1MFDH 4XB3A 4Q58C 4R7XA 5DJZB 4QRQA 4LHQB 3RBGA 4OAWA 1QYGL 3SDCC 1JZ7A 2WB7A 2EDLA 2KDGA 3GDBA 5DEGB 1PIGA 3VQMA 5F1KC 2IV9A 1ORQA 4HWUA 4OT1H 2HRGA 3SDAD 3VD0A 1OP3H 5IQ7L 4ZT1A 5LBVA 5I5JA 2FTAA 1TMCB 2Y2TA 3DJ9A 4M61B 4XMVA 1S78D 2AJZB 4XMLL 3QQDA 3FRPG 3SE4C 4FHJA 4LIQE 2AJSL 4W9CC 1MCQA 1DR9A 2WLYA 4NQVA 3OZ9L 2FGWH 2H1XA 3LS4H 3MV01 4Z7VB 4APQA 1VCBC 4B96A 2VR6A 3UJIL 4B27A 5IB5A 2Z35B 1YC8A 4R7DB 2AQTA 4ENZA 3ZKSD 2AJXH 3I2CH 1J1PL 3SY0B 5ACLA 5L9DH 3ZO0A 1ZTMA 2XZCH 3X12B 5I66B 5CNHA 3KPOB 4KK5C 4XH2B 4MAZA 2ZCLH 1A8JH 4PY7B 4QXUH 1LO4L 1JWUA 3PL6A 1BAFH 3O41B 3TZVB 2ESVE 5SV4A 1OARH 3FQUB 2MPAL 3LIZH 3B83A 1X6LA 4WDIA 2R7EA 3QCTL 4YIQB 3PHSA 4H1LB 3JYCA 4S0HA 2BP3A 1SFHA 1DN0B 4JM2B 4XAKE 1E5CA 1PD0A 3X1FA 1OCOB 4LLVA 3RAJL 2CBQA 4P5TC 1N19A 4ZUVA 3PL6D 2IQAB 4LOUC 3IJHB 2K4AA 1LJMA 1OGTB 3P69A 1R5IA 4KY2A 4ODSL 3PWPB 2R56H 4PRPE 1E43A 2X53A 3CZNA 2HX8A 5J1AA 3IDYC 1C5CL 4ZFFB 3RIFK 2B39A 1AR1D 5EEZA 1KXTA 5B3SB 2NXYD 2GQHA 4LU5H 5B8CC 5I9QB 4CVUA 1T1ZA 5L7XH 4NRYB 5C09A 2QL1A 2CXKA 4XX1G 1V3LA 3B2VL 4Y2OA 1N6QH 5C0DA 5FM4A 5B3NA 5J13B 2BP5M 1P2CA 4WJ5A 3AAZA 1MEXL 4LCUB 4YL4A 5HGGS 2V5MA 5IKCB 3CDGB 2V2TA 4GBXC 1DEEA 3DBSA 3CX5J 3QCVL 2FLMA 5D55A 1AKJA 3OKEA 5E2TL 2A7BA 1AGEA 4BXVA 1HTYA 4H88L 4YBQC 4ZMQA 1W0YT 3LRLA 5C09D 2ZG3A 4KFMA 4AYEC 1M6OA 2DTMH 2EYRA 3BH9A 3KJ6L 1WHOA 4P9HC 3EGXB 3PHOB 3V6BR 4ETYA 3F58L 2DB8A 5E2VL 2XA3A 3RWDB 4KXAA 2D3JA 4PV8B 2OP4L 4YDMA 1AIFB 3GHEL 1ZCRA 3ASOB 4EI6B 3RA7H 4OD3H 3LNEA 1AKJD 1UXWA 1WFNA 1ZT4B 4G6JH 3WEXB 2DLIA 1SXZA 4OCYH 1ADQL 3KCWA 3SBWA 3V0FA 5JW3H 4GKSA 3J27A 4MWFB 3NOIA 3KYKL 1G1CA 3OHMB 2YUXA 4N90D 4KY1L 3ZE2B 1FHGA 2JCCE 4JDZA 5JOPE 3IGUA 1KLFB 3ULUC 3R0MA 1EZVX 3APFA 4ONFL 2A9BA 2O93L 2ADGA 2DJ4A 2PR9A 2HUHA 4JL1A 4Y5XC 2JJTA 4NFCA 4OW6A 1D5BB 5IQ9B 1GVIA 4R96B 1QATA 4L9DA 3CVCA 1GS7A 3BZEB 4MXQC 4JZOB 5D71H 3H9SB 1I1YB 4N0CD 3T04D 1BZ8A 3LIUA 1BZOA 3RILA 1KPVB 1Z7JA 4N0UE 4JFEA 3HA0A 3EJSA 1E9QA 1FGVL 1KFGA 4K3JL 3B2DC 4DO5A 1JBJA 2UWEF 5GXBB 2ZQKA 2R2BA 1YN7B 1MW3A 3FN3A 4WFHD 2XC8A 4QRRB 3RVWC 1GHFL 4X4ME 3CSFA 1Q1JL 2GUYA 2IDFA 2JFCA 3QQXA 4KKCC 1RPKA 4OY9A 1H8OA 5A2BA 2QQKH 1AE6H 4GG8B 1GGYA 5DRZA 3EYQC 4FL4B 2GUOA 3PNRB 4YSRA 5C0AD 5HD8D 4KNSA 4JFED 5B4MD 2HTKC 4J3TA 5IJCC 1ZT7A 1NFDB 1QBML 2A9DA 3PY9A 4YC2C 1EWHA 2R59A 1IC5L 3QUMH 4KJPC 1KBBA 3FUFA 4GQRA 4J5VA 2CMRH 4X98A 3VQ1C 4TS6A 1XCXA 2TSAA 4DKTA 1MG2C 2E86A 3HHMA 3P4NB 4ALAL 5ADOL 4NM8L 1U30A 3MFFA 4XE0A 1FN4B 4AH2B 3PWUA 5JXEC 1A6PA 3UTQB 1RULH 2YXMA 3QUZC 4WU7B 4XPAH 1VAHA 5HJBA 1JPTH 2E7MA 1O6SA 5EU7C 3SYPA 3US9A 3Q43A 1PLGL 4PJFA 4L4TE 3PPEA 3AU1A 4CA4A 3CFDA 4D0BB 4KHTH 5LBSH 3L4CA 3RWHA 1SEBA 2Z8WC 4CN6A 2J88H 4HW6A 4PYGA 4WK4B 1CXEA 2PNDA 3DV6A 4MJIE 4WY7H 5KJ7E 2YD0A 5DJZA 1JXFA 2EDYA 2Y1YA 3E38A 3ARTA 3LHPL 1TZIB 5B39A 4AKQA 1YEGH 5CZXD 2VLME 1WCQA 2L7JA 3H4HA 1E4KA 1X5JA 4UM9B 2WVVA 3LX9A 4NRZA 3B7SA 1D6EA 1JFQH 3WOVA 1CBVH 3LNFA 3G9VA 1U93B 3QK0A 4MBOA 4RNRA 3T0EE 4KMTH 4L4VE 5LDUA 2E9BA 1FRGH 1SUHA 3NJXA 4ZZFA 1NL0L 5EZOL 3PWNB 5L2JA 1HAUA 4BUQA 3RL1B 3KLAB 4JO5A 3RVXD 5E94B 1IVLA 4L3AA 3T0EB 2FD6H 4G6ML 5ENWB 5LGHL 1TTAA 3PWLB 2Z35A 4KXBA 3ARRA 5E1HB 3LS5H 5I5RA 3QJFB 2XX1A 2D7PA 6CGTA 4HUXB 4N5UA 2IALA 4JB9H 1BIIB 3X12A 1QTSA 1KYOJ 2BFVL 5I66A 4L8CA 2DYRB 4HUCA 2WO3B 2AEPL 2AABH 2AK1L 2JNZA 2PLTA 3MODH 4HC1L 4PJDB 4PY7A 5FUOH 3FT2B 2ZWZA 2EKJA 2O72A 1MHPL 3L9EA 1CFVL 1E42A 3DI3B 4LPUA 5DUMH 3MYZA 2EABA 3MUGA 3QQ3B 2ZWNA 5AOMA 4RMVA 4Z7NF 1WBZB 1UM5L 5K9QG 1N0XL 2CBTA 2X40A 2O26U 2J8UE 1XSOA 1A6VL 2ESVA 5FGSA 1DN0A 1EV2E 3I6GB 5BV7C 4LMQE 3M1CA 3T71A 1Z3GH 2XXCB 2DOCA 3TZVD 2R2HA 1KTLA 1UQSB 2EXWC 1NEUA 2AXJA 2NYYD 3PP4H 1H6UA 3ABLB 4J8QA 5HI3D 3RIKA 3KCPB 2C9SA 1JWSA 4RSVA 5IB4B 1RD6A 5ALBH 3IMUA 1RZKL 1N3NB 2KZBA 4LMQI 4WK2B 4M93C 5EZLA 1JHLL 1OHZA 2ESVD 4JM2D 5AOJA 1Z5YD 3IYLW 4BDVA 5K9QI 1X5HA 1SLWA 2YARA 4NKDB 4NRYA 1JXGA 2K7PA 3B8YA 3LNGA 5C07E 4EI5C 1IAMA 4EBQL 4LVEA 1BVNP 1DVFB 4MZ2A 4KDWA 2R8SL 1MQ8A 3TBVB 3V4VH 2IPUG 2G5BB 4LCUA 2DBLH 3GJEB 5IKCA 2IANB 1U3HC 3QAQA 1PZ5B 1TJXA 2X1QA 4U1SB 4ZMLA 43CAB 5AOZA 5HHOE 1A6ZB 2D03L 3RI5F 5GS0C 3BP5B 2DH3A 2A73A 2E7BA 3WUWG 1H8NA 4ZFGH 4FQQB 5FB8B 3RPKA 1GSKA 4FG0A 3GGWB 4A7GA 3ZDZB 4IRJB 2B59B 4NHUB 3ENEA 2PYEB 3RWDA 4Y2DC 4PD4K 3AW5A 4PV8A 4AKPA 2IAAC 2XVLA 3ROLB 4GIOA 3WUZA 4UILH 1GL4B 5I1DB 3OBAA 4XZUB 1TZAA 4W1TA 4HBCL 3S8FB 3WEXA 2A38A 5DO8A 4R97B 5ES4B 1GGBH 3ILPB 3JWNE 2GC4C 2VKWA 4GRWB 4MWFA 1A3RH 1PLBA 1UB6B 5ALCH 3EJYD 4OQTL 4LRNH 4JFHE 3BPLB 5FW7A 3VXSB 4AQAB 4ZMZA 2VMEA 4YZWA 1WZ1L 2F08A 1JZEA 3MRDA 4E68A 5IQ9A 4R96A 4QXWA 3T0WA 5CP7A 2DEYX 5GRVK 2FECL 1GA2A 4FJYA 4JZOA 4XXWC 3H9SA 1I1YA 2I60L 1KPVA 4PB0L 3ZTNH 1F6LL 3VA2C 2J44A 3CN2A 3L9RB 4RMTA 3OMIB 4LT7A 4ES9A 2BPBA 2VR5A 3T2LA 1JGUH 3FO1B 3K80A 1PG7H 1LWRA 3VI3B 5BMFH 3BT2L 4PQXA 4N0UA 2Y36L 2YFNA 4XP6L 4TULH 5KVFE 3R7RA 3U4BH 5C7XL 4FQ1H 3H9SD 1QFWH 3MXWH 1KJVB 4CW1B 1UT9A 4L8DA 3AS1A 4AMKL 4D9QE 1MWAH 1N64L 1NLDH 2AJVL 4YFDB 3ULSB 2IOIA 3PGFL 4OLUL 1NCDH 3ERXA 4HQQH 3SZKC 2CPCA 4QRRD 2WZ6A 1JHKH 2RA1A 5DDHB 3IVKB 4IKJA 4OD2B 1JGLL 2UZIH 2D31B 2BNQE 2YPLE 1ZK5A 5D7HA 5B1CA 5PAZA 3IXTB 1MRCL 1OAXH 1Q0EA 3HG2A 1JF5A 3GXFA 4Q9CA 3OXSA 3LN9A 2UYLB 3BPCB 4B3EA 1R47A 3P4NA 4M6AA 4NN7B 2EDMA 2RD0A 3EFDL 2QEJA 3NSXA 4JVUA 2HVJB 4FQ2H 4L1SA 3FPYA 1FN4A 2XZAH 2DQCL 4KI5C 3UTQA 3W9EB 2ILLA 5JZ7C 4WU7A 4C4KT 2VABA 1A14L 1BAWA 1KBPA 4PS4L 1OLLA 2GJ6B 4KX8A 4Q9QL 2CRZA 2SODB 3VXMB 3QJUB 4YSCA 1XBDA 2BSTB 4QAWA 1CWVA 1NANI 2B9AA 1FVDB 3EJQA 1BQRA 3EBIA 4H0LC 4HU2A 3T1FB 4D0BA 5LN4A 1D6VL 2APFA 3GD1C 2QJDA 1BOYA 2VH5L 2FT8A 4P04A 4JN1H 2HJLB 2FATH 3VYOA 1T7YA 1M6UA 1KEML 1JZ5A 4WW1A 2ICWB 2FX8H 4XGZA 1WWAX 4XWGL 2NY4B 1VESA 1TZIA 3ALXA 4HJ0D 4B9FA 2Z8RA 1WIOA 2X2HA 5AVZB 1MFVA 1OKEA 5EBLA 4ATTA 1ESOA 1JGDB 3ZTJH 5I6OA 5A7EA 1RHHA 4EVNB 5LXGH 5ESAB 1PY0A 1S9VB 3WY2A 1U93A 4TF4A 2EUXA 1LLAA 4E2OA 3BIBX 5CFHA 5BOJA 1ND0B 1F4YL 4EOWL 3MLSL 3BZ4B 3MTRA 3KLAA 4BFBD 1OTSD 4OH2A 3WO3B 4BBWA 3HMXL 5CBAB 5IROC 2ZX9A 4L4VA 4UM9D 5L88H 3T0EA 5CEXB 3H54A 3QR2A 2AXFB 1I7TB 5T1KA 3D30A 4LIQH 3VMNA 3JBG7 3NP3A 3BH8B 3QGVA 2WBWB 5A3ID 4HUXA 3AT9A 5FK9B 1BIIA 1IC1A 2K45A 2OMUB 2VLMD 2XFGB 3QNYA 3QORC 3I50L 5DUJA 5DD6A 2FBJH 1PJWA 1MY7A 4JDTH 5I1AB 1GRWA 1KG0A 4H2CA 4I1NB 5IFJA 3AQDA 4UV4H 4B9YA 1BZ7B 2H0FA 3T0ED 2P7TB 1NIBA 4L4VD 4OVVA 3QQ3A 4ODBD 1WBZA 2OI9B 5T1KD 1R5WB 5HI4D 3CX5K 4UB0L 5C3TA 1SY6A 4FLHA 4LVOC 1YNTF 3D87B 2HB0A 1TYJA 2BVYA 4LRIA 4OUUB 3I6GA 5B1JA 1R6VA 1IAIM 4JEGB 5HHVL 5TF1H 5I16B 1K85A 2X5PA 4PRIB 3NJKA 1YECL 2J8UA 4J7RA 3CXDH 5ILTL 3VTMA 3LZLA 1ADWA 3L6FA 3CSBA 1F5WA 3OKLB 4QRBA 1OOWA 3KCPA 5IB4A 1OP5H 4K5MA 5MENE 3HPLB 3HI5L 1FBIL 5GIRB 1IGMH 1AG0A 5F9AC 4Z95H 3U0WH 5F7LB 5C08B 3VXRE 4CGUB 1RJZB 1YEJL 2G5BA 4G8EA 3GJEA 3MBXH 4FCHA 1PZ5A 1I8KB 4U1SA 1H0DB 5DC9B 43CAA 4JPVH 4NRXA 5C07A 3EYSL 3TT3H 1ZJAA 3U1PA 3VXRB 3X11B 3QARA 3PWJB 3KBHE 2OQJB 5J9PB 1VFMA 1R34A 2J7LA 4GI9A 1OSZB 2YXVA 3THML 3V2AR 3HBQA 4FQQA 4HJJL 1TTGA 4HXBL 4BQ8A 5E1GA 4IRJA 2B59A 3IF1A 5JPNB 1SEQH 1L3WA 2PYEA 1CCZA 2W65B 1RJLB 4UIKL 1XT5A 2IAND 2VDML 2KERA 1QP1A 4U6XB 1B0RA 1MOEA 5E24E 2XTJE 3RIAF 5I1DA 2H2SC 1KYUA 2YKLL 5TGBA 4XZUA 4DPAX 3NZUA 1Q9WB 2ZYRA 3L81A 4IIQC 1TZ8A 2L0DA 1LDSA 3H0TA 4WTZG 3RDJA 4IRJD 4TUKH 5BRZE 1MNUH 1PZ3A 1I53A 4NJAL 3FT4B 5T1DH 2HMID 2CO7B 2PYED 3ETSA 3PCYA 3ZDYF 1AZRA 1A8ZA 2NY5L 1EJOH 2F7RA 3M1OA 4S1RH 1A4AA 2CJUH 5KSVA 3F7LA 3B4NA 4RA3A 3Q7JA 1ONQA 4W4NA 4JQVC 3CHRA 1RURH 4H8QA 3X3GH 4JLRA 3TA3B 1YMME 3COOA 5F8QC 4POZC 2YBRA 2ZCKL 2X44D 3L16A 2B3RA 1J1OL 2ADFL 2A74A 2Z0BA 4TVUA 4ZUUA 3WNLA 3S5ZA 2ZYSA 3H7LA 4N2NA 4Y9FA 2V9RA 4XOCA 3WJJC 2Q2LA 5DGQA 3FT3B 1HE8A 4TLTA 3VXSD 1CDUA 2BZDA 3DHMA 2CDEB 3QJVB 3SE3C 1P6WA 3RWGA 1BV8A 5J06A 4OQTA 2OXHB 3K5RA 4NQSA 4PJBE 3STZB 4XC3L 1U8CA 4KGLA 5DZVA 3BC9A 2WXQA 1LWHA 1TTCA 2FQFA 3LY6A 2FJFB 3AQXA 5CCKL 3MLTB 2C3GA 3NPZB 2P5WE 3NIDE 4WSJA 2DQJL 4N2CA 1L7IH 5I1LB 2L04A 5DDHA 2BVUA 3FT0A 1VFUA 4AY0A 2X4RA 4AV5A 4E9YA 5C86A 1EO8L 1XH1A 3BW9A 4KTEH 1BVKB 2GABA 3IXTA 4UT9L 4LDCA 1O7DC 2UXGA 3K8KA 3KLHD 1JDAA 2YPLA 2KH2B 2UYLA 3ATAA 3BPCA 3SJVE 2CKBA 1FH5H 3SDCB 2HVJA 3LH9A 1FUNA 3APCA 5ECGA 2N7SA 4BK5A 2X4UB 2FJGA 3W9EA 2ADYA 3IDGB 5C0JA 5DK2B 2YEVB 3C12A 3CTTA 1UWXH 4HIXH 5DHVB 5AW6B 4BKSC 4YGVB 2YZ8A 2FR4A 4JPWH 2N01B 3D0AA 2BSTA 3HC3H 3JZ7A 3RX9A 3U36A 1FVDA 2VQTA 3EJZD 1OTUC 2ZXQA 4JJ5B 5CMAB 4YHKH 3UO8B 2AV7B 4UQBA 1J88A 2QPUA 3MRRA 2A0LC 5DA4A 5AVWB 3FHAA 1TOXA 3L2LA 2YPVL 3QZNA 5F97E 3DX0A 2HJLA 1KYOK 3M07A 1YZZA 4TNVF 1FDLH 4P57B 4FQXA 4NZTH 1N59A 1UH3A 4GSRA 1X4ZA 1H15B 1VEPA 3VGAC 2VSKB 3V0HA 3VXMD 3DNKA 2ARJQ 5I0VA 4L3CA 1G5GA 1HX0A 3H55A 1JGDA 5BVJB 2PW2B 4F7MB 2CJ3A 1IKNA 5DI8B 3A4AA 3VUAA 1HINH 4EVNA 4G59C 5ESAA 3TVMC 1S9VA 2K8QA 4W9EC 4LHJB 2UX6A 2A4ZA 4MHHG 5B21A 1CDGA 4QI3A 1UD3A 5E4OA 2XTLA 2Y6TE 1TCRB 2Y2WA 1F3JA 2HT3D 3MV9E 2NY4D 2HTLC 2Q87A 4K94C 5MEPB 4H5SA 3MA7B 4LEOB 3RBSA 5IVXB 1ZOXA 1V3KA 1I7TA 1CL7L 4FFYL 4KI1A 3BH8A 2XWTB 2W80C 3M46A 3FQRA 3MRNB 3MV9B 1TVBB 4MDIA 4E5XB 4CL7A 5FK9A 2K6YA 3IDYB 3KPNB 2R83A 1T03H 3GNML 3ARYA 2A9NH 1TO5A 4FABL 5I1AA 3MJ7B 5D7SL 2XHNA 1FQ9C 4XC1H 3LMJH 4PI2A 1BQLL 4Z7OF 2EEXA 3F7RA 3HE7A 3P4OB 1BZ7A 4MHHI 3LQAC 4Z7WE 3NRQA 2H0PA 1F0LA 5D9SB 4BGLA 1L9SA 3NSJA 3AT8A 1PG7X 1YAZA 5CUSL 4TQHA 2HFEB 2WLJA 5JDJA 4CVXB 1SY6H 3CSTA 4AEHL 3HMXA 4FXKB 4Z7WB 3IJSB 2UZXB 4WVRA 5EC1B 2FBOJ 4NP9A 2Y6SC 3ULUL 1UH4A 1HS6A 4DGVL 5MEOB 1ET5A 1PD6A 2WWKO 3JTSB 3VXUB 1UB5B 3OKLA 1K8IB 2EC9U 2WYZA 3QO1B 4GSDH 3HPLA 2JLPA 2EP6A 2XV3A 3MJ9L 2NLJB 1ZTXE 1TG8A 5GIRA 3C8HA 2CO6B 2PXYC 3N0AA 4YDLC 1NBZB 1UM5H 1NZRA 2OCCB 1COBA 5C08A 2YAFA 3B3IB 3WFCL 2EXYD 5MENA 4JY5L 4PRID 2R0KH 3R8QA 2OJZH 4AQ1B 3RWFA 1QI4A 1AZZC 2VXTH 3QZMA 5D1XC 3SOBH 1AJ7H 1MPAH 2N1TE 3E80A 4GUCA 3JV0A 4IU2A 4FQCL 3RI5K 3MLWH 3VXRA 3QDMB 3X11A 3PWJA 3HG3A 3FB8A 3VGFA 4Y5XB 1OSZA 1A6TA 3FW6A 5KVGE 3Q2VA 1G6RL 2ZOTA 2WXJA 5C08D 4XHJC 1U92B 3TO4C 2B5IB 5I8CA 4F93B 5JPNA 1B2WL 1HH6B 2VT0A 4G7VL 4WKZA 2H1PH 4U3HA 1LP9E 1NM9A 3SKJH 4OIIH 1HL8A 5C6PB 3ZE0E 3VXRD 3GMLB 4HMCA 1EVUA 1BJ1H 2RR3A 4NHCH 3EDEA 2NR6A 3HBPA 4X7FC 1Q9WA 1A25A 1DHKA 1BMZA 4PJAF 4W70A 2BCKA 3SE8H 2GTQA 4TSCH 2GVYA 1L9RA 1T6BX 4FLQA 3ZKQD 5B7FA 2E7LA 4E9RA 3FT4A 3N44B 3DOHA 2Y7QB 3P11L 3ZL4L 1SBSL 1G6RB 3OAWA 4U1IB 2J1WA 2BOCA 3JWNH 4P23B 3KH3A 2VLRB 5LVEA 2BK8A 3WTWA 5C0CE 3TA3A 1TJGL 4NI6A 5DFVD 3WO4C 3ECUA 2DWYA 2TRYA 3P9MB 1WICA 3HJEA 4AEIH 3WYRA 3L1GA 4R83A 3MBEB 1EEZB 2WOYA 2CH8A 5E8PA 1F18A 1YN6B 4H25A 1SXAA 2OXHA 3STZA 1ZPUA 4KUCD 4P46B 3SYOA 3FCGA 5EU7E 3KR3L 3TA3D 4GXUN 4U1HB 3QUZB 4K2UL 4MCZB 4ADIA 3O6FC 1INEH 2XA8H 1M1SA 3TNMB 3S3BB 1HNFA 3LD8B 2DJMA 3HR6A 5I1LA 4UYPA 3CPLB 5KVFH 4OZ4B 4CUCA 3CDCA 5AL8A 4AJWA 3FCTA 3EO0B 2DJUA 2CHWA 1WAAF 2P5WA 4ZMYA 5AVSB 5IREA 3NJLA 2FDBP 4NN6B 3RYMA 4JQIH 1A1OA 3KH4A 1H3PL 1JNNL 2Z4QB 4QXGL 4NXKA 3UZEA 1URIA 2BSED 4ZUSA 3WJLC 1XB3A 2YGOA 2J5LB 1T66D 2BC4B 5EEUA 2CKBH 2Q9OA 3SDCA 4N2LA 3PP3H 1OSPH 3J8F7 5AKTA 1L0PA 2P5WD 1A7PH 1T5XA 4YN3A 2WB1A 5DLML 5DK2A 4MX7B 4JMNA 3HPJB 3TOPA 1LE9A 3FT9A 1GYUA 4QO1B 1A9EA 1X7QB 2IVFC 3D25A 4OLWL 5DHVA 4X8JB 4D7BA 4FP8H 1OCWL 4HKXB 2DIAA 3WKNA 3SE4A 1MAKA 4WI6A 5EHFA 1NANH 1PKQB 5E2UL 3EH1A 5DZJA 4UT9A 2Y4SA 3SDCD 3UOAB 4JJ5A 1CICC 4I2XE 4YQXH 5GSVB 1MF2L 2AV7A 2ZOKA 4YSEA 5HHPA 4C59B 5HY9B 1TFPA 3RUGF 1RJCA 5D4QA 3U0TA 2ZSVA 2R23B 5LJYH 2EH8L 3N42B 3KNBB 3BAYA 4P57A 3CH1B 4IKIA 4Z7IA 4Q74A 2B4CH 2GFBA 1I1CA 3MCLH 4J1UA 1SRDA 3VG0L 2VUYA 1JRHI 1A14H 4WTWA 2WBXA 3X1EA 1WHPA 4G7SB 4RIRB 3L1OH 1NCWH 3W39A 5IP4A 4RGNC 2AMUA 2PW2A 4FTDA 1NA8A 2JKNA 4NKQB 4OQ1A 4R0LC 4I48A 4TL4A 4WO4C 3I6LE 4AXWB 1BFSA 4OLYL 5GZNC 4K9EC 4RFNC 1ZT1B 2AJUH 3B5TA 1JK8B 2LAAA 2R1XB 1GOFA 3GLEA 4J3OH 4NWUL 1TCRA 4BSWB 4EIUA 2NXZB 1ZLWH 1U4FA 2EDTA 2FUTA 4KK5D 4KX7A 5MEPA 2YPVA 3EHBC 6FABH 5I6KA 4P5TA 3EOTL 1CK0L 2JJUA 3SPCA 5ADPL 2ZF8A 1OLZA 2QLYA 3LN4B 3OKNB 4NO0A 5E99H 5GS0L 2VNCA 3BJLA 1CTNA 2X4OB 3MRNA 1UWGL 3MV9A 5F89B 1G94A 1TVBA 4HIEA 4H0GA 4E5XA 1TETL 4CRPA 3X2QB 1B4TA 5BVPL 4M93B 1CU4H 1QPXA 2P46B 5B8CA 3MJ7A 5G5DA 4NNYB 5FM5O 1AQKL 3FCSA 2VLKE 4QJ4B 1MCSA 1OP9A 4P5TD 3G5VB 4EI5B 4GKNA 5D9SA 4FMKA 5J0BA 4LOUD 4NO0D 5LAXB 2EILB 2VR4A 2OMYB 3MV9D 4GBXA 1U3HB 2XQBH 1RK1A 4GPVA 5BO1H 4V33A 1IM9A 3IJSA 4Z7WA 4FQLL 3KYMB 4FFYA 4I87A 4LPTA 3WHXA 1K2DB 3DO7A 3FMGL 1W6WA 4LLDA 1YPZB 4AQOA 3KVQA 3LNHA 3NJHA 4H8WC 5CJBA 2AW2A 3KL3A 3UAJC 4B53A 3JTSA 5ACZA 1L6PA 2VAAA 2XVGA 2FVNA 2HT4D 1K8IA 3WCYA 1F58H 3GXUB 2DQIL 4LCIL 4Y2DB 2NUPA 1CIDA 2NLJA 4HS8H 2DMKA 2LTQB 2FCBA 1NCGA 1OSEA 5JW4R 5AVRB 2CO6A 4O02L 4BE5A 1NBZA 2EVJA 3HHSA 3DDGA 4LQFH 3CV5A 5FCUL 1E4XI 3FUJA 1JNJA 5T1MB 5HXMA 4YBQD 4J2XA 4MB5A 4DTGH 1NPNA 1SLXA 3JXAA 3VXUD 4UAOC 3MRHB 4AX3A 1DEDA 1OB1A 4WUKL 4OB5H 2Y0SA 5IW3A 1SNRA 3BVWA 1N70A 3FCUB 4N4YB 4LLWB 4Y5XA 4MZRA 2R9HC 1RH8A 1CJYA 3ARQA 3SPGA 4R90H 4X6CE 2Z64C 4XI5D 4MMYA 4M4RB 3CH8A 3U9PH 3FO0H 2VN5A 3SGJC 4PRHB 4DN3H 5FPIA 4O02B 3SB3A 3KMDA 1HH6A 4LAJH 5FR3A 4N22A 4JFTA 3RIAK 4IDJL 1AD9B 3NP4A 1PYWB 2GAZA 2GI0A 1MVFA 2EE3A 4X6CB 3ULUD 3GMLA 3IM1A 3QDMD 4M4PA 4ZS7L 1CUOA 5H37G 4OF5A 4K07A 1EXUA 4JY6B 3BLBA 1UGKA 5DVLA 5AQ0A 4DJMA 4DZBB 4Y5VC 3QRFM 3V6FB 5I8OH 2VDKL 3UG4A 1WSST 3S8WA 2HRLA 2JI2A 4MXQD 1NGWB 4Z7UF 4PJ9C 1I9IH 4E0RB 3GBNL 3EYUL 1G6RA 4U1IA 1KTBA 1UWEL 3IMTA 4WW2C 3RVWD 3VRJB 2DWDB 1Q0XL 3WKPA 4HSCX 5IMKB 1IU1A 4Y7OC 2VDMH 1J48A 1QVOB 4KKCD 3ZIMA 1R0AH 4W9LC 3ZT5A 4ZX3A 5E2WH 3PGDB 4GP4B 5DC0A 1VPOL 4UOW0 4KI5E 1B90A 2WKGA 2YJLA 2H2PC 2VDKB 1EEZA 4XCFH 2HTKD 5IK3B 4P23D 3MOBL 4C83B 2FO8A 2VLRD 2XWJB 3A67L 4H8HA 4IJ3C 2CDFB 3LKRB 4JFOB 5JXEA 4KJPD 4U1HA 3QUZA 3O3EB 2VMFA 3HCVB 3FDWA 3V0JA 2JKXA 1UYWH 3B7RL 3TNMA 1MG3C 4DKDC 2VZVA 3CPLA 2ZCKH 5B3JF 3MBED 3DSFL 1H19A 4L5FL 3ZE1F 1MCIA 1B4RA 1A6UL 3TH4T 1QRNE 4LCWE 5HGDA 2DQDL 3EO0A 4M1GH 4F7TB 2BX5A 3CVHL 4QJ3B 1SJHA 4P46D 4RWYL 4YHLH 5JXED 1WGVA 3QUZD 3UC0H 3G04B 4NQDB 5D1ZC 3C6LB 1OP3K 2ZYIA 2YAOA 3BGMA 1OO2A 4NO5A 5EOTB 3NFPB 4KFZC 1RUPL 4D9LH 1KGXA 1KIUA 4LASH 2EDJA 1Z0MA 4L5FE 3U48A 4LSUH 4ZMPA 3QB7C 2WVUA 4FA8A 5DS8A 1BQHG 3DPBB 3MXVL 3JV6A 1FC2D 4NQEB 4MX7A 4HFWA 3HPJA 4EDXB 4QO1A 2B1HL 1LNUA 2TRHA 4J8RB 5JIPA 4TTDC 3CVHB 5IMLA 1BZQK 3CZEA 3VD9A 1PKQA 2DL2A 3A6BH 1UFGA 4LQ1A 3NIGF 1SN0A 5I18L 2ZICA 4I9WE 1HWGB 3GIZH 5GSVA 1U8NA 3FTWA 4U6TA 5I17A 6TAAA 4JKPH 2YSSB 4UMGA 4TNVK 2KHAA 3QAZB 4LSTL 1CLOH 4WCYL 2R23A 3ROOA 2DYSB 1VGEL 2VMJA 1YDPB 4H1LG 1DQDL 3CH1A 5FGBC 3MLVL 4HPOL 4W9KC 4M48L 1Q72H 1A65A 3PDOB 3OAYH 4NFDA 5DVKA 3DHUA 4HIPA 3BCDA 4BD4A 5IR1A 3IJYA 3MV8B 2NY1C 2XT1B 4PHXA 1LHZA 2NRDA 4YDKL 4AM0B 1FNLA 2X4PB 1RVFH 2AI0H 4AXWA 4L2LA 4G43B 4DP7X 3CUPB 4JDVA 2BIPA 4GG6F 3LPFA 1GR7A 4LVOB 2B7DT 1NCBL 4TM9A 4D0DB 1JK8A 2B0SL 2R1XA 2IGFL 4YSSA 2JJVA 1FSKC 1UC6A 3RURA 4BQBA 3V52H 3WL9A 1A1MA 1IARB 5I6LA 5DZLA 5E9NA 2N0MA 3U79A 3IFNH 4WENB 4YX2H 4HUWB 4X4YA 5LLIC 3NCJL 3OKNA 2VITB 3I9GH 3NEEA 3QJHB 1OF2A 2IOOA 5DD5H 1NMAL 4N2KA 2ODIA 3KVDD 1P69B 3L5XH 4OZHE 3G6AA 4KHXH 2R69L 4OM0L 1AS6A 1U0QA 5HHNB 5ICXA 4XNZC 5AKVA 2G4EA 4F80A 2NXZD 4NNYA 2R1YB 4PJIE 5EORL 3ZRCC 3T6QC 1MI5E 4XCEB 3I6LD 4EI5A 4MD0B 2R29H 3EGDA 4H20H 2QBWA 4ZS6C 4GT0A 4YZFF 3BKJH 1N4XH 5LAXA 5HYJE 2OMYA 1DSFL 1X9QA 1U3HA 4KZCA 3REVA 4Q6KA 2B2XL 1QZNA 3V0VA 2HN7B 5FECB 3QUYC 1J0HA 1RY7B 3DGCR 4LCYB 1K2DA 3HUJE 4U6VH 4UTAL 4IRSB 2DI8A 3WHE0 2Z1KA 3HZKA 3D85B 3PF2A 4EI5D 1UM4H 2OMTA 4HIHB 4P9HH 3F7KA 2VDOL 3GYRA 2VERN 3BUYB 4L23A 4QR7A 1BHGA 3K7UA 1YCSA 3MRLB 4Y2DA 2DMHA 5CIPH 1U3HD 2B9BA 3P77A 4GAJL 4K3DL 3ARFC 4GSUA 4HGMA 2CHDA 5GQBA 2D0HA 5GS0D 3PAVA 4WJKB 5F7BA 4EO5A 4HCRL 4PJXE 2CO2A 1JDCA 1SXSA 4Y4FC 2LT9A 1DVYA 2WXRA 3NA9H 5I76B 1ZTXH 4XPBL 4KQ3L 3MRHA 2JCCF 4RGOH 1A6WL 2Y23A 2FSEA 2QZ5A 3N9GL 4P3CL 3S4SA 4Y2DD 4EAEA 5GRZA 5EZPA 3FU9A 2CRYA 3D09A 5KANI 2VDOB 5JOFB 3CVBA 1ZVSB 3QEQE 3OLIA 1DBAL 5ID1A 5D70L 1KGCE 4XXWA 2AQPA 4HEME 1MIMH 1UA6H 3CHSA 3FH7A 3MLXL 4M29A 4AG4L 1K3ZA 4G70B 5FGCE 3FQTA 2BLFA 3LEVH 5BZWB 5I1CL 3QEQB 2P8LB 1PYWA 5KVGH 4X6CA 2DV6A 3EDJA 1MCHA 5BQDA 4EQ3A 1Z9SA 4JUTA 4JY6A 1JPGB 3LH2H 1BXVA 1IFHL 5FGCB 2BS8A 1BEXA 1CC3A 1GYCA 4OZFB 4WEBL 2G3ZA 3D34A 4TPRL 1F3DH 5GS3A 1NGWA 4PRHD 5EFIA 3U7YL 3P3RA 2O5XH 4YXKL 3V9EA 3WMQA 1TZGL 1R33A 4M3JA 3D06A 2AS5M 4LLYA 4P9ML 2GBAA 3MSPA 4O58L 3FZUD 3CHQA 5F1NB 3E8UL 1KYDA 3U4KA 3WENA 1A3LL 2FZ3A 4GMTL 3H85A 2ATAA 3ARGB 1FFPA 4NUQA 2ENSA 2DWDA 1IZKA 1R3LA 3QRLA 1N7MH 1LMIA 1QVOA 3JUZA 1OD7A 4PWJA 4YPGB 3WTXA 1Z0NA 2QHRH 2X6AA 2JB5H 43C9A 2DQEH 4LXFA 1ZXKA 5TH2A 3BSHA 4HCIA 4LKXB 3CFIC 5IK3A 1KC5H 3SYCA 4K4KA 2ZAGA 4LOVA 3S0PA 5BXFB 3DSNB 4XVSL 3PQYE 4M7LT 5CKGA 3HCVA 4HUNB 2PTTB 4G7RB 4ERSL 1CXKA 3KDMB 3L1EA 1NCJA 1U91B 5KZCB 4I88A 5A1AA 2ZKMX 1NDGB 2ZOOA 5SX5K 2Q86B 4H13C 3HI1B 3QULA 1ZGLM 2AEOA 1JNHA 4XP1L 4DW2L 4HK3N 5CJOL 2AXHA 4OR1A 4YVUA 2W95A 4A68A 3VI4E 2CIIB 3AACA 2AEQH 5JZ7D 3G04A 4QNPE 1C5DA 1SHMA 2G3MA 4K94L 2CSPA 4M7JH 2XSKA 2NNAB 4LCWA 4JBSA 2GTZA 3Q3GB 1N10A 1AG6A 5AB0A 3RQ3A 4AIZB 1MRDH 3TYFA 2H1LM 3IDXL 5C3LD 2FEEI 3VGAB 4J3UA 1MCOH 4OF7A 1QA9B 1R3JA 2YSTA 3ETBF 1FGNH 1PLCA 4MXVE 5D2LE 1BBDL 3TX4A 5DHXB 3X13B 1MCRA 3QZOA 3TVMB 5IHZA 5D5MB 1GGTA 4L3EB 4NQDD 4EDXA 3C6LD 2J56A 4DKEH 3KYNB 4AI7A 1LL1A 5D2LB 3KS0H 1OT4A 1TKWB 5KEZA 2ZX6A 3VRLF 4XPTH 4Y5YA 1XGZA 1JPSH 3GJFH 4XN1A 3HZ3A 4GAYB 2ZXAA 5IROA 3VWJC 4PVLA 1RXLA 2YSSA 3BUIA 1A4KA 1GY1A 4NQED 2VSDA 2R4SL 4L37B 1RUAL 2X41A 1YDPA 4C4KO 1FI8C 3ARZA 1XGYL 4HH8A 4L4JA 3ZDXF 1EDYA 3O6MH 3QJRB 3EG9A 5EO0A 2A83B 3QORA 1KBGL 4AQEA 2YK1L 4NLAA 2OL3L 1JRHH 2YA2A 3EZJB 3BP6B 2X4QA 5IUSA 3H7BB 3ETBJ 4DPBX 2G60H 2E76C 3LN5A 5DFAA 4Z5RA 5IROD 2WP3T 4AM0A 4DF9A 4OV6F 4XN2A 3RG1C 5EUOB 2NYZA 3CUPA 1KXQE 4DOHE 4R4FH 5F70A 2FJHB 3TP4A 4QUOA 3VW3L 4FTVB 1SZNA 1MW1A 4PH8A 5E8NA 3A6CH 2XZZA 3ABMB 4RGMB 3BUTA 1RP9A 3D05A 2HPOA 5BV7H 1IKFH 2KMWA 3T6VA 2CDGA 5CSBA 4HUWA 1WZAA 4IMKA 4ZAKA 4M43H 5TDNA 2VITA 3DIFB 4G8IB 3MV8D 3QJHA 2OL3B 4WGKA 4Y19E 4JG1L 4UUJB 4QHPA 5HBBA 1AGCA 2ENYA 1VFOA 2W0FB 4P99A 3GXNA 4WFEE 5HHNA 3IFLH 3WDHA 4OZIF 2PXYB 4CJ1A 3VXTB 2R1YA 3FQXB 4LSDA 5I71C 1FIGH 5A6MA 2ZKXA 3JT2A 1RU9L 4PJCE 4OZHA 1M1XB 4P07A 2BY1A 1AR2A 3HAEB 3IRPX 3GMPA 4TOYL 1E6OL 5D1XB 4PJIA 1QHPA 5LN8A 2OA9A 3KJ4C 4QYOB 4PJCB 4LCYA 4LAQH 2XPZA 5AVTB 2EYTB 3E2HB 2CM5A 3F64A 2WANA 3F3HA 5HYJA 2PN5A 3AU0A 3L9BA 4PVBA 2FB4L 3BVNB 3O4LB 3D85A 1RZJC 1EEYA 2R69A 3WMSA 4XMPL 4E9WA 4G8GE 3ESMA 1HHIA 2KT6A 1CFMA 4OJCA 4A2GA 2ZOUA 5TK4A 1FG2A 3VFGH 3D3VB 3AFLA 2ATPB 4M5YL 1BMWA 4DT2A 5K69A 5MEQB 3BKYH 4DN4L 3RWCB 5I76A 1WWWX 1OM9A 4IIQA 2ZG2A 1S7UB 2YMXL 3D85D 1WFJA 4WWKC 2UXFA 4X6EA 5E8OB 3PXLA 4HFUH 4I5BA 3G6JE 2CD0A 4PJXA 4EUPB 1D2PA 2VUOA 2AV1A 1XDTT 3VFNB 2H2SD 4MNGB 3GSXB 4JQVA 4ELKB 5GPRA 3VX1A 2A6IA 3G6JB 3MKKA 3W5MA 3BUBA 3NCFB 3WTSA 5FM8A 3BN9C 4AGOA 1RZFH 2Y07H 2OTUB 3DJZA 5E0FA 3QNZB 5ESQB 4AYFB 5BZWA 1E5YA 4HCRA 3FN9A 3QEQA 3W2DH 1XGPB 2E6PA 3MBWB 3WJJA 3BZFB 5DYOB 5C97A 4HEMA 3SE3A 4OLVH 2APXA 4CSPA 2J2ZA 1IEAB 5FYJL 1F86A 2NZ1A 3R4DA 2CRMA 5C3IA 1BBJB 2EO1A 2O6EA 4OZFA 4X4XB 1IBGL 1G5AA 2HKFH 1WITA 4RZKA 1U8JA 4WWOA 3EAKA 3KHQA 2LABA 4POZD 5CBEA 2W92A 4OF6A 4XB8A 3T3PF 3O6FB 1LK2B 2BY2A 2ZWYA 4QF1B 3BDXA 1RK7A 1NINA 2F2HA 3QEQD 2XZQH 2IH1A 3FTUA 4LSVH 5F1NA 2A9CA 3WAJA 1F4HA 1W72L 4D2NA 5KW9H 3DOSB 1KIPA 1IC7H 4XAWH 3MACH 1IAIL 1YSOA 5AW2B 4R6UA 1OPGH 3KWTA 4GJTB 5IVZB 4Y9BA 2ZP0T 1P4IH 1W8EA 4GAAA 4OIFA 3GPEA 3D6GA 4AJ0A 1WISA 1YEKH 3ZQXA 4H8UA 1Q9LB 4LKXA 1KFAL 2XIDA 3ARGD 4X8CA 4DVBA 1P4BL 5DEFA 1SMAA 3D69B 4WNQA 3DSNA 2E3VA 3IPEA 4X7SH 2JWYA 5I0ZA 2PTTA 1W72B 4PV1C 1GKEA 2CE6A 3KDMA 5KG9B 2ZCHH 1PU0A 4J4PC 2C3XA 4QHLB 3PQYA 1AFVL 1TIUA 2YWYA 3HI1A 3MRGB 4PWHA 2NY2C 1I3VA 5LHDA 4K9EL 3K6NA 4NKMA 3QJOA 5DLLA 1E7VA 3GLDA 4S0SD 5CINH 2CIIA 5FFOA 2ERJC 4FNTA 1OAZL 3Q13A 2R0LL 1S7VB 2X3AA 2EYSB 2HJKB 2C3VB 2XBZA 4X5WA 4RGNE 5KZCD 2YOCA 4U1NA 4AIZA 4FI8A 2FO1A 3HOGA 1GGIL 4MD5A 4OFIA 1IE5A 1KXVC 4M02A 1JPFA 4PRBB 2ICWI 1TENA 2RCSH 1AGBB 3IDNB 3X13A 3WNOA 3SE9H 3CSYB 4R0LB 3CU1A 3TVMA 2A0LD 5D5MA 1OAQH 2H9GB 1Y1UA 3IWUA 3LRSB 3OKKB 1CLYL 2P8PB 5FS5A 1G7JA 4RFNB 2X7LB 1ZANH 5D2LA 4RISL 4M6NL 3MGTA 3OB0H 1ZV2A 2E4TA 5FYJU 3WIHH 1GSMA 1MXDA 5CLYA 1G9NH 1DL7H 4UF7C 3WTTA 1UTDA 1Z3RA 1XGRA 1T21A 1NGZA 2JQZA 1A4CA 4FDWA 3TVMD 2GSGB 3QFGA 5ESVB 3ZYJA 4L3ED 3GLAA 4HD5A 4EZMA 5BUPA 3PAUA 1ZHBA 1WAPA 5JW4Q 3OKMB 2KZ1B 3QDHA 1ZS8B 1WH0A 1XCTA 1YYCA 3BP6A 2HTLD 3NA4A 3QFJB 4PR5B 5I6XB 3H7BA 5IOKA 5HDBF 2AJ3A 4ZFZB 3OTTA 4U1JB 3MLRH 3H56A 4JRYE 2IWGA 35C8L 3IDIA 4Z3EA 4ETQB 3B7TA 4F9PC 2PWFA 4WO0A 3UP6A 3PDDA 1YEIH 2DQUL 4GW5B 3UTSE 1FZOB 4GEIA 2Z7UA 1TU2B 4FYSA 2IFGA 1ERNA 2V2WB 4FNLL 3U7WL 4HJIA 1J86A 1KXQA 3SGEI 5DJ0B 2XQ0A 4BCZA 3BEWA 1RIVL 3MX0B 4JFUA 3QUHA 3UTSB 3T3MF 1OQOA 3L13A 2BIHA 3IU4L 3O3AB 2Q8AL 2OL3A 5DR5L 4JCLA 1DYZA 4UUJA 1UD6A 3P3SA 4X5QA 5FF6A 4Q2ZB 1XF2B 5AVYB 4FTVD 5DC4B 3QEGH 4AL8H 1YJDH 2C8NA 2PXYA 4O4YH 4N0YL 1FIEA 4PGCA 2N0KA 2BH0A 3FB7B 3BD5A 2XFXA 1CZ8H 2Y6SD 1TXKA 2ITFA 4G5ZL 1SYVA 4N2FA 5JDSA 4MYWB 1FNSH 3HAEA 4UAOB 5D1XA 2O5YL 1XX9C 2QKIC 4ZBJA 3ABKB 1BYOA 3VB8A 1CTOA 1HE7A 3F6LA 4R7NA 4PJCA 3C60B 1D5RA 1F4WH 4N20A 4B9CA 4NT6B 3RB5A 4H8PA 2PXYD 1FHNA 3IDJB 4KO5A 4W6WB 2UZYA 3NTCL 4HUVA 4O51A 1Z9NA 3LEYH 1XZ0B 3BAEH 1G7PA 3QXVA 4MLIA 4PGEB 2R69H 3TO4A 3S35H 5F96H 5HGBA 2Y7MA 3HR5A 2YPKB 5D1XD 2K6ZA 3ZRSA 5AZEH 2VMCA 3D3VA 3ME0B 4U7SA 3V5DA 1WBYB 2PCPB 3UBFA 4A7QA 1JGVL 3L3JA 3FYIB 1OAKH 4QKTA 3DECA 1TTFA 5AD0B 1N68A 4G8GA 5MEQA 1E7UA 4KZEH 3RWCA 4X7DC 4G7YL 4YEEA 2CK2A 5F7EH 5MERA 3D4YA 4XHJD 1PQZB 1X7SA 1BXXA 1P9MC 2JQMA 2VC2H 1BOGB 3BXNB 4PUBH 4EMZA 3U9WA 1MLCB 2XLLA 2Z65C 1BDYA 4X6FA 2XN0A 1LM8V 2JF1A 4NZUH 3KXFB 3PNWB 4X9IA 3DC0A 3T4AC 3D3VD 3VFNA 1AS7A 2XWEA 3JQOB 4MNGA 3GSXA 4WW2B 4ELKA 5KS9B 3BHBA 3H3KA 3HHRB 3G6JA 3AGWA 3GDCA 4CN1A 5FFGA 3RDTC 4G8GD 1C9SA 5E2JA 4O9HL 2FHBA 2PCFB 2G9HB 2XACC 4LFHG 2X2JA 3F6JA 1LDPH 1OM3L 2APVA 2OTUA 2EAEA 2WUBH 4BHUI 1USZA 3QNZA 4TUUA 5ESQA 5FHBL 4AYFA 3BGAA 3CN4A 1LEGB 2HLEB 1W15A 3BZFA 4CSZA 5JQHC 5E6YA 5JPMB 3QNFA 2PCYA 3FN0L 4PJBF 4MJ5B 1BBJA 4IJ3B 3LEXA 2EACA 3JWOH 4ORGB 4OZGB 4X4XA 2EVIA 3CFBB 3APMA 4LB8A 2YQGA 1JNLH 3WBDA 2NYKA 2VXSL 5D72L 3O6FA 1CB4A 5DQDL 3TEUA 4P8QA 3VH8A 3GSOB 4MASA 2ODHA 3ZUCA 1HCVA 1QFWM 4Q8BA 2WNGA 3OHXC 2M2DA 5B1AB 3NZHL 2EDHA 2A77L 4K71B 1AQHA 2GYSA 4NOBA 3VNZA 3WXVL 3HRZC 1WA0X 2H8PA 4XE5B 5HJDA 4AQZA 3EOBB 5D1ZB 1KB3A 2V33A 5IVZA 4ZW7A 4GFXA 4TUJA 3O6FD 1PZAA 3WJLA 1PY9A 5E9DE 4JREC 3DX2A 3UYRL 2JMRA 3ZKXC 4UINL 5DT1H 2CHZA 2J20A 2QSCH 3LKQA 5HYQA 2EC8A 2ZXBA 5AWNL 1EXHA 4IBVA 2EEFA 4ISVB 3VRIA 3OG4B 1BXUA 1W72A 5KG9A 3ZZ1A 1T04B 1X9RA 4PJGF 5GRYA 1PNCA 2BVTA 3L3IA 5FYJD 1EJFA 3R7QA 2ZWLT 4BZ1H 4U49A 5T1LB 1RZ8A 1U95B 3GRWL 3MRGA 1Z6JT 5D93C 4FNQA 3CMGA 4F8QA 3U46B 1C1EH 1TJIL 1CICA 1ZLVH 2WMPB 3WFEL 3VXOB 3DROB 5TFSL 4JKWA 3D1MC 3U30C 2X3BA 1S7VA 5D7JC 2EYSA 2RB8A 5TJWK 2C3VA 3BD4A 4IOSA 3V0WL 3BH4A 3FFCE 2XV2A 5E8EB 3MLZH 4YNYA 3ECWA 2WK2A 1EHAA 4PJ7F 3H2PA 1CICD 4PRBA 4YUEH 3OZKA 1AGBA 7PAZA 3KEHA 5AAPA 4WO4A 1DZ0A 2VXUL 2H9GA 3LRSA 3OKKA 5ANME 2P8PA 2VSMB 3MROA 5GZNA 4PW3A 3VFPA 4X5PA 4S1DC 1JXDA 4IOSD 4A55A 2XPYA 2FHFA 1HZHH 4C55A 1FSKB 2HPTA 5IFHH 4JGUA 5TE6L 5D7EA 4HULB 1HWWA 1U8HB 2DEWX 2WD0A 3MYJB 4XP4L 3BPNC 4ZMAT 2VDLL 5ITBL 3NFNB 4I0PC 1JFHA 4M7LL 4P2OC 2E9WA 1BX2B 4M8QB 1H3XA 1QI3A 2GSGA 5ESVA 4M6MH 3MZGB 5AZ2H 4AE0A 5I1EL 3VXQA 2WWOA 5GZND 2CUAA 1C7TA 2AITA 2DQFB 4XNZB 3O3BB 4XNYH 5GGTL 3QFJA 3GMRB 4PRDA 4PR5A 4YE4L 1CE1L 1FNHA 1KCVL 1ECYA 2I27N 3AQZA 3LQAH 2YA1A 5IF0B 5EDSA 5AG9A 1ACYL 2IQ9H 4WV1A 2X70A 5GISL 1P7HL 3IMSA 1NUDA 1N5YL 1DQTA 4GW5A 1QFOA 3MLYL 3UBXB 4MA7L 2VDLB 4WHYH 3C8KB 1P4LA 3QUYB 1RCYA 5HDOA 1R17A 2BNUB 4JRYA 4XR8C 3LB6C 4C58B 1RK0A 2DD8H 1KGJA 2OX5B 3NGBB 3QFJD 1TTBA 4LSSL 3UAJA 2OK0L 1S5HB 5HGAB 3TF7C 3UTSA 1KBGH 3UBHA 4YHIA 3O3AA 1FFOA 3DI2B 3GIVB 2BSSA 2ZUQB 5IGXL 4Q2ZA 3BUDA 1MJ7L 3ARPA 4PLKC 2YGQA 2HX7A 1QEXA 3KM1A 3II1A 2UWEE 3C6SB 2QADB 3FB7A 3GZOA 3HS9A 4Y4FB 3UAJD 3VE0B 1U8OA 2PWGA 3K71B 3UTSD 4DEUA 3GXDA 3W11D 1WD8A 4YSAA 4BFKA 4EZLA 1AY1L 5G55A 3OL2A 4KK6D 3HJ0A 2NY7H 4G3YL 2LW3A 4GLRI 4JO3H 3UL4A 1T5WB 3WIAA 1A47A 1G7LB 4JFFE 3BOVA 4ONGH 1J5HA 2QPFA 5ID0B 2IPUK 1QKZL 4GUPA 4JR9L 2J1KA 4AITA 1DUYA 1HQRB 3BKCL 5K9JH 3EDDA 12E8L 1NGQL 4U1GB 3ZT7A 4IGBC 4PGEA 1CFTA 4OCSL 4XODA 3SGJA 1V7NH 4APXB 2YPKA 4GAGH 1LP9F 1YQVL 4P5RA 4LKCB 4M6OH 4UTBH 2YUWA 1T2QH 3C60D 1V54B 3QFDB 3PYCA 1PZCA 3PGCA 4FFWC 3CC5A 5AD0A 4GXVH 4Y5VA 5D6CA 4FMFA 4NWTH 2ZOLB 4PWFA 4XP5L 3ZQ9A 1E4WL 1F90H 2WWMD 1GW6A 1PQZA 2P80A 4I18C 4X80L 2IDTA 2J12B 1H5BC 4PJ9A 4WLCA 3BXNA 4LEXL 1MJ8H 3W0WB 1YNLH 3EOAA 1Q0YL 3AXLA 5ICYA 1J05B 2XIIA 4X99A 3F7PC 1QFUL 1S4IA 3PE9A 4B41A 3KXFA 1TDQA 1RFDL 4WW2A 5KS9A 4GEJA 4ZODA 1VA9A 3Q8FA 3GSNH 1OGPA 4YXHH 5I5IA 1MUJA 1VSCA 2F5AH 2G9HA 2PCFA 1UXLA 2BCMA 1P0SE 2PR4L 3RY6C 3QUKA 5IJKC 1I7RA 3D2UA 3DDFA 1T0MA 2P80D 4B9PA 3PHQB 4AV0A 4AOFA 4JN2A 2E74C 4F2ME 2EKSB 5TDOB 5JXAL 1EFXB 5A2AA 3KXFD 2V7HA 2GT9B 4LVHC 4MJ5A 2BERA 2X1XR 3F12B 4OJYA 1QABA 3SKOB 4ORGA 3GMNB 5FDWA 4F2MB 2Q76A 1M05B 3WS3B 4WUUB 1AHMA 1IBHA 1JXKA 3OJ2C 5CCGE 4F33B 1PCXA 2ZX7A 4LGRB 3FB6A 4R5TA 1WFIA 3F7YA 3D50A 4CADA 3GSOA 4X9GA 2O5NA 1OF0A 3R18A 3MNWA 4S11A 3TNNB 2VDPL 1I9JL 3FONA 3FTGA 3IJEB 2WGXA 4PCKA 1NCHA 4JO2H 5L2KE 3NABH 4HS3B 2AK4B 4L2YA 4PJEF 4R4NC 4XMZA 3EOBA 5D1ZA 2YD1A 3SCMC 2XU9A 5F88A 4BSVB 3W1ZA 5KSBB 1J5OL 4WI3A 4P59H 1MQKL 5I74B 4WWID 4Q52A 2Q8BL 1HHGB 1JCVA 2ZX5A 5HYSG 4ODVH 1W9XA 1HEHC 2FQEA 3QG7H 4ISVA 4L29B 1JZ6A 3E6FA 1I1RA 2GK2A 4AKOA 1KCSL 3LDBC 2CK0H 4OCWH 1MDTA 1T04A 3BEVB 4NM4H 5D1ZD 2IMNA 3ZOAA 2VDPB 1B9KA 4YFLF 5C9JB 1QZ1A 1NJ9B 1ZHKB 5T1LA 4UBDC 4Z7NE 2HRPH 4BKLB 1E28B 1L7TH 5CJXC 3NJFA 3BVUA 3U46A 4IOFC 2D7TL 4YAQA 5I15H 3NBNA 2BWQA 1UATA 3DLQR 4IDLA 4OM1L 3VWJB 4A37A 3VXOA 1WZKA 3RKPA 4I77H 5JQ6L 2B15A 3CLEL 5EOCH 2X1OA 2WYIA 2C9RA 2P45B 3OPZH 2P3YA 1P4BH 4LLUB 2UY6A 1XL4A 1SOKA 3JUYA 1JI1A 2J25A 4TTDD 2R1WA 4QRSA 4JE4B 5T1LD 4DEPC 1RUMH 1F41A 5CILL 5GJSL 1C8QA 3S35X 1HJCA 4LSRL 2VRKA 4XB7A 4W81A 3FFCA 4XNDA 3GRWA 4MXWH 4H4NA 5A2FA 1UFUA 4JFDB 1F00I 1AGFA 4JG0L 3MRIB 5EU5B 1G43A 1U8HA 2YAQA 3MYJA 5J12C 3EJCA 3L45A 1DQLH 4HWEL 4JFZH 5ANMA 2Q0ZX 4MCYB 3NIFF 1MH5B 2HFTA 1U3YA 3LPPA 2AZAA 1DSWA 4OFDA 3GHPA 1GYWA 4X6DF 4M8QA 4FFVC 3FFCD 2F19L 4N1HB 1I8IA 2IFFH 3M8OL 3TIDA 1MFAL 2CGRH 1MHCA 2QSQA 2N7AA 1RZJL 3B2UD 4PW4A 4MYPA 5EF3A 2DQFA 5E5LA 1UCTA 3O3BA 1MY5A 5CGYC 3S98A 2AQSA 2FT6A 1UXMA 3EXJA 1PEZA 4P06A 1DLFH 4D8OA 3L17A 1HCYA 1MIEH 1SM3L 3DX8A 5GHWL 3HB3B 4AZ8B 2IG2L 3F84A 3FU7A 5KTEH 4BEIA 1EANA 4GO9A 1B6UA 1SBBA 3C8KA 2DKSA 3I02A 1KPUA 1E8ZA 3FOLB 3QUYA 2JTDA 2VXQA 4M1DH 5JW4M 1JYNA 3E6HB 3SGEH 2OX5A 4I13B 5TPWH 1FORH 5DMGD 4H8WH 4F8PA 4B9IA 3DMMB 3EO9H 3DVFA 1DQVA 2ZSWB 3WLBA 4KZDL 1H3WM 2EIZB 4X5LA 1C7SA 3GIVA 4JRXE 4K7PY 1BQ5A 5GGTA 2VN6A 2VQUA 4UIMB 1QUNB 1XH2A 2ZKHH 1A6AB 1F11B 3QPQC 1IBYA 3BFWA 1R24B 1KJ2L 3ARFA 4OVUA 4TNWF 1U8PB 3ZL2A 3QUYD 3MOQA 2F7PA 2ZT9C 4BQ6A 3HNVL 4FYRA 4A6YL 4TSAH 4YHOH 3CZKA 1CDYA 2CKNA 3C6SA 4AGPA 2Y22A 3DX7A 4Y4FA 5AB2A 3VE0A 1UENA 1TUPA 1QNZL 4WWKB 5EBMA 1FV1B 4UV7L 5I19L 3QXDA 1MCWW 1HVXA 2XRAH 3QXTA 2H41A 5MP6H 2WAQA 1UHVA 2Q10A 2R0WL 2UWEA 1T5WA 3TBSA 3O9WC 1I3RB 1D9KB 1OE2A 3WEBA 1HQRA 3N41B 1JZ3A 4XHQA 4HH9A 3ZYIA 3MV7B 2QADD 4Y4FD 3LKNB 3DUUB 4MJJA 2O61A 1KJ2B 3L7FB 4JFFA 4RZCB 4XPGL 2MPVA 3LTVA 3NFSH 4APXA 4U0RC 5D7KE 1WA2X 2CALA 1ZVYA 4A6YB 5CJQL 4AW7A 2V7NB 3P02A 3CFNA 2W38A 3IWVA 5AL0A 4EE2A 3QFDA 5HDQL 5JORB 1NGXB 3DPDA 5KBDA 2VDRL 2E46A 1ASOA 1XR8B 1RPQA 4WFGD 3NEXA 5DS1A 4J6RH 1DANT 2ZOLA 4FGMA 4PTUB 5FKPA 2BW4A 3SDXB 1NWOA 3ZHKA 3SQOH 3U83A 4JFVA 4JFFD 3CVDA 2AGJH 3GI9H 3GSWB 1J05A 2ADJB 3EO1B 3WSQL 1AZCA 2KPWA 2W60A 4FLSA 5I1GL 3K0YA 3KPPB 2TSBA 5BPPA 3HG1B 3KPRE 4ZFQA 2YIHA 1DSYA 4MAUH 1ZXQA 4W9GC 1M3IA 4MSWB 1NQBA 1OANA 5C9KA 3PHQA 4YSTA 2VDRB 4C56B 5AB1A 4A2MA 3O0RL 3G5XA 1S46A 1KTJA 3W0WD 4S10A 2EKSA 2WIIB 5FYLL 1J5IA 4HLZG 1EFXA 1U3JA 3QCUL 3MU3A 1JIBA 2RH0A 2G30A 3WY4A 3IGKA 5JHBA 2QGCA 3K0WA 2CLRB 4OFYA 4N0FB 3L95B 1B4JL 1T1XB 5KAQG 2ZONA 3K2KA 3MUHL 3GMNA 1ZIBA 5C0ND 3U2SA 4F2MA 3HMWL 4QXTA 3WS3A 3BWZA 1N6VA 3DX6A 4JG5A 1GH7A 4LOFA 5AOIA 4NUJA 5C6TL 3WIIH 2G75A 1K3IA 4W9HC 1R3IL 2P44B 5AUMB 2B3IA 3OSVA 1EFXD 4NYLB 2XKSA 3EKCA 3N85H 1LMKA 2HJFA 5KJRH 1DE4A 1AAJA 4OFYD 3FH5A 4K7FA 3N55A 1VFAB 5JMOC 3RY5A 5HHXL 3GM8A 2ERJB 4M00A 5E1QA 4JHWL 4G42B 4LEEA 3K3QA 2I5YL 4NFBA 4J39A 3T2PA 1CI5A 1MRFL 5D1QC 2CRIA 2E5EA 1HHGA 3K2MC 5LB1A 2NY0C 4UQ2A 4HZLB 3VYPA 1HHKA 4YR6A 4AUYA 4L29A 3KAAA 3MOAH 5I82A 1RMFL 2BP0B 4N28A 4ADJA 2NNXA 1L6XA 3O6LH 5K39A 3K6DA 1FYTB 1UVQA 1WZMA 4NP4L 4Z7VF 2ZOWA 3DRQA 1PEWA 2A3TA 1GGUA 1OGAE 5SWSB 3HE6B 1NCCL 3LZPA 2KLSA 4F5CE 3VWJA 3O0LA 1DFBL 3EYFA 1U8IB 3GI8H 5JHLL 4ELDA 2DQHH 4MMZC 1YEEH 4KJQD 2QSTA 3EJTA 3CMOH 4ZQKA 4CJ0A 4LLUA 2XYCA 3I9AA 4ZZKA 1QLFB 3IB4A 3L3OC 3B6SB 4MQSB 4UNUA 2AP2A 4WFFE 5FC9A 1GIGL 4BH7B 5CEYB 1W0VA 4HXAL 4CU8A 1IGCH 3GB7B 2M8XA 4R3SB 3F62A 2AZUA 5DMIL 4G5AA 3L3HB 4YHZL 3VWJD 3ZVVA 3HFML 1CLVA 1LEKB 1U2CA 1J8HE 2DWEB 4ZYKB 4JM2F 2HKHL 5F9OH 3QO0A 3HVNA 1IQDB 5EU5A 3DBXA 4TNFA 2CZNA 3B2MA 4D3CH 4LSPL 2COVD 2WW8A 1Z5LB 2YMOA 1S7XA 1RIHL 5C0IB 3S37H 1MH5A 3OX8B 3QQNA 5AAWC 3ZZQA 1FL5A 3Q6GL 4GI8A 2OKMA 2DQTL 2VKXA 4JFDD 3I3DA 4BYHA 3D39B 1NM4A 4TQPA 1CGSH 4WI2A 1RLWA 5AOKA 1ZDSA 2YQBA 3H3BC 2DY2A 4XNMB 3NK3A 5EPMB 3SOTA 5CU9A 5FA3B 1RJYB 1B4LA 3V4LA 2EVHA 1HILA 5JQIB 5F0MB 5GRUH 5KVEL 2JI1A 1HIML 3P0YL 1D5ZB 2OV0A 2QKIB 2VTFA 4J12A 2DDQL 5B38G 5CJ5A 3BP7A 5F7FA 3C9NB 2WXPA 1UD8A 3HUJF 2VXQH 1P1ZB 4FD0A 1I31A 1IKOP 4LDOB 4U1MB 4XNUL 1KGYE 1R46A 4KKZA 3K1DA 2OW6A 2K3HA 4FE9A 2FL5B 4NKIH 3ASNB 2EIZA 5KVEE 1INDL 2UXVA 4WRLA 2WP3O 1J0YA 1NEPA 4UIMA 3DX3A 4UQAA 1N8OE 4YBLC 3ZDYB 1A6AA 2DLFH 4IRZA 1CT8A 1R24A 3SDDC 1U8PA 4G9FB 4LBEB 1VDGA 4JRXA 5EF2A 1OAUH 4XP9L 1S5IH 3UC2A 2JH2A 4BFIB 3ZE2F 2ZE0A 5IMOA 1KACB 4WWKA 1MFDL 1FV1A 1E3ZA 2DICA 2ZXWB 3L7EA 4M62H 4QRUB 2YN5A 3RX5A 3GMMB 1V7MH 2YZ1A 3LXCA 2HFGH 4LSSH 4RWHA 1RZ7H 4LDLB 1ZGLB 1X7TA 1IBDA 3NRFA 4N8VG 1PMYA 2ENJA 2ZUWA 2BP8B 1I3RA 5JR1H 1AZBA 1PW3A 4OT1L 1Q9OA 1ORSB 2F8IA 4OZFG 3RWJB 4WNJA 1CFQB 2QPDB 3F7VB 1RL1A 2IJ0C 3QS3A 4RZCA 4WWKD 1K8DA 4HETA 3F8UB 4G6AD 2G5UA 4XRCB 1SJXA 4PG2C 4ZD3H 4M1CC 3U4AA 4FEIA 2FGWL 2V7NA 3LS4L 2WC7A 4HALA 4ZFOL 1QHQA 4FQJH 5JORA 5CAYB 1NGXA 5KYWB 1QBBA 1XR8A 3QZWA 3WGUB 1D9KD 1T4KA 5FUZH 5FM5M 2Y7NA 4OSUH 3VFUB 2QVIA 3MV7D 2AJXL 3BN9D 3I2CL 3O2VH 5L9DL 2XZCL 4HPYH 3GSVB 5C8JA 5ISZE 3SODB 1NFDF 2ZCLL 2ADJA 3EO1A 3KPQB 3MCG1 4QXUL 4JRFA 1XH3A 3IETB 3QDJB 3CLFH 1BAFL 15C8H 1CYWA 3KPPA 1SDDA 1GS6X 3OHXB 1U8LB 1OARL 1QBAA 1CD9B 1OE1A 5ISZB 2XNAB 3LIZL 2XWCA 3O11B 4MDJA 1INQB 2XWDA 4ZFOB 4YHMH 4AW4A 4PJ8B 4N8CH 5D2NB 2I24N 4C56A 3KPRA 1EHLH 3AS3A 3HG5A 3VFWA 3FAWA 4O2FB 1RERA 3OM3B 1C5BH 4PJHF 7FABH 4YDIH 4ZTEA 3GTVA 1NMBH 1FVCB 2R27A 1AI1H 3BDYH 3AREC 3P9LA 4N0FA 3HG1D 3V6OE 1T1XA 2VJ0A 2L7EA 3QISA 2R56L 5LAPA 1DBMH 4XN7A 2ZX8A 5DSCB 2UXTA 5J89A 1GTFA 1NEZG 5DQJB 4LU5L 4C56D 3DURB 4J4PA 3RHWF 1NSNH 3QG6B 5AUMA 5L7XL 4NYLA 3A4EA 1N6QL 5D93B 5FEBA 5C0RL 5E23A 1JZHA 4B95C 1TNMA 1WK0A 3G6DH 1C08A 1J9RA 3O45B 1WS7A 3U7AA 2V8MA 2IF7A 3VI4F 5DJ8A 4GRLB 4N87A 1TQVA 4HLEA 5BW7C 2X6VA 3VFRB 4KGJA 4G42A 3U9UB 1OV8A 4PW9A 2QVKA 2KLRA 5DJDB 2V5SA 4G7QB 4ABUA 1B6DA 3ZKMD 1TVHB 1HXKA 2VW4A 1EXGA 2Z91B 4KTDH 2D8KA 2FWSA 1MCCA 3QIBB 4DUWA 1HQ4B 2DTML 4FF9A 2C3WA 1A7QH 2CCWA 1KXVA 3GJFK 5DJAA 4RBPH 1QUPA 3W57A 3M6DA 2P9RA 4QRPE 1BFVH 3JZYA 3C09C 5FYLD 4EPSA 5I8EB 4QTHB 4E42A 3FAXA 3FKUS 1LO3L 2EIMB 3RNKA 3QHFH 1YEDB 4Z7OE 4HK0A 4KQ4H 1ICTA 3RA7L 4OD3L 4HJTA 3DUSA 3AY4C 4P4KB 4G6JL 4OGXH 4TSBH 1WV7T 5KBNC 3H9HB 2JSFA 3INUH 5LCVH 5JW3L 1SN5A 4ENEC 5DO2D 1AACA 4UDTB 2OAAA 3LZNA 5IBTH 3BPNB 3RVUC 1V3JA 1MFBH 4JZNA 4I0PB