2LHAA

Solution structure of c2b with ip6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
151
structure length
151
Chain Sequence
b'EKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptotagmin-1
publication title Molecular Level Interaction of Inositol Hexaphosphate with the C2B Domain of Human Synaptotagmin I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2lhaA00
2LHAA 3ML9A 3TJPA 3L13A 3FDWA 3SD5A 1W16A 3DBSA 4TUUA 2Z0UA 4FJYA 4DNLA 2K8MA 4ANXA 4GB9A 2DMHA 3QAQA 4XE0A 5G2NA 2WXHA 3KWUA 3TWYA 3KWTA 4F92B 2A4ZA 2NSQA 3DPDA 1TJMA 4BGDA 4FULA 4L1BA 1CJYA 4NS0A 5JHBA 2K4AA 3PFQA 2FJUB 5G55A 4EZLA 4FHKA 3QR1A 5H4ZA 4FHJA 3IBEA 4LCVA 2CHXA 2WXPA 4L2YA 5CCJA 2CM5A 3CSTA 2WXMA 4TS6A 3N5AA 3PS6A 2WXKA 4QJ3B 3B7YA 3OAWA 3PRZA 3L16A 2R83A 4Y1TA 4F93B 1GMIA 4PS3A 3W57A 3L17A 4HVBA 2RD0A 4LT7A 3NZSA 4BFRA 5JHAA 4WEEA 1BYNA 3MJWA 1E8YA 3ZIMA 4F1SA 3OHMB 3M7FB 3T8MA 2CHZA 1E8WA 1RLWA 1E8XA 4OVVA 3HHMA 3F01A 4PS7A 1WFMA 4A55A 1BDYA 2FK9A 2ZKMX 3ML8A 2D8KA 2UZPA 2A5UA 3QJZA 4FLHA 3W56A 4Y1SA 1RSYA 3JZYA 4V11A 2Y3AA 2CM6A 4GNKB 1QATA 3QK0A 1UGKA 2DMGA 4NP9A 4IQHA 4EZJA 3RPBA 4WWPA 3FBKA 2NCEA 4ANUA 2BWQA 4G11A 4F91B 5T8IA 3PREA 5EDSA 1E7VA 2NQ3A 3APCA 4NPJA 3LJ3A 4KITB 4AJWA 3F05A 3NSJA 1YRKA 4KZ0A 4TV3A 3ZVVA 4EZKA 4XZ4A 4ANWA 2K3HA 1E90A 2YOAA 3RDJA 2ISDA 2WXNA 1DJGA 2WXGA 2Q3XA 2B3RA 1DJIA 2WXIA 3F00A 2QZ5A 4QJ4B 2JQZA 4DK5A 1QASA 3HIZA 2ENJA 4WAFA 3IM1A 1HE8A 4FADA 4URKA 4J6IA 1RH8A 3L08A 4IHBA 2WXQA 5CCGE 4QJ5B 1BCIA 3GPEA 4ICXA 4ICWA 3ENEA 1K5WA 3TL5A 1DJWA 4XX5A 3PYCA 4KZCA 4NPKA 2CHWA 3S2AA 4WWOA 4HLEA 2X38A 1A25A 1DJYA 4OVUA 3APFA 4WWNA 1DJZA 2WXJA 4L1LA 2QZQA 2Q0ZX 2K45A 2WXFA 2WXOA 1V27A 1UOWA 4QAMB 3R7RA 3L54A 3ZW3A 1E8ZA 3CSFA 4L23A 3APDA 1DJHA 4JPSA 1TJXA 2EP6A 1DJXA 1W15A 4AOFA 2CJSA 2N1TE 2CHDA 3QARA 4LDCA 2WXRA 4MJJA 5KJ7E 2V4LA 2ENPA 2YRBA 1DSYA 1UOVA 2ENQA 2KI6A 2WXLA 3NZUA 4FJZA 4FA6A 1DQVA 5H4YA 4ANVA 1WFJA 3F04A 3QR0A 3R7QA 3P2BA 5CCHE 4PS8A 1E7UA 3L9BA 3L4CA 2CJTA 3HN8A
chains in the Genus database with same CATH superfamily
1WO2A 2EIEA 4HAFA 3GSWA 4KQ3H 1QHPA 4DNLA 1UVQA 3OR6A 4OLVH 4U1NA 1LEIB 3CN1A 4Y2DB 5F3BB 3S0PA 3LY6A 4OCYH 5FYKH 4GKZB 4NO5A 4WY7L 4YO0B 3QO0B 3QUYD 3KW8A 2BS8A 1I3RB 2BNRA 4ZXBB 3SE8L 1A9EA 2CLZA 2ZSWB 5AVWB 2Y2TA 1Z32X 4LCIL 2JI2A 2WXPA 5K93A 2Z1KA 2XKNA 1CTNA 3MCKA 5EUOB 5ICYA 1N59B 2B1HL 1M1SA 1TQTA 1FVDA 4NWUL 1Z0NA 3DOHA 3FB7A 3DMMD 1HL5A 1E4KC 3WLBB 2ZOWA 3BIKB 3AS1A 3SE9H 3QQDA 5EU6A 3BO8A 2DYPA 3CVDA 4G8FB 2V7HB 5TE6L 4UAOC 3OXSB 3LOWA 4IU2A 3K0WA 3EFFA 3JZYA 4TKWA 3OPZH 5DZOA 1CDGA 3SYQA 4BFIB 3QQ3B 1QSFE 4ENED 2A6DB 2UYLA 1RUKH 4NQSA 4JMNA 4EAEA 2BZ7A 3IE4A 4KRPC 1YMMA 4JFOB 2AJ3B 2K3TA 2X3AA 2I24N 3MRDB 4NPYA 1VPOL 2H6PB 3U30C 5MEPA 7PAZA 4Q52A 2Z8RA 1I8LC 3MLTA 2BNQA 1U95B 1WTGT 4U6HB 3CE1A 2EXYD 5IHUL 1N4XH 2NY2B 4YJZL 2AV7B 2R2HA 1NL0L 2ENYA 4WNJA 3PL6C 1B90A 1HL9A 4JJHA 3DUUA 4BZ2L 1XF2B 3GUFA 4X8JB 4DO4A 1SEBB 2HTKD 4M6NH 4PV8B 5IT2L 3HC4L 5C0AE 7PCYA 4ZOEA 4FNLH 1T2JA 1F6LL 1KY7A 1V7ML 2LW3A 2A1WH 2WCPA 4WEBH 4XN8A 4YPGB 4CMMB 3QJVB 4FLRA 3PL6D 4O00A 4LCWB 1LO5B 5DYOA 2G5RA 1OGSA 1AD9A 1U36A 3GPEA 3QJSB 5A7EA 3QDMB 1R3IH 5BRZE 5E5LA 2KKQA 4Q6YA 4E68A 1P7HL 4RNRA 4APXA 4IHOA 3BUTA 4WI5A 3ZKMC 2MPVA 3QIWA 2WJ7A 2MQ0A 3QCTH 1T22A 4CC4A 1NUFA 3VAEA 4GSRA 3NIFE 5EO9B 3LSOA 4JE0A 4ZOAA 3UBXB 3ZDZB 2BSBA 4Y4KB 4X9YA 4B95C 1UM4H 4MJIE 3U7WH 1IAKA 4PRAA 4C56B 2VDQL 3O11B 2CDFA 2V3DA 4ODWA 1A65A 2FX7H 2W5PA 1J87A 2QQKL 1F1AA 2Z92A 2WSPA 5JPNC 3QYMA 1IFHL 2RFXA 1UWFA 1ZSDA 2XWJA 3TWYA 2WXHA 4F1ZA 5KBDA 4A7VA 1K85A 4MB5A 1HQ4B 1YY9D 1T3FA 4ZUWB 5CWSB 1AXTH 2V2TB 4P23C 1KJVB 5A40E 4YGVB 4OQTA 1NOLA 1DBJH 2EYTA 3QFGA 2V8MA 4WDIA 2OMZB 3OAWA 3U83A 4IKIA 3VXSA 1WGOA 2A6JA 4XNZB 1FZMB 4BM7A 5C9JA 4L29B 3IJSA 2K4WA 3MRCA 1LEGA 1MRDH 2I27N 2YUZA 4LU5L 5TDOA 3WKYA 1IJ9A 4AYMC 3TH2T 4QMEA 4JM2C 3C6LC 5TF1H 5GSVA 4ZMVA 5DHVA 5GGVL 4UTAH 3T6VA 5GS0C 1NBQA 1D6VH 3I9GL 1HI6B 2C9PA 1IBYA 2KPNA 3B8YA 1BJ1J 1QNZH 1J9RA 4OJEH 5B38A 4EN3A 3MRLA 4DEPB 2FHBA 1IQDB 3LZNA 1MWAL 3EYOB 3CXDL 3CQPA 3C6LD 4GQPH 3DIVA 3MA9H 1XD1A 4NRYB 5DQ9B 5AAWA 4H0IA 3C08H 3T2LA 2UV3A 3SY0B 5LO7A 4OZFH 3SKNB 3RWGA 3UO8B 3VDBA 3KLSA 5F1NB 2VMEA 1PZBA 3O3UN 2R51A 1RVFL 3NIDF 4L8BA 3FFCD 3EYFA 1MSPA 3X14B 2WZAA 4MDIA 4DPAX 1DSWA 5IEHA 5FS5A 3RWDB 3VFTB 4Z3IA 3WE6B 4DP9X 1ADQL 2DWDB 1F4AA 1U8OB 4WVRA 3G3LA 4MAUL 3VXMB 3LAFA 3ZTCC 4AXWB 3QFJB 4JPIB 5GGRY 4GRWB 1PLGL 1T5WB 3MLRH 2NY0C 3GMLB 3WHE1 5K33A 4G6JH 1ANUA 1XGYH 1D9KA 3VGHA 1BQHA 5E2UH 3DX2A 1IGFL 2RQEA 1BFOA 1M1XB 2CBMA 3OZLA 3RBGA 1MCOH 1MFAL 5JMOC 3QUXB 2AXGA 3V52H 4DO6A 4GG8A 4H88H 4FFYH 1OY3B 2VM9A 2CG9X 3VGGA 2WCGA 2CJSA 3M8OH 1EBPA 1W9XA 4X6DB 3FSZA 5I5JA 3V5KA 2WZ6A 4PWGA 2YWYA 1ZWIA 1YHPA 5KSVB 4UTBL 3ECBA 4DEWA 2EH8H 2BY2A 4E41D 2GEEA 1I3UA 4CMHB 4P2OC 2HT4C 3E38A 2UZXA 1AO7A 4WUUB 1CL7L 2P5WB 5K9QI 1M56B 4J27A 1WH0A 4L4JA 5FPIA 1UXWB 3O2DL 4R83A 2VM4A 5BVJA 4OIIL 2YD5A 2EUXA 2W59A 4IGBA 1NCNA 4ONFH 1HINL 2NY5C 4HEMA 3RGVC 2FBRA 5KTEH 3BKJH 4H8HA 4U1MA 4ODUB 4DWHA 4FI8A 2WLYA 2EIJB 1FGNL 2FGWH 2CU9A 4D0BB 1RZJL 2ARJQ 4JG9A 5GJSH 2HKHH 4JM2F 3DV6B 3NJGA 5FA3B 4ADGA 4ELMF 1XF3B 4TNGA 2VN5A 2OZ4H 4HGKC 3NBNA 3RGVD 1LM8V 1JOIA 1X5XA 3H56A 2QHRH 1WS8A 4U7MA 5EF2A 4DETA 4O2FA 1NEUA 4XMWA 5HJ3B 4FKKA 1U2CA 4NHUA 5C0BB 5EOQH 1EEQA 3RWEB 3S9DB 2AERT 1A7PH 1KELL 4MQXC 2X6AA 3BT0A 4PB0L 3DX8A 1CLYL 3MBED 3NJXA 4G8IB 4P57A 2YAMA 3ORJA 4LLUB 3ZO9A 2HT2C 5GS1A 5DJ6B 2X4QB 5C1MB 1PCXA 1UGKA 5D6CB 5IB5A 5I73B 2YN3A 2XWZA 3IMBA 2P7TB 1T6VN 4J12A 4NT6A 5D1XE 3ZL4H 1FGVL 2MNJB 5BW7A 4LVHB 4U0RC 3OKKB 2MCG1 2F74A 3VG9C 3QHZL 3WKNA 4XXCA 1AKJB 2FJFB 3RTQD 4NBYB 2ARJB 3FTSA 4ONGH 4AK1A 4J6RH 5F0MB 2HT2D 5SWQB 4NLHA 4TN9A 4CDHA 4PJ9C 1IO4C 2X4RB 2PCFA 5KJ4A 2Z65C 5CJXA 2R27A 3GJEB 4LDEB 2QZ5A 3U0TA 2JQZA 3WAKA 4AMKL 3S48A 2XOTA 2Y7OA 4X0KA 1KJ2A 1IC7L 3O0RH 2AXHA 3UZVA 1WHOA 3IMRA 1AXSA 5DS1A 5DRZA 2SEBA 4KKQA 4WV1A 4ZD3L 4OFIA 3ARDD 4CN1A 4UQ9A 3PNWA 4FAAB 3EJCA 4XCCL 3EGSA 1KTCA 3H7BB 5T1DL 3VDAA 3G04A 2Q6WA 3JWDC 4HLZG 5BZZA 4FCAA 1JJUA 3LZPA 4HV8B 5E8EA 4HIEB 3R7RA 1OGTB 5AW1B 1NPJA 3SDYH 2QPFA 4XWOC 2OMVA 2QTVA 1IGCH 3GI9H 2RTTA 4DP2X 2DQJL 4OFPA 3TA3C 4RZCB 5JOPE 3WTTA 5JLZA 3S8FB 2LABA 3NJFA 1JPSH 3FULA 1UZ8A 3IFPA 2DLFH 3LS4L 1XCWA 2QVFB 3T0BA 2EECA 2PXYD 3P2BA 2HLAA 4JN1H 3WJLA 1E7UA 4PJHB 1SM3H 3L3DA 3ML9A 3BEWB 1EWHA 3OLDA 3EBHA 2AEPH 3TA3D 4OKDA 4A67A 5IJVB 3IDXH 4N0UB 4N8VG 3GUTA 3EGDA 3W11C 5HBBA 5DGQA 1O7SA 2FEEI 5C7XL 1F4YH 4XCFL 1N6UA 2VMDA 3EFOB 3D0AA 4XGZA 2JJSC 4C47A 1AQMA 4N6QA 1AR1D 1M42A 2F58H 4LBEB 4Z8FL 5DMIH 2DI9A 3JV5A 32C2B 3QPXL 1HOCA 2QDWA 4RQQA 3FSWA 4Z7UB 4M5YL 1CGWA 1T03H 1A3LL 2Y07L 1T2XA 4L3AA 4PJBF 2HT3D 4HJGA 5A43C 5A2BA 3AM8C 4BD4A 3HFFA 2VDPL 3HB3D 3PAZA 1A14L 2IGTA 4J4PA 1L0PA 3PABA 3PHQB 4OZ4B 1NCHA 3QJZA 4GSUA 5AWNL 3D2TA 4AGLA 2A9ML 5FA4A 2XFXB 1WWBX 2W88A 4YMPA 1FRGH 4YXLL 3IN2A 4PY7A 1HHJB 1PZSA 1O9VA 1NMCC 5LGHL 3AWEA 5B22A 1NMBH 3CFJA 1PFCA 1JFQL 3BMWA 2ED9A 1NJ9B 4N2EA 4AGQA 1VKXA 2D31A 1K5NB 1CICA 1PSKH 3GSNA 1ZAGA 4KRNA 4LOFA 1CE1L 2NXYC 2C3VB 3ETBF 1LTXA 3LPFA 3WFDH 4LCYB 2AJVL 4YAQB 3RVWC 1GW6A 1JTPA 2V2XB 3SPGA 3QHTC 3ARYA 2GY5A 3RFRA 1JPFB 2ZTBA 4NEHB 9CGTA 5KYNA 3WFEL 4D8PA 1I7ZB 3APMA 2X2HA 1MCLA 3X13A 4JFFD 4D0DB 4NPKA 3VMNA 3ZX1A 2E27H 3MRHA 4HKXA 4L3CA 3BCDA 4OJAA 3RVWD 1CXIA 4HS6B 3GJFK 4JHWL 3OV6A 3QRLA 1QBAA 5MEQB 3AG2B 3FO2A 1T0MA 1PLCA 2YARA 1D7CA 1TUPA 2ATPB 1NAMH 3OF6A 1Y0LA 5EBMB 1JGLH 4LSTL 3S5LB 4AW4A 3KMDA 5EFIA 3Q1EA 1SQMA 1I3VA 5HHXL 1CXFA 4GXUN 4KUCD 4HZ1A 5KN5B 3W9DB 2AVGA 1S3KL 3HN8A 3OKEA 1FDLL 3L7FA 3SDAB 2ZZUT 3TZVC 5C2UB 2Z31B 4G9FD 1T0NA 4F7PB 1F8TH 1KG0B 1P5VA 4WIQA 1D5ZB 2ALWA 3IDNB 4ZPVA 4C4KT 3HUJA 4M1GL 4ZUVA 4BFJA 1FC2D 4L37B 4J8RB 1XGTB 4ZDHA 1UT1A 1MIEH 1WBYA 2IDFA 1HAUA 2VL4A 5I1EH 1DLHA 4HUVB 5B7EA 2DKMA 3GIZH 3S34L 5IJDC 3ARFC 2H9GB 2AQSA 3GMNA 1MFBL 3H7LA 1OTUC 4XP6H 3ZR5A 2OSLA 4JFPB 5BCAA 4G8GA 1NSNL 2BVQA 5CUSL 2IOOA 4HWZB 4XMXA 3HKZA 3IXTB 3POHA 3X3FH 4NNXB 4CA4A 5E0QA 1AZUA 4OD3H 4LCUA 2ICWB 4M7JL 2Y9RT 5BV7B 3FN3A 4QOKB 5E1IA 4XN1A 4KGJA 5AOLA 2VUKA 2D3NA 4UI2A 3ARFD 1FVCB 1ZIBA 3BE1L 3OJDB 5I0DA 3JWOH 2FBJH 4X0NA 3PGCB 1EEUA 1S7TA 4W9JC 1KJMB 1OLZA 3TT3L 3UMNA 5FOBB 5GZNA 4GG6F 4LOVA 3HG2A 3V0HA 3O6LL 3O8XC 1TENA 3BH8A 3FBKA 2NMSA 1EIBA 3FCBA 5IKCB 4WU7A 5TK4A 4WF7A 3QSKB 1KSRA 1YECH 2BFGA 3D9AH 1HSBB 5T1LA 1OAKH 4JCMA 1F18A 5TDNA 4UNUA 2KLSA 1MHEB 3J07A 3DRTA 1AQKL 3MRKB 4JY4B 3O8XD 3EAKA 2A83A 2JCCE 3LNEA 1S7QB 3EIFA 3P9WB 4NO0A 4AKPA 2YKLL 4QRRB 4DCQB 4LDOB 4RESB 5HGHA 5HPMB 5LWYH 3BQVA 5D9SA 2CO7A 5L2KE 1JNNL 1IT9L 3R19A 1W72H 4OM1H 3GPSA 4NENB 4DFIA 2ZP0T 3C60A 1GSMA 4PJGA 1IBGL 3VH8B 3NH7H 3SYPA 2WLJA 4K73A 3NIDB 3LXUX 2HAZA 3GYRA 4Z7WF 3QNXA 4M3JA 5CZVL 4WLCA 4AENB 4OJYA 5C71A 4NQTA 1S7UB 5HGAB 5DQDL 4MJ5B 4XO8A 2I7OA 3VSTA 3IFNL 3UYOD 4RBPH 3GO1L 5SX5K 3ZRFC 1FNGA 1SJHA 2NUPB 3ARGA 2Q8AH 3K6SB 1CCZA 4UQ2A 4ZTPL 3NABH 5D2NC 5ECGA 3HR6A 4FKHA 1MFDH 1UA6H 5FYKE 2P42B 4KUZL 1M7DB 3DURA 1JL8A 2ITDA 1A02N 5KS9B 4HJ0C 3QJOA 3EDJA 2HA1A 3PIQB 3GJFA 4PV1C 2YMOA 3MNDA 1T66C 2AK1H 2E7LA 3SGDI 4U33A 3TP4A 1N6QL 2NTFA 1T7YA 1ZTXH 2HX9A 4K71B 1W80A 1SMOA 4UU9A 4GT0A 3ZKNC 3DYPA 4MD5A 4NLAA 3SQOH 4LRIA 4TVPH 3TFBA 5SX4I 2Q7YA 5ERWB 3BLPX 2PCYA 2DQHL 4FABH 1UEMA 3FO9B 2R56L 5DS2A 1L4IA 1JF1A 3IGUA 1U3JA 4JFWA 2KDGA 1OXYA 2YD7A 4WI7A 4XPBL 4KK9D 5D6DC 3RVTC 3WD5L 3UAJD 3ZKND 2DI8A 1OM3H 4YDMA 5FO7A 1XCQA 3Q43A 5AYTA 4X5PA 3V4PH 1F6FB 3DMMA 4N2GA 2DH3A 3INOA 4M8UA 2ZX8A 4RGNC 4OVVA 3HHMA 2WW8A 3MJGX 1WFMA 3SB3A 2AK4E 2VDKH 4X4YB 3TYFA 3CX5K 3GSOB 3RVTD 1MCWM 1Y07A 1YPZF 5AL8A 1JUFA 4MZ2A 4F7TB 1NWOA 3QUGA 2QKIA 4XO4A 4BSVB 3H55A 1HSAB 3CX2A 1BD2E 3MNWA 2XG4B 5F7KC 5DMKB 5C2BH 4RDBA 1CUOA 5ID1B 3F2LA 3OMNB 1L3WA 1LQSR 1QSFD 1BSIA 2J71A 4ERSH 4IRJB 4DK6A 5I28A 5EZOH 2VKWA 2WUBL 5DRXA 4PJAB 4Z7OF 4I0PC 1W6WA 1E90A 1LMKA 3UG5A 3HBZA 2QV2A 3HPLA 4KK8D 4LSRL 1Z5LA 5J13C 1ZTMA 3QNFA 4CVXB 2XSKA 5CEYB 2Y24A 1NBVH 1E27A 2L8AA 3K0YA 1JYVA 3FQNB 3L95A 3R4DA 4JVUA 5E6ZA 5KYWA 2FSDA 5DC9B 2NY1B 4AEHH 3HN5A 4BQ8A 2Y36L 3BQUD 3GSUA 1IILE 1X5AA 1ZA3A 1XB8A 5C0AD 3FCUB 3QAZC 1SOXA 5K59E 4AC4A 4WTZG 4ZTEA 3D4YA 3QEUB 4OM0H 3VQMA 2F08A 4U6XB 3ZKSD 3D34A 1CTOA 2AQRA 4J8QA 3L7EB 1N3NB 1I7TA 2I69A 3X11A 5IMKB 4GAJH 4RZKA 1U4FA 4GI9A 1QUPA 2OL3B 3EYQC 4RCAA 4JHVA 5D7KE 2BINA 2JE8A 2WVUA 5IBLD 2V5MA 5JPMA 4M4PA 3KH3A 1NBZB 2QSTA 4G6KH 1OAZL 1QMUA 4NAJA 4Y5YA 1ZANH 2DD8L 4PJEF 3ULAB 2IOIA 4DGVH 3I6GA 3K72A 3HLAB 3MLYH 4KGLA 3Q01A 2C9UA 4PI0A 1VADB 5E56A 1H8NA 4MJID 5ABZA 3D3VB 1CDUA 2PN5A 5DD5L 1JPTL 4JZJC 4QGTA 1Q0YH 4AE1A 1FN4A 4XXDB 3ZE1B 3OZ9L 3RTLA 5I8KH 3QPQD 2R0KL 3UJTH 5FECA 1CLVA 1OB1B 1BLNA 2P8MA 3F3HA 4OCMC 2R23B 4YL9A 1E0OB 3LN4A 1U30A 4HFUH 2GAZA 3CLFH 3FQUA 1OQOA 4P48A 4ELKB 3U2SA 3T4AB 4N8CH 3B7YA 3GTVA 4FTVB 4LASL 2Q20A 3A24A 1Z9PA 1XWVA 3F12B 3IDYC 3L4WA 2HLEB 2AFNA 5JHLA 4WCYH 3CAFA 4LLAA 2AJZB 3EGXB 5ELIA 4GSDH 5JOEA 1JNJA 2PETA 3DVNB 5I6XB 2J8UB 5HHME 2IAMC 1XH1A 2HYMA 5I1GH 4JY6A 4ODSL 3V6OA 1P5UC 2BIPA 4H8WH 2ITCB 4OAWB 3LKNB 3LB6C 3WFBH 1C08B 1TITA 2OL3L 3CZGA 4BCYA 2FYYB 4E9LA 1FH5L 3CD4A 2ZG3A 1THCA 2EEAA 3D69A 3SBQA 3TXAA 1GZPA 4Q9RL 3WKML 2H0JA 5IM7A 3ZSTA 1E4XL 3UBXG 2VE6B 3C5ZB 4RH4A 4X6EA 1R3KB 4K3GA 1DUZB 3U2IA 5I1IH 5T1KD 1PKQB 4HC1L 5FCSH 1MHCB 3L1OH 4LLYB 3NAAH 4RAUA 4BELD 4P59H 3A6CH 4L1HA 1AJ7L 3P9MB 4WAFA 5B8CC 5DSCA 2BVOB 5DFWH 2DQUL 2Y1AA 3ULUL 5MERA 5ICZA 1R33A 4JQXA 1JNHA 5CFHA 2HUHA 5TQ2L 2XNAA 4E5XB 5I17A 3FCGA 3SYCA 2HMIC 1HTYA 3B2VL 5KEZA 3S37X 4EN3C 1X4XA 4FYQA 2AMUA 1TNMA 4G3YL 4PP1C 3VD7A 3MBWA 5F9WB 4R3SB 5JDSB 2APXA 3NQIA 3NDZE 6FABL 1KIUB 2NNRA 4WGWB 5HYSA 1MHPL 1DJHA 1QHOA 1TZAA 1AGDB 1NGQL 4XNQB 1UB6A 4NQUA 2HMID 3C8DA 2O5XL 3RX8A 4MNQE 2E3VA 4PP1D 3GBDA 3HI5H 4PW9A 4L9DA 1QSEB 5E8OB 4NDMB 2FJGA 2VXSL 3KDMA 2ZJSL 1UWYA 3AS3A 1PY4A 2P5EA 4WW2A 3L9BA 2PTTA 4E41A 3D39E 1KV3A 3S88H 3DGGB 5JTWA 2YPLE 1M7UA 1I9EA 1MOEA 2WWNA 5LXGH 4L8SB 4K94C 3UJIL 1AGFA 4MA7H 1J1PL 3BUQA 1DVTA 2GIYA 2ZAHA 5GQBA 4MAYC 1S8DA 3L1FA 2IXQA 1QUNA 3QZLA 1J8RA 4NERA 1KEML 3CIQA 4P9ML 1UD6A 3ZTNL 4WWKD 1ILSA 2VW7A 3RILA 4OZHB 4MMXB 1MJ8L 5DHMC 1EJOL 1CG9B 1OAYL 4V33A 2J6EA 4EI5C 4NM4H 5JXAL 1TJIL 4JREC 3R4RA 1XIWD 1O6SA 1TT6A 3ZGIA 3CPLA 5LBGA 4X99A 2E8ZA 4WW1A 4Z7VE 4BWWA 4K8RC 1F4XL 2O93L 4YSAA 1ZPUA 3JVGA 5DJ2B 1KCWA 5DJYA 5D7JB 2AW2A 4H20L 1SVZA 4PR5B 3UPCA 1K72A 2FAUA 3MV9B 5I82A 3OG6B 1J9TA 1AD0A 1NCGA 3MBEA 4PSRA 3MGAA 1L0XA 5I1AB 2P9RA 4WI3A 4UNVA 4R5TA 2YJLA 3ZHLA 2QBWA 2X6VA 4L3EA 2Y69B 2Y2YA 1JD7A 3BPLC 3BW9A 3Q6FB 3TV8A 1N9PA 4JDZB 4RETB 5DD0L 2PP7A 4FERA 2X6UA 4ONHB 5IOPA 3IDUA 4NN6C 3RZCD 3DI3B 3F05A 1RZGB 1F00I 1T4KB 3IDJA 4NHCL 2P3YA 3FT4A 5D1XD 3ARXA 2FBOJ 4P2CG 3RJOA 4IBUA 4KTDH 3F00A 3QWOA 4FMFA 2C1PA 3EH5B 1G6RA 1WK0A 1OK0A 2ADGB 2FUTA 1BPVA 1Z9NA 3Q44A 4U3CA 3VFMB 4EIGB 1EH9A 3OAUL 4YHZH 4KY1H 4FP8L 2BX5A 1SBSH 1X9LA 3DX3A 4R0LC 4O9HL 3UP6A 3ARDA 1DBKL 1DANT 4PGDB 1A25A 3GMPA 1QSVA 3VCLA 2ICWI 4JFZH 1UADC 3MCLL 4O5LL 4QAMB 5GISL 2Z35A 3E6FA 5D5MA 2JK5A 2EH7L 1JYWA 5T3ZL 4XXCC 1EMTL 1CFQB 2Y7MA 4GS7B 1LILA 3KGSA 4XB3A 2PO6C 1TTGA 1AKPA 5EBLB 3N1PC 4KXBA 3TH3T 4I0CC 1SEQH 1S7XA 2ZUUA 2A9AA 1FYTA 3ES6B 4HDIB 5DJAA 1A7RL 2AS5M 3HAEB 3VFGL 5JOPD 1OD9A 2CJTA 2PXYA 1PMYA 3T6ZA 4Z7WB 1I82A 1OSEA 3MRRA 3PP4H 1M71A 6PAZA 3MYZA 5F7MC 2DMHA 2YMXH 5D4IA 2ED6A 3WN6A 3C9NA 3HA0A 2C1OA 5F21B 4PVMA 2BSTA 1FFOB 1MLBB 1NCDH 4MXQD 4M93C 3BWAA 1GOGA 1QSZA 5T33H 4X5WA 3H1ZA 4P04A 4WI9A 4Y7OC 4XBGB 5F3HB 1KGUA 3HC2A 3S35X 2K8QA 2FQDA 1PU0A 4RISL 2YPVA 1EAOA 3RLSA 1GMIA 2NTSP 4R7XA 3BLBA 4P0DA 1PZUB 1N19A 1G5GA 2ZWNA 2R4SH 3G9VA 2WWMC 4UAHA 5DWUL 1MZZA 3NSFA 1VGEH 2X1WL 2JFCA 1CGTA 1MRFH 3QXAB 3S2CA 4I0KA 3RA7H 4JKPH 2DYSB 2DEYX 1MNUH 1R46A 1WD8A 1DN0A 2JB6B 4BSJA 1QPXA 3MNZA 3COOA 5I1JL 1R0AH 4MNGB 1OCZB 4DP5X 3LH2H 4PRPA 1S9WB 2Z8VC 1JZFA 1IGIL 1NANI 2NCEA 1PNCA 5DZVA 4JR9H 3HRPA 1MQKL 3KWVA 4NPJA 5F71A 4YDVA 4DAGH 4KITB 1T1ZB 3BKML 1DVFA 4HEPG 3ZK0A 5I66A 2CPUA 3DO7B 4LHUA 1B9KA 3MXVH 4BUHA 3BZEB 1E30A 2YD1A 2ISDA 4XBMA 5E6IC 3QJXA 2Y7LA 1MCNA 3CFKB 2VRQA 1EDQA 3OB0H 3V0AC 1F3JA 3CVIH 4ZSOE 5JHDB 3FCSA 4F8LA 1FFPA 5FUZH 2GJ6E 1YNKH 3TEZA 1SLVA 1HZHH 4UANA 2B0SL 3L3OB 3WJMA 4HCRA 4H13C 1G4RA 3E2HC 4JFFA 3S2AA 1OWWA 3UG4A 5E6ID 1XQ4A 3KCWA 4YDJB 5CBAB 3LV3A 1P0SE 4I2XE 4UT9A 1HNGA 3LD8B 4ZFOB 3KWWA 3TCXA 4Z3FA 2R4RH 2HFEA 4DHLA 3LKRA 1SFDA 4Y1AB 5GRVL 2J21A 2QKSA 3Q8FA 2ZNWA 3I6KA 2Q2EB 4Y88A 1J0ZA 4JNXA 3INUH 4Y7MA 3QUMH 4X98B 2Y6SC 1UOVA 1KMGA 3MRFA 4HKBA 3FTGB 5K9JH 1DQVA 1EEZA 4ALAL 1CDHA 2ICEA 2BSSB 2ICCA 4MXWH 4M7ZB 3FO0H 1Z9MA 3BZDA 1KC5H 4N3TA 1RK7A 1KDIA 2NXZD 3HG1B 3QQ4A 3GSQB 4MJ6B 2NY7H 1CD1B 4KHXL 1SOQA 4G5ZL 3WJJA 5GIRA 2IAAC 3MRIB 5MENB 4QDGA 1KF9B 1ETJA 5CN2A 3CFTA 1MW1A 4GMSL 5J5EA 2ESVA 4KO7A 4E9TA 4Y4HA 2D7TL 4CN4A 3HC3H 1IC0A 2R83A 1XEUA 2AXFB 2H0EA 1TTCA 3PJSA 4UZGA 4JDVB 3WO4B 4R8WL 1R17A 4JM4H 1BQKA 3GXUB 3WEOA 3B2UC 1UD8A 3QUZB 4YE4L 2OSXA 4GUOA 1LK3H 4YIQA 1E8WA 1RLWA 3BAYA 2G75A 1N7ML 4MKTA 4QHKI 3G5ZB 4QUOA 1DHKA 4J3UA 1AIFB 3ZYOA 3DJ9A 5GGVY 3S8GB 1Q8MA 1BEXA 2YXMA 3N06B 3TFKD 2IV9A 5LDUA 3AY4A 2CDGA 1FLTX 2JKIS 3BIAX 3MUJA 1HIMH 3NP3A 4M1CD 2BVYA 4YBLC 5E94A 4IIZA 4JRXE 1UVQB 3OR6B 1ET8A 2CJUL 1EJ8A 4N68A 2WKOF 2NDFA 1TYRA 5J12C 1BQLL 3ZXAC 3UPRA 4NO5B 1QTYT 3S5LG 1QHQA 3OC5A 4NP4L 3T0AA 5FFOA 2X3CA 2EZ0C 2BNRB 1EFQA 1LO0L 1EAQA 3UX9B 1X5HA 4X9GA 2EDMA 1A9EB 2CLZB 3DSFL 1BEYL 2EIBA 3H54A 4OF8A 2BC4B 2XKNB 3MRBA 1X5YA 3MCKB 2ZKHH 5ICYB 2H32A 1XL4A 2C3HA 3MLWH 3WDHA 5AZ2L 1FVDB 5EU5A 5ISZA 3FB7B 5IOKA 4JO2H 5MEOA 4I13B 1NM4A 3QQDB 5EU6B 2DYPB 1OOAA 1LNUA 2CR6A 5GZNC 1NCWH 3KHOA 1BAGA 2F68X 2Q2LA 2XWBA 1NICA 4IU2B 5L2KD 3EFFB 4FQ1L 4K4KA 3FKUS 1YQVH 1GPOL 4JN2A 5TE7L 1SOKA 2UYLB 1T5XA 4NQSB 3KEHA 5FW7A 4OCRH 4ZS7L 3BPCA 4JQVC 5G5DA 3RB5A 1ZK5A 4OTXL 1UWEL 1YMMB 2YBGA 4KAQH 4NNYB 5LUMA 4NPYB 2CD0A 5DD3L 5MEPB 1KIQA 3EG9B 3MLTB 3KPLA 4FQCH 1IUZA 2BNQB 1EPFA 3NT0A 4YDLB 2DL2A 4HUNB 5HVHB 2R2HB 3QNYA 3RGHA 2VXVL 4ES8A 1ZTXE 3PAVA 1ZMYA 4ZS6D 5I6KA 4H8VA 3DUUB 5IY5B 5HI3C 1U8HA 2DQCL 3RE0A 4X8GA 4HXBL 4TVPE 5FOJA 1E28B 4IBSA 3UTTE 3A3YB 1BIIA 1NGXA 4K7PL 4NAMA 5FYKD 1B3JA 2ADIA 1LP9E 2ZPKL 3CVHL 1EUUA 4XH2A 5DYOB 1CJYA 1BW8A 2FECI 4N1CA 5HI3D 1FORH 2V17L 2BZCA 5H35B 3ZQXA 4TSAH 3UZQA 3JWNH 4LSQH 1AE6H 1ET5A 1U91A 4APXB 2QSCH 4IHOB 4L05A 4X7EC 3SDCD 4UUJA 4JQIH 3QIWB 5CLTA 1AHWC 2IO5A 1T22B 3CPUA 3HR5B 4PJDB 4OI8A 2FT6A 3UAJA 2MOVA 5KG9A 4QTHA 1HHKA 3H4FA 3LSOB 1PBYA 4KTEL 2XACC 3HUJF 3E1F1 2D4DA 5F7FA 1NEZA 5FO2A 3N3EA 5EC2A 1AAJA 4OT1H 7CGTA 5IQ7L 1B2WL 5E99H 5BOZG 1IAKB 1T1WA 4F9PC 1S9XA 3GLAA 1OSPH 3LH8A 5EN3A 4PRAB 5M95B 3O6ML 4ODWB 1D2OA 2CDFB 3HI6L 1LGVA 2NW2A 4KC3B 1DEEB 3VU2A 1YC8A 2Z92B 3HMXL 2AK4D 3PDGA 4N22A 5IESH 4FQQA 4HAKA 4HWBL 3SSGA 2RFXB 1NCUA 4PVLA 4HG4J 1ZSDB 2VXTH 2XWJB 2CMRH 2I26N 3EHBC 3SZKC 4BE6A 1ZGLM 3BFWA 3ARBA 4I1NB 1LO3L 1QSFA 3QNZA 3WKQA 1WA2X 4Q14A 5KVEL 5J1SC 2JQAA 1BD2D 1RPKA 4JKLA 2GK2A 1JXJA 4KROD 2IPUK 4ABVA 4DKAA 4ZFGL 1YC7A 2EYTB 4MVBD 5LQBL 2NR6A 1WYJA 3HE6B 4FZ8L 3EDFA 4F7CB 1AGCB 1B0RB 2DOCA 3EHBD 3VXSB 1HEHC 2A6JB 3Q6GH 1Z9SA 5TPWL 3VE0A 3BPOB 2VLJE 5C9JB 3FTYA 3QG7L 3EJZD 3IJSB 4I77L 4CKQA 3MRCB 1LEGB 5TDOB 3IMVA 1FE8H 4ZW5A 1KTKE 1D5BA 4RFNB 4XVJH 2HJLA 4UV7H 1Q9KB 3BQUA 5C0AA 4OGYL 3CC5A 5GSVB 5DHVB 1TJHL 3K6FA 3TVMB 5FF6A 1LO2H 1MLCA 5B38B 2BWDA 1RZPA 5I0YA 3QWQB 4HLJA 4CSTA 4Y5VC 4K3JL 5ALCH 3T2NH 3RJDA 5I18L 1WFOA 4U2YA 2ED8A 2H1PL 3IS0X 2HKFH 1WA1X 5I9QC 2XZAL 2UWEA 3RWGB 4Z7QB 2W38A 5D7KD 5HVWA 1QFWI 2JJTC 2YK1H 4I1PA 1EVTC 4L8BB 4YHYB 3EYFB 4AVJA 2FSEA 4K23L 2RQ8A 4Z78A 4MDIB 2AAAA 1C12A 4MJIA 4N9OB 5HGBA 5IEHB 4PI2A 3D4ZA 4JKMA 4GINA 3QDAA 3NCJL 1OP9A 3GHBH 1Y18A 2N0MA 4JGNA 1M2OA 1PLBA 4LPCA 4EJ1C 1ZLUH 2FATH 1O9ZA 4S1SL 3TF4A 3IFLH 4KMTH 4L4TE 1D9KB 1BQHB 2I25N 2YOCA 3C2AH 1BFOB 4FXKB 4PS4H 3W57A 4KH2A 4LRNH 2YR3A 3LNGA 2AXGB 3O9WA 4GG8B 5EA0L 2HG5A 2DQFA 1M05B 2VZOA 3PWPA 1MCKA 4MZRA 3P73A 4LHJB 1DQLH 3CSBA 4O02H 3V5KB 3WTXA 5L8JB 5AYUL 2NLJA 2HFGH 4FYRA 2FWOA 3WHXA 1NFIA 1NFDF 5LHDA 2PTVA 1DQML 2UZXB 1AO7B 4IS6A 5AW4B 2UY7B 4P5TC 5ESVA 5HHMD 3UAFA 4OFYA 4LE8A 2OSYA 2XZQH 3I50H 4ZOCA 4Q7DA 3WFHB 5L2JA 1COBA 5BVJB 2YEZA 4IGBB 5E23A 2ZP8A 5D7SH 1YRKA 1WVZA 3ZPDA 5IHZB 4X83A 1KGIA 1QPPA 2QADD 4JO3H 1DO6A 4KY2A 1K6QH 4X4MA 4NN6B 4N2CA 4P5TD 3V9CA 2LT9A 3J8F7 1O7DC 3O81A 2L0DA 4N0RA 3GTNA 2H7WA 2H6UA 4QRBA 2EUVA 4PJCE 3RX5A 2G3XA 4BZ1A 3KM1A 1TEFA 1VDGA 4XRCA 3QEQB 3B8SA 3V6OC 4JFED 3FUJA 4O2FB 5DMGD 2Z34A 4EUPG 3PDOA 3IXAA 4IBVA 3SHSA 4YXHH 3MV8E 3DX8B 1PZAA 1JDAA 4KI5E 4XAKE 3P0VL 3H6JA 5GS1B 5AOIA 5IB5B 1TMCB 2FCBA 1DSFH 4BK5A 1ZHNA 3OB0K 1ZEAH 4NT6B 4WNQA 3KLHC 3U4AA 3DBXA 4K3HA 2OA9A 2J5LC 2QQLL 3C8HA 1DSYA 1KYOJ 2F74B 3CXHK 1YJDH 4MJ2A 2XWTA 5F8QC 4J3VA 3R7QA 4XNMA 4P3CH 1OLLA 2VXUL 3GLEA 3E3QC 1IKOP 2E4TA 2PCFB 4KKRA 4ECNA 2WWKT 4MNQD 3RY4A 3N85L 4XMPH 3VX1A 2YS4A 1AG0A 1FLRL 2MH4A 3HS8A 3U0TB 4PU2A 4X0KB 2WLKA 4NO3A 5JW4Q 2MSPA 1KJ2B 3D39D 2V5YA 2XZCL 4N0CD 4PY8I 1SFHA 2EDFA 2OMUA 3MACH 1EHAA 3KPNA 3UZVB 5JHBA 1G94A 1AXSB 2ZKWA 5DRZB 3T9WA 4PRBA 2XBDA 4WV1B 3PNWB 1HC1A 3EJTA 1KEGL 4UDUA 3EGSB 3G04B 2Q6WB 1URLA 4QXUL 4M93B 1GKEA 4U4IA 4WWKA 3VGAC 3QS2A 5E8EB 2CA4A 2WBJD 4CRPA 2V9RA 3ZY7A 3L17A 1WA0X 2ZD0A 2OMVB 1UJ3C 4FQLL 2IANE 1DTUA 1AY1L 3CFCL 2R15A 1A7OL 4HIJA 1RUQL 5FO9A 1XIWA 3VD1A 3QYCA 2M83A 1BBJA 2JJVA 5D1ZC 1KJ3H 5JLZB 4E5XG 3IRZA 1UZ8B 5T3XH 1BXVA 1KCUH 1KFAH 4OY9A 3P11H 3PQYE 2ZUQC 1PZDA 2YA0A 2HLAB 4B9YA 1UCBH 2D7QA 3L3DB 3CLEH 2UZIL 3TO2A 4UYQA 1RAMA 4IRSC 2MKLC 5D1ZD 3GUTB 1AANA 4FG4A 2VDLH 4PV9A 5GRUL 4Z6AT 4AJVA 5BO0D 3RZCA 2BS71 4XGZB 3ZE2B 4W6WB 5JIKA 3K6DA 2GC4C 2DQTL 5D1XA 3MCG1 4WWID 1RJLA 3MO1A 4IRSD 2P80A 2DLGA 1HOCB 3U4EA 4AYFA 4RQQB 4GUPB 3LRMA 4YQXH 4CU8A 3SE6A 3W2DH 1ZXKA 2CK0L 4HJGB 1ZJBA 4N26A 1P6AB 4DVRL 2CSPA 3VACA 5IHUH 4XHQA 3SDXE 3RAJH 3LQMA 4HHAB 4YDZA 2W60A 3VM7A 3PABB 4H5SB 1IM3D 3BC9A 4MDJA 5FA4B 3FUKA 4NQEE 4ZRGA 3PLYA 4PY7B 4YSEA 3FU9A 4J7RA 3QI9A 4QHLA 5FM5O 1Q9LA 4R4NC 4JHAL 1GJWA 1DLFH 1S5IL 1G9MH 3CFJB 2YQGA 4G7YL 4ADJA 5BXFA 5AVYB 1TQBB 1VKXB 3ZDYB 1CICB 3NIGF 3GSNB 2D73A 2E6JA 1EV2E 2W0KA 3OWRA 4B53A 1BF5A 4QRFA 2GHZA 4QRSA 3IJ7A 4ZX5A 4XXWC 2VDRB 1EGJH 1A5FL 2EXTA 1RUAH 3CHRA 5D72H 3L3JA 3IGFA 1OSYA 4GB9A 1GW0A 1C1EL 43CAA 1HKLL 1RIHL 2R29L 1PY0A 3CH1A 5IVOA 1CT8B 4XOBA 4UT6H 2JKWA 2Y5QA 2WYHA 1TEYA 4D8PB 3AMLA 3T5WA 2G4GA 4N2DA 4A39A 1KLFA 1X5IA 2D0FA 3PXJA 2NUTA 1OK8A 3WMQA 1CLOL 4F7EA 4HKXB 4L3CB 3WDJA 4UCFA 5BOJA 3F7VA 3O41A 2BLFA 4WW2F 5GZOC 1GTNA 3RIAK 5KWYC 3GXMA 4OUUA 1CN4A 4FI7A 5HDBB 2RMNA 1E42A 3FO2B 1X5KA 4HIHA 4KDVA 4XCEA 5L4FA 3FQWA 4ZX6A 3C75A 1BPLB 5I15L 4L1TA 1Y0LB 3M1BA 3WTYA 4PLJC 4AEEA 3IU4H 1RUPH 5EFIB 1L7TL 5DA4A 3HTLX 3KPPB 3S3DB 3I9IA 1N5AA 4UT7L 4XOCA 4J3OG 3OKEB 4ODTH 4P3WA 3MRMA 2VDNB 2EDEA 4QKTA 4ACTA 2XXGA 1T0NB 5CLZA 1P5VB 2EDXA 3E7JA 4B3VA 5T8IA 2WQAA 4ZPVB 1PX3A 4ZUVB 1DBBL 1XT5A 2RACA 4ZDHB 1WBYB 4LL1A 2VDRL 3WNNA 4EZKA 3V4VH 2G9HA 1DLHB 1AZRA 2PMZA 2N7BA 4OLWH 3FOMA 3GMNB 1BIHA 1TZGL 3HAEG 3OL2A 2OSLB 3CK0L 2BVQB 2F18A 2YD0A 3L08A 3X3GH 1WPCA 1CXEA 4LCUB 4PFEA 2EC8A 5F44A 1MCCA 4YFLF 43C9A 3NN8A 4P2RE 4DP4X 4MSWA 4WK4B 4UILL 2XJLA 4ZODA 4G59C 4FDWA 3K8KA 4WWNA 3PHOA 3MJ9H 4BZYA 3JV6B 2MCMA 3AQYA 1UWGH 2VSKB 2Z93A 5IEKA 3FYIB 3FF7A 1S7TB 2ZXQA 4NQQA 4OD1L 2OX5A 4N2IA 4AYBA 1F5WA 1DVFC 1X4ZA 3E0GA 3FSOA 3BH8B 2J88H 4PP2A 2G2NA 4U1SA 1D5XA 5TTRA 1P9MA 4N2FA 4TRPL 4WU7B 4FFWC 4NFCA 2EADA 12E8L 4DGUA 4PJXB 1KTBA 5AZEL 5TDNB 3DUSA 4GQRA 2PP9A 5HVFB 1Z3GH 5I6OA 5C70A 4V2BA 1RZKH 2JKXA 3DOSA 4FOMA 1MY5A 2A83B 5BJTA 3I9AA 4HUUA 4Y2OA 5D5MF 1UM5L 1MFAH 1ACCA 2QQQA 1PAZA 4WHYG 5HGHB 2J1KA 2UXTA 4YDIH 4DQOL 2VRAA 2DQIH 5D9SB 4I89A 3TBSA 4DGIL 4PJFA 3UYPA 2L4OA 1J86A 3C60B 1YYCA 1YNLL 4PJGB 5F0JB 4YC2C 5PCYA 3ZJAA 3CN3A 1I1RA 3VFPA 4D0CA 3QZNA 1CS6A 3MOBL 3QNXB 1P69B 3GZKA 2C9RA 2NSXA 1LE9A 2G0LA 1CU4H 1NINA 1XF4A 5IVXA 5DTFA 1FNGB 3ARGB 1SY6L 5IVNA 2A5UA 2EXSA 4UQ2B 5J06A 3O4OB 4UINH 3V79C 3IJYA 3QH3B 5T5NG 3FQRA 1VRSA 3QG6A 3NPZB 1FL6A 1D3CA 5EG6C 1ZLUK 3VWKC 4F27A 5FGCE 2ITDB 5FIEA 3U9WA 3GEWB 4D7PA 3WJJC 3GINA 4OF5A 1XB6A 2J12B 2CHNA 4GO6B 4E9RA 1ICTA 2NTFB 3LPGA 4IJ3B 4GRWH 2AQPA 1P4IH 4RGMB 4HF5L 1I53A 4JPKL 2ZXAA 4KK6D 4NCC1 4JRXD 3VWKD 4Y8DC 1DVUA 2FIRT 4P5KA 2Q7YB 4UOW0 2E76C 3EJYD 4FQIL 4TQPA 3VQ2C 4EI6A 1JXFA 2KHAA 1CLYH 1G7JA 5DT1L 1U3ZA 1JF1B 3W9EA 2AAVA 1U8JA 3RY6A 3WIIL 4U6TA 2GBAA 4G70B 2JNZA 2DWYA 2TSAA 1T0PB 1AP2A 1I9IL 5FO7B 4ZX3A 1RK0A 1XDTT 1DJWA 1NIBA 1OIOA 3DMMB 2B5IB 2JCCA 2OYLA 4L1SA 3CFBA 5KVFH 2OQJA 3GM0A 3BUDA 1J88A 2CUIA 4MNHA 1HHIA 4LMQI 4NIKB 5FKPA 3QUKA 5L2KA 1G9HA 2QMKA 4KVNL 2OK0L 4X6CE 2QKIB 3MNWB 1HFUA 4P99A 5D7HA 1BECA 1R47A 3AT9A 1FO0A 3UDWC 2JIXA 1MFCL 4TTDC 4YXKH 3SGEI 4Y5XC 1A6PA 2VERN 4KDTA 4XCCH 2AQ1A 4KRMB 3HZVB 1U8LA 1Z5LB 2VR6A 4OLUH 1G43A 4BWUA 5GJTH 5F0LB 4S0HA 3L2LA 2ZUVA 1E27B 4FFVC 5AKRA 3L95B 3JWNE 4LDLB 2PLTA 1UXSB 2NSQA 5IBTH 1J0IA 2ORBH 3HE7A 4TSCL 4TTDD 3I2CL 2DQJH 2FEDC 2P44B 2BOCA 2WKLA 5ACMA 1ZA3B 3ARED 5IB2A 4M6AA 1V3LA 3BSZA 3GBNH 1VFAB 3F64A 2JLPA 5ESQA 3SDCA 3ASWA 3STZA 1I7TB 2VN7A 5TE4L 3H3PH 3X11B 3IKCA 2AJXL 1OTSC 1BP3B 3DVIA 5LNEA 3ZKXB 4F1SA 1QFPA 4WI2A 1C5BL 5JPMB 3N43B 4GMTL 5AW0B 1OZTG 4Y5YB 1WDAA 2EICA 4MDRA 2BDNH 2B14A 5LG1A 3I6GB 4GLRH 3K72B 2DDQL 2ETWA 4HISA 1FG9C 4HS8L 4AUJA 3QEHA 1OTSD 5DO2D 4YSUA 2I5YH 1XXDC 1FZKA 1F4WH 1N64L 1Y6NR 3MQIA 4P4KD 2MFNA 2PWFA 5F7DA 4HALA 1KYAA 2HRPH 1FN4B 2R0WL 5CEZH 1DQQA 1XGUA 3BLKA 4OZIA 2DAVA 4OZGE 4EIUA 4HMCA 5FECB 4B9ZA 1M53A 5E08H 2P8MB 4UM9A 2A77H 4OIFA 3L8QA 4FG0A 4XVUC 1BD2A 2E9IA 2WXGA 3LN4B 1INQA 2GAZB 4MCYB 3FQUB 5BMFL 2X40A 5JW4M 3O4LA 1WG3A 3P54A 2EEBA 3OHXA 2NSMA 3G6JA 3LEXA 3KXFE 4XNUL 1TLKA 4Z3GA 1MUJB 2KPWA 4ZQKA 3THML 3GXIA 1FIGL 5D96C 1K5WA 4S10A 3SJVE 4LKXA 1GYAA 3ZL2A 5EZIL 3H9YA 3KPQB 3T0EE 4KNUA 2CBTA 2DI7A 4HUCA 3L9RA 4TSBH 2VLJD 4AJYV 2WO4A 5D4HA 4IDLA 3W0WA 3VXUA 1H3PH 3V6FA 2QLVB 2P5PA 4LEXL 5KYYB 3GBML 1LDPL 2AKRB 3D69B 3WEBA 1ORSA 1NKGA 3KGRA 4JL2A 5IM7B 1YG9A 2KBGA 2YSSA 2ZUWA 1ACYL 5LCVH 3TOPA 4F2FA 2OXHA 4X9BA 3U6RB 3WFEH 4E0RA 4XOAA 4X6EB 3CU7A 1A6ZA 3VI4E 4CVZA 4KRLB 4G83A 5JXEA 4NZFA 2J5LB 2ZWSA 2DQEH 5L8KB 3T8VA 1D6EA 4G71B 2O26U 4LLVA 4RAUB 4DO5A 1TG8A 5FYLH 5CJ5A 2J43A 1RU9L 5CJQL 1YEIH 3FUFA 1ERNA 3FW6A 1K4DA 5GGTA 5MERB 2HJKA 5ICZB 1JNHB 2XNAB 5I17B 3OD3A 3IGAA 3UYRL 1MH5A 2F9BT 4KKAD 4APQA 1X4YA 2X5PA 3CWGA 1A21A 5H37H 1G1KA 4L2YA 1RFDH 4DTGL 1ZE3C 4JY5L 2WXKA 3S3JA 4FFZA 1A7QH 4XPHL 4H8WC 3SIKA 2VQ1A 2W07A 4HAGA 5JHLL 1QFHA 2XLLA 1PVHA 3LX9A 3TS8A 2NT0A 1IFRA 3REWA 2ZYHA 4L4TD 3SGKA 2MKWA 2QVKA 1J12A 1JZ7A 4QCIA 3ISRA 4ZMLA 2WQVA 3ZT7A 1M4KA 2X4SA 3T1WA 2FJGB 3KDMB 5BZXA 4YZFE 2P5EB 1MJUL 3ECVA 2V9TA 4WW2B 2PTTB 4E41B 2CPCA 1ZD6A 3ABLB 4FEMA 2C9QA 1G7PA 3UPAA 5K9OA 3PPEA 5B38G 2E7CA 3GXPA 1E9QA 1VFBA 5LGKA 2EIMB 2NQ3A 2WBKA 1CBVL 4BFFA 4KJQC 1A3RL 2HCZX 4ZMOA 1S8DB 4JGMA 2IXQB 3TA4D 1J0HA 1QUNB 2OYPA 3HRZA 3TCLA 1HJBC 4W4OA 2OBGA 4AIXA 5CN1A 3BE1H 1ZT1A 1IGML 1XV8A 3LMJL 2MPAH 1F56A 3O9WC 4XN5A 5E0FA 3J2PA 1DCEA 4UZSA 2GJJA 4LLDA 2WXQA 4EQ3A 1P7QD 4YHPA 1IV8A 2XQ0A 1AG6A 4ICXA 3ENEA 1NGPH 1JMZA 1O6SB 2JKNA 4LFHD 2N3JA 2WSDA 3CPLB 4X99B 5CR8A 4Q6KA 2BXYA 4PRIA 2PYFA 4LLWA 4WW1B 3QCUL 4X7FC 4JFEA 4KI5C 5DJYB 3ZUNC 1MJ7L 3SKMA 1T1XA 2VMJA 3LVEA 4HKZA 2D3LA 3ZDXF 4HX1B 2HZHA 3MBEB 4P06A 4QT5A 1SLUA 4ZW7A 5AL0A 4QRUA 1MDTA 2JI1A 3GHEL 1N5YH 1RZ8A 4LEOB 4QTFA 3RDTD 1OT1A 3MV8D 5SV3A 4XAKD 3ULSA 3KPOA 5IOPB 4PJ7E 3PWUA 3ISWA 1IGJA 2CJ3A 4M5ZH 3K2UL 3IDJB 1JNNH 3RTQB 3SPCA 4CL7A 1JWUA 3FT4B 4CAGA 5I1CH 3P3TA 3SDDC 4ATTA 4LSSH 4LF3B 4MNQA 1SDDA 4RX4A 3QWOB 5EH1A 2C1PB 5BV7H 5EBWA 1ACZA 2EYRA 1ET7A 1TJMA 2LTQC 4NS0A 1ZLWH 4F8QA 1RHHA 2AV1A 2X4UA 5IFJA 1PDKA 1S3RA 5H4ZA 4LCVA 4AL8L 3ARDB 1XXFC 2CBPA 2CWRA 2F54E 4OGXH 5FAAA 5BRPA 4DZBA 2IDTA 5DD1H 3GMPB 1JCVA 5IMMA 3VCLB 2UWEF 4NXSA 4BHUA 2J6EL 4AGOA 1XH2A 2PWGA 3CQQA 3EADA 3DX9A 4KQ0A 5IV2A 3QB7C 2Z35B 3NCBB 2WBJA 3BKCH 3E6FB 1DBML 5D5MB 1QBBA 2JK5B 4A66A 5T3XE 5L0QC 3QYNA 3QRFM 2BIOA 3KVPA 4ELDA 3GS0A 3X17A 4BZ2A 4NKOA 1N6QH 4NGHH 3SKJH 3DX6A 3NGBB 1FUNA 1S7XB 2Y2WA 3P0YH 2VWEE 3EUUA 4GKZA 4G8EA 2IAND 4DUXA 5KANG 5DJAB 4NKMB 4KPHH 4GNKB 2V8LA 4IYKA 4MMZB 5CJOH 5D2LA 4Z95H 4HPYL 2WB7A 2PXYB 3ZKQD 4NZRH 3SQBA 3MRRB 2XUWA 5J56B 3ILPB 2A2QT 1OGPA 3F7QA 3QIBD 1Z5YD 3U7YH 3C9NB 3PQYD 3MU3A 1KLUA 5EUOA 2C1OB 4U3HA 2BSTB 4L5FL 3G6DL 1FNSL 3BWAB 4ANWA 4D9RE 5C6PB 4X5WB 4F7MA 5EU7E 3LNDA 1GZHC 3CHXA 3WY2A 2E0PA 3BIKA 1AR1B 3MTXA 4RDQG 4LCCB 3HIZA 2V7HA 3DXAE 5KYXA 4A2FA 3V6BR 5DRWA 1A6VL 1L6PA 4B9CA 2C7UA 1NANH 1MIML 1L9OA 1WCBA 4X8XA 4ABQA 3LTVA 3BD5A 4JB9L 4Z3HA 4JFOA 2X2UA 2XQYG 2EIZA 1MCEA 4XPTL 2DM4A 3N44F 3HB3B 1BG1A 5EZJB 4R90L 4MWFA 4FG6D 2BVTA 1DVYA 1DN0B 1H19A 5E4OA 3X1FA 5LJYH 1IM3A 3MNZB 4U1GC 1E8ZA 3VFNB 4XE5B 1OAQH 1QLEB 2QSVA 4LSRH 4PRPB 4AQAA 1XF2A 5K1VA 3EJRA 1IGTA 2H0PA 4AGNA 3TPKA 4NSKA 4ZO9A 5AVQB 3JWDL 4OD2A 3LXAA 4K3EH 3UO1H 3FHEA 3D25A 1JGUH 4U49A 3EDEA 4G43A 5I66B 1XEDA 3MGOB 1JV2A 2C9SA 5KSBE 4XBEL 4LCWA 1LO5A 1Q72H 2O5YL 3QDMA 5CIPH 3O2WH 1IL1B 2M8XA 3QZBA 4HP5A 2WO2B 4OCNC 4ANXA 4EE2A 2F8XC 3IMUA 1KB5L 4I3SL 4AT6A 3SE3C 1JDDA 3V7MA 1F3JB 1YAIA 1NQBA 4FTDA 3FCSB 1FFPB 5C09A 1MAML 4OLZL 3MREA 3K2MC 4U1LA 1T2QH 3OTTA 4P07A 5E8PA 1UUSA 3GI8H 3WJMB 1M57B 5EO9A 1ZLSL 1ZS2A 1P1ZA 3UBXA 4JFFB 4WJKB 4OFVA 1OAZH 1S9KC 1MWAA 4Y4KA 4P46C 3LV3B 4DZ8A 2UUDH 5E4EB 3KWWB 4U1IA 2HFEB 5GS0H 1U58A 3LKRB 4G1MA 3O11A 2YN5A 3NFNA 2RCSH 4DSYA 4FL4C 2E6QA 3I6KB 5FLUA 1I85C 1PYWB 3MRFB 4KZDL 2MQCA 1Y1UA 5FR3A 1EEZB 1KT2A 2X88A 4V2CB 4H1LH 2ICEB 1ADQA 1N70A 3EXJA 4CN6A 2O6DA 3MR9A 3E8UL 1PD6A 3FN0L 3RX9A 3QQ4B 3EOYG 1WIUA 4GRLD 4H0HB 4G9FB 4WK2B 3SE4C 3PFUA 2X87A 4F8NA 3MSPA 5GIRB 1CDJA 2NQDA 2F1EA 3GWJA 4L29A 4HQQL 3ZDZE 4X8CA 2VGLM 4M61A 3FOLA 1H5BC 2VQ4A 2XVLA 1AQ8A 4Y4HB 1IKNC 1FZJA 1H3UA 5CP7A 3VMOA 1HJCA 1J9SA 5I5RA 2BY1A 3KBEA 3PJSB 1HI6A 4X50A 3T0VA 5F70A 1S46A 2GEQA 3QQXA 4KQ4L 5AENA 2Z3FA 1IQDA 3WKMH 3HBQA 1SXZA 2YRLA 3EYOA 2BIHA 4FQXD 4KX9A 4QTIL 1DVXA 3D52A 3HS9A 2G75B 2HXAA 3AFLA 4JCLA 3ABMB 4CGTA 5DQ9A 2K45A 1F90H 5MI0B 3O2DA 4L9LA 3SY0A 4XNBA 4P2RD 4LPWA 3SKNA 4ZW6A 1RIUL 2CDGB 2Z8SA 3UAEA 1NMAL 1BZOA 1U8CA 1AI1L 5E94B 4U4BA 4JG0H 1AJ7H 5HVGB 1L9QA 2X0UA 4Q0XH 1CK0L 4KU1A 3UPRB 1AFVL 5D8JL 3RWDA 3VFTA 5TQ2H 3A4DA 2DWDA 1R3HB 4BJLA 5FDYA 1AGEA 2F7PA 1XSJA 2NY5H 2PPDA 3HG5A 4AXWA 4XP4L 3O6FC 3GRWH 3TX4A 2JB5H 1QKZH 3CHOA 1WEJL 3D0LA 3Q8EA 3T4YA 3DX1A 5G2NA 2V5TA 3MRBB 3MBXL 3KWTA 6FABH 2H32B 1SXSA 2RA1A 1QQDA 1MEXL 4S1DD 4LIQH 1MHPH 5EU5B 3ZOAA 1T7WA 4N6RA 2NY4D 3KLKA 3T6XA 3BN9C 3LEYL 4FHJA 1LO4L 5HHOA 2H41A 5C0DA 1ASOA 5I71C 1LNUB 2X1QA 2VNCA 4X6DA 4U1JA 1E4JA 2XWBB 5J4MA 2AJYH 5E51A 3VWJD 1WS7A 4WI4A 1GAFL 2NY3C 2E5EA 1T5XB 2L7UA 3S5ZA 1VEOA 5G5DB 1JRHL 4HD9A 4DKFL 3BN9D 1KIQB 3ZYZA 1F3RB 1J1PH 3KPLB 3WN5C 4D8OA 5CGMA 1TPXC 2ZX7A 5DS8A 3VXME 3QFJE 4N5ED 3G5YA 4H25B 4TNEA 5A2AA 3TJEL 5KJRH 2NY3D 4U6VL 1U8HB 4AW7A 5ACZA 3N40P 2VMFA 2XRAL 4QLWA 1CBJA 5JORA 5B3JE 4XC1L 1KXVA 2R69L 1MREL 5CO1A 5FYKU 1NGXB 4PJIE 1EJOH 1MCRA 2A9NH 3KG5A 2ADIB 3KGTA 2B1AH 2DQDH 3BPNB 4XH2B 4HK3J 3ZT6A 4PLKD 3G5VA 5GGUB 4JRXA 2F53A 1CTMA 1BFSA 2DTML 4GAFB 4U7KA 3QORC 3UZQB 5LLIC 5HJ3A 5C0BA 3RWEA 1U91B 1FBIL 2Y3NA 2ZUYA 3ARSA 4G9DB 5E1HB 1MVYA 5KVFE 3OKMB 4HCIA 4BUGA 1DJSA 4UUJB 2R8SL 4X5QA 4HOZA 3MKKA 3RVXC 2WLHA 1ETA1 4UQCA 5DJ6A 5KG9B 2D3JA 4QTHB 1HHKB 3SPVA 3BZFA 3UC0H 1KYDA 1NEZB 2P7TA 4F33A 3QORD 2OMBA 2OR8A 4FLQA 4PJ8A 1G5AA 5ECJE 1T1WB 4XP9L 2I85A 1S9XB 2FD6H 3GT6A 3HG0A 3GS4A 1YYLH 5HHQB 3RPIA 2A9CA 3US0A 2NW2B 2JVUA 2OLDA 5F9OL 2FB4H 1S78D 3GJEA 2YD3A 1UZ6F 1H3WM 5I75B 3ARBB 2R1XA 5CD5D 5GS2H 1K3IA 1QR4A 1QSFB 3OAUH 3QNZB 4G7VH 5HDOA 5F7HA 4K5LA 3BDYL 4I88A 2NW3A 1OARL 5HJBA 3QDGE 1W16A 3RY6C 5EEXA 3IYLW 2AI0H 3CFUA 3HMWH 3N91A 2EABA 4GBXD 4MYWB 1B2YA 4JHZA 4NRXA 4X6FA 3G9AB 5EZLA 1OGTA 1SRDA 1Z9SB 2AABL 3VE0B 2XETA 4ZNEE 3L3IA 5EIVA 2GC7C 4EZLA 4ZFFB 4TLSA 4HEPA 1JERA 2HJLB 3BQUB 5C0AB 3CC5B 3AREA 3DPBA 4JG1H 4M48L 1IZJA 4KJPD 4IRZH 1LP9A 1VEPA 3A67H 1GGTA 4HOMA 1QWUA 5K69A 5FF6B 1QFWH 5JHAA 3QT2A 2ZOTA 2AJSH 3PP3K 4TUKH 4N3UA 1EZVY 3B1TA 3ARPA 4JJOA 3V4PA 2XY1A 3EBGA 1H3TA 4KDTC 3ML8A 3DI2B 2JXMB 3OWEA 3IRCA 4PJFF 5LDSA 4OJCA 4FQPA 2ZYSA 5CEZE 3RFZA 2UWEB 3LKPA 2WQXA 3NIFB 3QK0A 1IAIL 1BF2A 3EFOA 4K15A 1NLDH 2RGSA 4YFLI 2BK8A 2EAEA 5I24A 4AH2A 3VXPA 2IIJA 2GSMB 15C8H 1KPUB 1CD9B 4EN2A 2FSEB 1IC5L 3T3PE 4P4KA 4Z78B 4MJIB 1UKQA 1C12B 1YEJL 2DBLL 3QXVA 5HGBB 5CGYC 5ILTH 5L4MA 8FABA 1KCSH 1VCBC 5D7IE 2VAAB 4J3OH 3L81A 3GZQA 5IVXF 1Y18B 1DQDL 3TT1L 2D2CC 5J11C 5F9AC 1CO1A 2W0PA 4A6YL 4M7KL 4OB5H 1Z2KA 1T0OA 2G0KA 3A6BH 4GT7A 2J7LA 3P0GB 4LVNB 1KBVA 2XA8L 4A37A 1A9BA 1JHLH 1XSKA 4PJHE 3SCMD 1KIPA 4MA1B 3EYUH 4AGMA 4MA8H 1YVLA 3RIAF 1CFBA 3ULVE 4N0UE 2DQFB 3PWPB 3P73B 3AAZA 2IH3A 3HAEH 1SLXA 3B37A 2CO2A 3KXFD 3NMEA 4AEIH 3IE9A 2NLJB 1EDYA 3ARWA 5HD8C 3JXAA 2FWOB 1TTUA 4R97C 3SJVD 2P8PA 1NFIB 3RWCA 3MLVL 1JHKL 4IS6B 4A7QA 1U4EA 1OOWA 1TCRA 3NRPA 5F7NC 3T0ED 1X7QA 2E4FA 3QARA 4LLQA 2V4LA 3Q5TA 4WO4D 5L2JB 5EV7A 2CCVA 1A22B 2YEZB 5FYLE 1T6BX 1U3HD 3HJEA 4TQEH 3BISA 2BSED 3QWRD 3OHXC 4LQFH 3BKYL 4KTYA 3KS0H 2ZCLL 1MRCH 5T1KB 5FHAL 2GI7A 2YGOA 1RIVL 3NCCB 1AS6A 4NFBA 3R0NA 1INEL 1TU2A 3RVVC 1ZJAA 4Q74A 3GKZA 1KLGA 3ARVA 2F15A 3GXFA 3DDFA 1E2WA 4XRCB 5BUGA 4NUGH 4WO0A 4CDGC 1XZ0A 3AXHA 2WUCH 1GMEA 1BZQK 1CGVA 3B9KD 3S5LA 2E6PA 1QFWM 3MAWA 4HBCL 4PN6A 5AAPA 3PDOB 3IXAB 1ASQA 2XBTA 1T7ZA 4IOFC 4OLYL 5A3ID 3D33A 5B7FA 2CNYA 4ODHL 3M46A 5I16A 3W9DA 4QXWA 2HRLA 3O6KH 2V7NA 3P30L 4UYPA 2HVJA 5AW2B 1ZHNB 1DQKA 4WFGE 4XVTH 3R8BB 3FAXA 4WNQB 2ODIA 4L4TA 5JXEC 3DBXB 1D5ZA 1OO2A 3IDNA 2VDMB 2XWTB 4Y16C 2FIKA 4DP0X 4YHLH 3JT2A 2HLFD 4W4NA 1DANU 1MW0A 4NP9A 4TF4A 4XNMB 2MNUA 5KUMA 3S37H 5GRJL 3HHSA 1KIRA 4NZ8A 4YUEH 5KBNC 2H9GA 1KFGA 2FWSA 1PG7L 2UUDK 3TF7C 1EA9C 4X6BA 2XZZA 1E6OH 3TTYA 5EDSA 1I8KA 4NO3B 2QQNL 3FXIC 4NO2A 5GPRA 2HH0L 2OMUB 5AVXB 2L7EA 2YOAA 3UROR 1OPGH 5KSAD 4PRBB 4NUQA 4NN5B 3IJEA 4R2GD 2F8VA 3ESNA 4UDUB 1HYSC 4H8UA 4GY4A 2CKBB 4WWKB 2WV3A 3MXWH 3SGKC 1MF2H 3L5WA 4QPEA 4R96B 2G60H 1YEKL 2P49B 2H0FA 2PABA 4F15B 2FZ3A 5IROA 3L48A 4HIJB 2CJUH 5FO9B 4P2QD 2J1WA 2TSBA 1XIWB 5F6HI 2IG2L 4OZIF 1BBJB 1UH2A 2GIMA 1HYSD 4WNSA 1UM6H 4YX2L 1YJDC 3KJ6L 2P24B 1CGUA 4PJCA 1VGKA 2YUXA 1LO0H 3V4UL 4WTWA 2VZVA 1JWSA 3K7UA 3LIUA 4NOBA 4NCDA 1LWHA 3GK8H 3TO2B 4ETYA 1ZKAA 3HC0A 4JY4A 3G6JF 4XO3A 2VDML 1YEEH 5C6TH 3RDTA 5L4JA 3MV8A 4Q9QL 4PV9B 4P9HH 1QFOA 4XP5L 5C0RH 1NH6A 1W8OA 4PRHA 4MS8D 3VB8A 1GGIH 3LEVH 3RZCB 4Z0BL 3PGFH 1IE5A 5D1XB 2WCSA 3WLWC 5C3TA 1RJLB 3MO1B 2JKRM 3JT0A 2E86A 1HXKA 3KPTA 4FQ1H 4FQJL 3U4EB 3J27A 4AYFB 2L04A 4X7SL 2CR0A 1X3DA 3U9PH 2G3MA 4J3WA 2BP8A 1QYGL 4JFTA 5HGAA 4PUBL 4PHZA 4MJ5A 1FCCA 1NAKH 2EDTA 4BA8A 4E9VA 1UQSA 5C6WH 2CKBL 1GGCH 1QFUL 4K94L 5DZPA 2W60B 1KBGL 3WL9A 3V0JA 5FM4A 4B7LA 1WSST 1QBML 3UTSE 4EOWL 4PGJA 4HVBA 3TJHC 1EAJA 1P6FA 3NZSA 4HXBH 5E5MA 1M7DA 4QHLB 3QI9B 2F54D 3OAYH 3SBWC 2SODB 3QEGL 2F2HA 3ZHKA 5C08E 2YJQA 4QRRE 5I74B 3H42H 4FA7B 1JZGA 5C07E 1KV7A 2VDOL 4X42A 3O3DB 3NTCH 4P5SA 4WTXA 4QRSB 4NZTL 4KKBC 3C09B 3TN0D 3L3JB 3NIDE 2ERJB 1VHPA 3Q13A 4TVSa 43CAB 1VZIA 4A2LA 4HJTA 3QIBA 3CH1B 4R7DB 1A6WL 2IWKA 3PQYA 4G72B 5EU7C 1Y7VA 1MKFA 2R59A 3KPSA 2NZ9C 2NYZA 3GEFA 3RIFK 5DUPL 1IQWL 1KLFB 3CMGA 4KKBD 1RZ7H 2G3NA 2VR8A 4F7EB 3N0AA 4XB7A 1E5AA 4UV4H 3AABA 2VR5A 3KYKL 4M7LT 5D1QD 3F7VB 1BAFH 3O41B 1KCRH 3ET9F 4OUUB 1GYWA 1KPVA 4PCYA 4PG2A 2CNZA 4D9RD 3GSOA 4XCEB 5DJZB 4HIHB 4Y2DC 4LAJH 5AW7B 4D9QE 2KT6A 2NZ9D 4X5XA 5IVZB 1MCJA 4JDTH 3M1BB 5MP6H 4GKOA 1MFMA 1HSAA 2XN0A 1G7HA 4QRPE 5IMOA 3CZFA 4JDEA 3IVKB 4ZXBC 2HX8A 2X1OA 3GSRA 1NGWA 2XFGB 4HJIA 5AKVA 2XTSA 1ID2A 4BQ6A 4PJAA 1LK2A 4BUQA 3MRMB 3S35H 4ZFGH 1OQXA 1TZHA 4MFHA 5ICUA 4X5LA 2BHUA 5KJ7E 3CVCA 3OAZH 1NLBH 2RH0A 3MLZH 3S36L 4MGXA 1Z3RA 3WE1A 4I77H 3BH9A 3AITA 2G9HB 3MOAH 2LU7A 2KYIA 2I07A 3CLWA 1Q94A 3FOMB 4CADB 4IBYA 1EHKB 4QHUA 1IAIM 2C7FA 5K1JA 5ITBL 1FFQA 3FF8A 2FO8A 2AQTA 4ELME 5I1KL 1N3NA 2EE6A 1W8NA 4V1DE 4DT2A 43C9B 3DC0A 3WFZA 4Q4IA 4MSWB 2OL3A 5BZWA 3VQLA 3V0WH 2X2YA 3PHOB 1RJYB 4S1QH 2Z93B 4KKNA 3CHPA 1RKRA 5IEKB 1ZA6A 2OX5B 2CE6A 5DLML 1A7NH 2NY2D 1WTLA 4PLNC 3SYOA 4PP2B 3Q9PA 4U1SB 1D5XB 1BLIA 1E8XA 1QBLL 3VXRA 4GQZA 4HC1A 3U82B 4Y1SA 3WFCL 2DLTA 2ODHA 3EYSL 4OQTH 2X05A 2A0LC 3DUSB 5T1MA 1LYQA 3QC5X 4EUPA 4R26L 2WP3T 3N42B 3DOSB 5C0ND 3U79A 4F57L 4PEEA 5BJTB 4HUUB 2VR3A 4Y2OB 3KR3H 1BQUA 2CBOA 2NXZB 4GRLA 3D85D 1IM9D 1ID5I 1NCCL 2F5AL 2OMXA 4FTVA 1I75A 2PWHA 4FG2A 3WELA 2QR0A 3H85A 4NUJA 3OJMB 3VFVA 4Y4KC 3ZT5A 3F12A 4JRYE 2K3HA 5HY9B 3TBSB 2ZOLA 5I6MA 2BVUA 4PJFB 5I8CB 3RKDD 3QHFH 2Q3XA 5CFAA 5HDQH 2PR4L 2KQNA 4D0CB 5IQMA 5D2LF 2ZUTA 1OCWL 2D03H 2ZOKA 1ZGLP 4ZFZA 4S1RH 4MQ7A 4XMZA 2FO4A 2RAMA 1LE9B 5EUOF 4HW6A 5AYQA 1XF4B 5DTFB 4XPGL 2ZWYA 4FQXA 1CFMA 3M6DA 1XO8A 4NKIL 2GJPA 3IJYB 1N18A 1CLZH 3FQRB 3C5ZA 5K39B 5ANHA 3ZSSA 3JUZA 3SPHA 1FL6B 3EJSA 1KN4L 4P2RA 4IEFA 3UH8A 3UBHA 2WNWA 1RZKC 5A2FA 1FPTL 1RXLA 5ADPH 3L4YA 5JIIA 1NCBH 4WFHE 3GKWL 1JZ5A 3B3IA 4D7BA 1J1XH 4AYSA 3P9MA 3U48A 1PZ3A 5GRWA 4TUOA 2BVOA 2WLZA 3ILQD 3VG0L 3VRLF 2LHAA 2NNAA 4LIQE 2G4EA 3CSYA 4E5XA 4UMGA 2W81C 5B4MC 1OGAE 1YEHL 4B6ZA 4P5KB 2EDDA 4FF9A 4ILDA 4ZJ9A 4EI6B 3QZPA 3QFDA 2VC2B 1RMFL 4DEPC 1DDHA 3ILDA 1TZIB 1RULL 1U8JB 1OPOA 4GQ9L 1XMWA 4HXAL 4AQ8A 3AGVA 2PW2A 3PHSA 2JCWA 1E4WL 1RK0B 4CC0A 5E2TH 1AGDA 4AYEC 2JCCB 4JLRA 4PJBE 2WMPA 3CFBB 3FUEA 2P8LA 4MNHB 4K8RH 5C0CE 1HHIB 3AVEA 1R5WA 4ADIA 4KZEL 1E5YA 2DV6A 4KO5A 3SGEH 2HRGA 3QUKB 5L2KB 3VWJA 1BOGA 1EHLH 3HOGA 3DGGA 4AQOA 2KZWA 4ODXA 5HYQA 5DCCA 5GRVK 2H26A 4YPJA 1FO0B 2JIXB 1BMZA 1PKOA 1U93B 3EO9H 4AQEA 3VW3H 1ETZA 4R4FL 1FHNA 1S9YA 4FQ2L 1I1YA 3BAEL 2ZKYA 4G6AD 4E42A 5L88H 3WIHL 3NJLA 1U8LB 4OCXL 3EJPA 4QRQB 3RNQA 2X44D 4BXVA 3QUXC 4F9LA 4HIXH 4OIAA 1TOXA 1BGXH 3VXMD 2XPZA 3QFJD 4BRJA 4ETQA 3DA0A 2K7PA 1SXNA 2XDHA 1NFKA 1TETL 3HE7B 4GP4B 3ILEA 5ESAA 3CFCH 1A7OH 2F5BH 2B1OA 3QZWG 1V3KA 2BOCB 5E8NA 1CB4A 1TQSA 1ZGLA 5IB2B 3TM6A 4CMHC 1A47A 3V7AG 3L1EA 5ESQB 3SDCB 3STZB 1XBDA 5DK0A 1KB9J 3IKCB 3NPSB 3H8NA 5DZLA 5I8OH 1A1MA 4RFOH 3RG1C 4WHCA 2N7SA 3X1NA 4UZUA 4ONHA 5IGXL 1BFVH 5DJXB 1AQHA 1KXVC 4KJWC 2G30A 2PWEA 2DQTH 5AKTA 1B4TA 4JPVH 1T6WA 3QEHB 4A2DA 1DDTA 1FZKB 1KJ2H 2WVVA 1FO0L 5F7DB 5D55A 2ENQA 2W9EH 4PRNA 2ADGA 2DEXX 1NCJA 1DQQB 1XGUB 4FLOA 3U6XA 3KBFA 3PY9A 2EEDA 2KMWA 3VFMA 3O0LA 4X6CA 3K8LA 4KQ3L 1H6EA 4UM9B 3N0PB 1BD2B 4KV5F 4OLVL 1INQB 4ZAKD 4F3FA 3FUDA 4N85A 4OJFL 4KROB 1F42A 4PVNA 4OCYL 3MV9E 5FYKL 4HG4K 3P2DA 3O4LB 2EE0A 5I73C 3KYOA 3OHXB 4HUMB 3QA3A 3QQ9C 1GOFA 4GBXA 3G6JB 4Y9GA 3LEXB 4UDTA 3QDGD 4LVHC 5IWLC 1A4JA 3FUNA 1J1OH 4LKXB 4WJ5A 3WV0A 2QELA 3TO4D 2EDNA 4GKLA 2CM5A 1XF5B 2GB2A 3MUGA 1N8OE 3W81A 2IQAA 3OB8A 2C3XA 3BRFA 4GRWF 1OAUH 1MCPH 3ROOA 3VXUB 1YEFH 3ESMA 2EC9T 1BYNA 3MLSH 3SE9L 5F96H 2C9VA 3CDZA 3KJ4B 5EEZA 4GG6E 3FJTA 1S4IA 3AADB 1ORSB 2OJEA 2YSSB 1UOKA 2ZKMX 5JZ7C 2BOBA 3WMSA 4N28A 2DJUA 3OPZL 1ZY9A 3UEZA 4P2AA 1XAKA 1A6ZB 1RUKL 4CVZB 1MLBA 4S0SD 2DB8A 5IHLB 4UQIM 4X6DF 4KXCA 1ZDSA 1D6EB 4Y19D 4LLVB 4G11A 5F3HA 2CH8A 4K9EH 1YDPB 1N4XL 3CZEA 1ZHBA 1MDAA 8CGTA 4HWNA 2E8YA 1ULVA 3IF1A 1K4DB 2W0FB 2HJKB 3RNKB 3UC2A 3DRQB 3J7HA 4RAVB 3IGAB 1MH5B 4M6NL 4APQB 2OFQA 2BMKA 4FXTA 1OAXL 4OW6A 2ZYIA 4FNLL 4WEBL 2A1WL 2A9BA 5DZJA 4OZGA 4IHBA 2ZWZA 3L5XH 3FZUC 1UKTA 2W07B 4Z7WE 4H8PA 4I8DA 2CIKA 5IG7A 1G7MB 3N1FC 2FJHA 1R3IL 2E7BA 3MFFB 3REWB 4F37F 5FWRA 1NA8A 3GIVA 2DYRB 5DO8A 3GSNH 2AP2A 1S7RA 2I32A 4XAWH 4QCIB 2EO7A 4KK5D 4XVOA 2X4SB 4W6XB 3IJ8A 3KXFA 4LAQL 1ZHKA 3QCTL 5DQJA 3SOBH 2WYIA 3ULVD 5LVEA 5CLYA 5F7BA 1IRAY 2XVGA 3SJVA 2O72A 2LLNA 4XPAH 1G7PB 3T0EA 1EXUA 5K9OB 3VYPA 2N4IA 5HHMB 3CFKA 4MXVF 3X1BA 4FA6A 3U7WL 4LOUC 1E9QB 1VFBB 4UOQA 5EEVA 4WO4A 5D7LE 3L4TA 1LL1A 3FBQA 4X80H 2XC8A 3CJJA 1BAWA 2FX7L 4N25A 3TCLB 1U3HA 4NN7B 3HRZB 3L3OA 4UILH 2QADB 3Q3GA 1ZT1B 2XG5A 1AACA 1BQ5A 5H94A 1RJZA 2XHNA 5FYLD 4Y4FD 4HFWB 4LOUD 4OCWL 5AOJA 4LVOB 4LLDB 4EBQH 4OD1H 4MNGE 3VI4A 3DX4A 2X89A 2ED7A 3VUAA 1UGNA 4YHPB 3JSSA 4R9HA 1YN7B 1P1VA 4Y1AA 1AXTL 5EC1A 2XKUA 1DUYA 2YQBA 3WTUA 4PRIB 1DBJL 2PYFB 3FPYA 3OAZK 4LLWB 3G7TA 4M5TA 3VXTA 1XR8A 4JFEB 4AG4H 7FABL 3B9KA 5JIPA 3BRDA 3QW9A 1ZPLA 2YBRA 4ISVA 3SKMB 1T1XB 4HKZB 2V9UA 2VDNH 4F2ME 2YXFA 5IUSA 4QT5B 1YPZE 2WM0A 3N41B 4QRUB 4XR8C 2V3EA 4YSRA 2GCYA 5TF1L 3SBPA 4UTAL 1S7WB 1J05A 1D6VL 3ULSB 3KPOB 4N1HB 4DQOH 3PWUB 1QNZL 1IGJB 4IK7A 1XFPA 2NY6D 2X6MA 1QATA 1JWUB 4WFGD 1NC2D 1A4KA 4BKLA 3MUUA 3VSUA 1G9EA 4Z7OE 1HHGB 5C92A 4TNFA 2F8OA 4LSDA 4MNQB 1SDDB 3FYEB 3BAKA 3MA9L 5B1BB 3MOBH 1B4JH 1KYOK 4JBSA 3C08L 5EBWB 2CRZA 2EYRB 1QR1B 2AXFA 4URTB 1P4BH 1YNTA 2O30A 1VAHA 1F0LA 3H2PA 3NYKA 1RHHB 4HT1H 2AV1B 5DU7A 3UFIA 1THAA 5IFJB 1PDKB 3IDMA 5L9DL 3R1GH 5KSAA 4LHQB 5DK2A 1EUTA 3VD5A 4B0MM 4DZBB 5IMMB 5BS0E 3SDAC 1TCMA 3DX9B 5HI4D 2Z31C 4FRWA 4I18A 1YN6A 5IV2B 2WBJB 1FFRA 5I0ZA 3TL5A 1HCVA 1G7IA 3MLRL 3QVAA 3HG1E 4JW3A 2APWA 4NKOB 2DQ6A 25C8L 1XGYL 3P4OB 4P2QA 3AU1A 4RLDA 4Z7UF 5E2UL 3DX6B 5E2VH 5E9DD 1R3JA 2F7RA 1ZSHA 4YHOH 2ZSVA 5MENE 4GI8A 4G8EB 5C0IA 3QXUA 2Z31D 4PJEE 3V52L 4H88L 5D2LB 4FFYL 3A21A 2CDEA 3CVHA 5AVRB 3SQBB 3ZR6A 3M8OL 5DT1H 4HA1A 4XC3L 1V7NH 5BV7C 3SODB 3VGBA 2G3ZA 2BC4A 1CDBA 1MFVA 1KLUB 2EH8L 2XN2A 2WPGA 3VB9A 3NSYA 1HH9A 1VACA 3SN6N 3UTSA 3D12B 2W95A 1GOHA 4F7MB 2K8MA 1IAMA 4WKZA 1KPRA 3D4GA 5KVDH 1TNNA 5KYXB 2KDYA 4PJ7A 3FT1A 3KL5A 5E2WH 4ONFL 5DRWB 4RGNE 5KTEL 3BKJL 2FR4A 2OK0H 3M17A 5IF0B 2WVSA 3IN0A 2C7UB 4M8QA 3DGDA 1WCBB 2FGWL 2VDQB 4PGZA 4MB4A 4NNYA 4GKNA 3DV4A 3NK3A 2EIZB 5CSZA 5E1QA 5GJSL 3EG9A 3HMXA 4MWFB 3WG7B 5HI5C 4HWBA 2OZ4L 1IM3B 5HGGS 2X4OB 2WYZA 2J8HA 1W0WB 3GJFH 2FRGP 2AGJH 2QHRL 4Q89A 4AQAB 4P5RA 4NQDE 3WNPA 4KRPD 4XTRC 5EOQL 1IGTB 1E28A 4NSKB 1A7PL 3H9HB 4OD2B 4XNYL 3UTSD 3D25B 1RZFH 1U8KA 3U7AA 1DYZA 1UENA 3PJNA 3BP6A 4G43B 2JKTM 2MCPH 1JV2B 1N68A 1VJSA 5F89A 2VO5A 5EO1A 4YWGH 5C08D 4QRRD 2F19H 3ZL4L 5H35A 5C07D 1BG9A 1U8IA 4WENB 3RWHB 4DOHB 3CZLA 4AT6B 1N2RA 4HOXA 4JFDA 1V05A 4RIRB 3CSPA 4ONGL 4YEFA 2MHAA 2HUEA 5C09B 3MREB 4OGAC 3HR5A 4U1LB 1J8HE 5E8PB 4PJDA 5SWSE 1F2QA 3FC8A 1IBZA 1P1ZB 5I30L 2BNQE 1IC4H 4GMTH 1OD7A 1WUNT 2QVMA 1MWAB 3PJLA 4DZ8B 4W6YB 2HWZH 3VXQA 1SOSA 4QR7A 4U1IB 5D1QA 1J9QA 1U58B 2V37A 3PWLA 2NX5E 3GNMH 3ZKMD 2JTYA 4G1MB 3NFNB 3ZHFA 2XU9A 3T0WA 4ZTOH 2GQHA 4K71C 5D4JA