2LHFA

Solution structure of outer membrane protein h (oprh) from p. aeruginosa in dhpc micelles
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
178
structure length
178
Chain Sequence
ADNFVGLTWGETSNNIQKSKSLNRNLNSPNLDKVIDNTGTWGIRAGQQFEQGRYYATYENISDTSSGNKLRQQNLLGSYDAFLPIGDNNTKLFGGATLGLVKLEQDGKGFKRDSDVGYAAGLQAGILQELSKNASIEGGYRYLRTNASTEMTPHGGNKLGSLDLHSSSQFYLGANYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein H1
publication title Structural Basis for the Interaction of Lipopolysaccharide with Outer Membrane Protein H (OprH) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 20
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2lhfA00
2GE4A 2F1TA 3GP6A 1Q9FA 2K0LA 4RLCA 3QRAA 1QJ8A 1BXWA 2JMMA 1QJPA 2MNHA 1MM4A 2MHLA 2M06A 2X27X 3C5OA 1THQA 2ERVA 2LHFA 2M07A 1P4TA 1MM5A 1G90A 1QJ9A 2F1VA 1ORMA 1Q9GA 3G7GA 4PUXA 2N2MA 3QRCA 2N2LA
chains in the Genus database with same CATH superfamily
2KXPA 4FZNA 1H6S1 3GP6A 4N75A 1Q9FA 3LK3B 3QRAA 1IZNB 3DWOX 3SYSA 1BXWA 2XTRA 3UU2A 2MHLA 4RL9A 3JTYA 1HXTA 6PRNA 3NJTA 4FESA 3POUA 1MPFA 4F4BA 4U9CA 4O4XA 3T0SA 1THQA 5DL5A 2R4PA 5GTIO 1GFMA 2R4NA 4N74A 5FVNA 5TISO 1OSMA 1ZHWA 3PQUA 4GCPA 4AYID 8PRNA 2PRNA 4LSEA 2X9KA 2KC0A 2M07A 3SYBA 4O3ZA 2R89A 3VY9X 5GTHO 4D65A 2Y0LA 1MM5A 4AKMA 4AKRB 5AFUL 1ZHTA 4N59A 1G90A 4E1TA 4AUIA 3RBHA 1T1LA 4B61A 4UB8O 5G26A 1ZHXA 4G76A 3G7GA 4C4VB 1GFPA 4CTDA 3VY8X 1HXUA 3JCUO 4N58A 4QQ1A 1GFOA 2KZ7A 5GV0A 4FQEA 3AAEA 3AAAA 4FRXA 1BH3A 4FOZA 2FGRA 2F1TA 1T16A 2XE2A 2Y0HA 5DL8A 3UAQA 2K0LA 4RLCA 2J4UP 5B5EO 5IYUA 1E54A 2ZFGA 3AA0B 3DA4A 3VZWX 1MM4A 4GF4A 5KAFO 2ODJA 3WU2O 2M06A 2XMXA 3NSGA 4O4UA 2XE5A 5DL6A 4LSHA 4AYEC 4AYMC 4AYNA 2LHFA 2ZLDA 4FZMA 2XE3A 4K3CA 3SY9A 2R4LA 3PGRA 4AZLA 5B66O 4O49A 1BT9A 5G39A 3SY7A 5D5DA 4C00A 1P4TA 4FMSA 2F1VA 3AA7A 4FRTA 2KXPB 3WI5A 3LK2A 3AA6A 2Y2XA 4RJWA 4AFKA 1Q9GA 3PRNA 2WJQA 4PUXA 4UB6O 1GFQA 3AA1A 4JCHA 4E1SA 4JFBA 1S5LO 5T5FA 2FGQX 5JDPA 2AXTO 2Y0KA 5G38A 2IWVA 1QJ8A 2W80C 3POXA 2JMMA 4FT6A 4XNLA 1QJPA 3FYXA 5EE2A 1ZHZA 2R88A 2IWWA 2O4VA 3HOLA 5KAIO 5ADXK 4IL6O 2WVPA 3C5OA 3BRYA 4AYDC 2YNKA 2OMFA 2ERVA 5H2FO 4BUMX 1IZNA 3AA6B 4GHBA 3LK42 4O3XB 3PGSA 4KR4A 5E79O 4C69X 4GCQA 3PQSA 2K4TA 2QTKA 7PRNA 2KZ7B 2XG6A 4G75A 3K19A 1QJ9A 3AAEB 3AAAB 3EMNX 1GFNA 3V8UA 4Z3TA 1ORMA 1PHOA 3VZUX 2R4OA 1PRNA 2R8AA 3A2SX 4K3BA 2KDYA 4FSOA 3QRCA 5G3AA 4AKRA 2W81C 4D5UA 3BS0A 3KZIO 2GE4A 1YS5A 3T20A 2WJRA 2PORA 4LSFA 2Y7SA 3DA3A 3HOEA 4RJXA 3BRZA 2XE1A 4C4VA 3PF1A 2MNHA 2J1NA 3O0EA 4GCSA 3WI4A 3SZDA 5DL7A 3DZMA 2JQYA 3KVDD 3A0HO 5ADXL 1ZHYA 2X27X 3PORA 3POQA 3A0BO 4O3WA 3SZVA 3AA0A 4O3YA 3AA7B 3LK3A 1HXXA 3LK2B 4FSPA 3HW9A 3UPGA 3VE1A 4KR8A 4XNKA 3AA1B 5AFUK 4RLBA 3HWBA 3TZGA 3PGUA 2F1CX 2XTQA 4D64A 3T24A 3VE2A 2LFUA 2YPVA 4KRAA 3LK41 1OPFA 4FUVA 4FZLA 5PRNA 2N2MA 4LSIA 3VZTX 4PJ0O 3DWNA 2N2LA 4PR7A
chains in the Genus database with same CATH topology
2KXPA 4FZNA 1H6S1 3GP6A 1Q9FA 3LK3B 3QRAA 1IZNB 3SYSA 1BXWA 2XTRA 3UU2A 2MHLA 4RL9A 3JTYA 1HXTA 6PRNA 4FESA 3POUA 1MPFA 4F4BA 4U9CA 4O4XA 3T0SA 1THQA 5DL5A 1GFMA 5FVNA 8PRNA 4AYID 1OSMA 1ZHWA 3PQUA 4GCPA 2PRNA 4LSEA 2KC0A 2M07A 3SYBA 4O3ZA 3VY9X 4D65A 2Y0LA 1MM5A 4AKMA 4AKRB 5AFUL 1ZHTA 4N59A 1G90A 4E1TA 3RBHA 4B61A 5G26A 1ZHXA 4G76A 3G7GA 1GFPA 3VY8X 1HXUA 4N58A 4QQ1A 1GFOA 2KZ7A 5GV0A 3AAEA 3AAAA 4FRXA 1BH3A 4FOZA 2FGRA 2F1TA 2Y0HA 2XE2A 5DL8A 3UAQA 2J4UP 2K0LA 4RLCA 5IYUA 1E54A 2ZFGA 3AA0B 3DA4A 3VZWX 1MM4A 4GF4A 2ODJA 2M06A 2XMXA 3NSGA 4O4UA 2XE5A 5DL6A 4LSHA 4AYEC 4AYMC 4AYNA 2LHFA 2ZLDA 4FZMA 2XE3A 3SY9A 4AZLA 4O49A 1BT9A 3SY7A 5D5DA 1P4TA 4FMSA 2F1VA 3AA7A 4FRTA 2KXPB 3WI5A 3LK2A 3AA6A 2Y2XA 4RJWA 4AFKA 1Q9GA 3PRNA 4PUXA 1GFQA 3AA1A 4JCHA 4E1SA 4JFBA 5T5FA 2FGQX 5JDPA 2Y0KA 1QJ8A 2W80C 3POXA 2JMMA 4FT6A 4XNLA 1QJPA 3FYXA 5EE2A 1ZHZA 2O4VA 3HOLA 5ADXK 3C5OA 4AYDC 2YNKA 2OMFA 2ERVA 4BUMX 1IZNA 3AA6B 4GHBA 3LK42 4O3XB 4KR4A 4C69X 4GCQA 3PQSA 2K4TA 2QTKA 7PRNA 2KZ7B 2XG6A 4G75A 3K19A 1QJ9A 3AAEB 3AAAB 3EMNX 1GFNA 3V8UA 4Z3TA 1ORMA 1PHOA 3VZUX 1PRNA 3A2SX 2KDYA 4FSOA 3QRCA 4AKRA 4D5UA 2W81C 2GE4A 1YS5A 3T20A 2PORA 4LSFA 2Y7SA 3DA3A 3HOEA 4RJXA 2XE1A 2MNHA 2J1NA 3O0EA 4GCSA 3WI4A 3SZDA 5DL7A 5ADXL 3KVDD 1ZHYA 2X27X 3PORA 3POQA 4O3WA 3SZVA 3AA0A 4O3YA 3AA7B 3LK3A 1HXXA 3LK2B 4FSPA 3HW9A 3UPGA 3VE1A 4KR8A 4XNKA 3AA1B 5AFUK 4RLBA 3HWBA 3TZGA 2XTQA 3T24A 3VE2A 2LFUA 2YPVA 4KRAA 3LK41 1OPFA 4FUVA 4FZLA 5PRNA 2N2MA 4LSIA 3VZTX 4D64A 4AUIA 2N2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  2F1T A;  3GP6 A;  1Q9F A;  2K0L A;  4RLC A;  3QRA A;  1QJ8 A;  1BXW A;  2JMM A;  1QJP A;  2MNH A;  1MM4 A;  2MHL A;  2M06 A;  2X27 X;  3C5O A;  1THQ A;  2ERV A;  2LHF A;  2M07 A;  1P4T A;  1MM5 A;  1G90 A;  1QJ9 A;  2F1V A;  1ORM A;  1Q9G A;  3G7G A;  4PUX A;  2N2M A;  3QRC A;  2N2L A; 
#chains in the Genus database with same CATH topology
 2KXP A;  4FZN A;  1H6S 1;  3GP6 A;  4N75 A;  1Q9F A;  3LK3 B;  3QRA A;  1IZN B;  3DWO X;  3SYS A;  1BXW A;  2XTR A;  3UU2 A;  2MHL A;  4RL9 A;  3JTY A;  1HXT A;  6PRN A;  3NJT A;  4FES A;  3POU A;  1MPF A;  4F4B A;  4U9C A;  4O4X A;  3T0S A;  1THQ A;  5DL5 A;  2R4P A;  5GTI O;  1GFM A;  2R4N A;  4N74 A;  5FVN A;  5TIS O;  1OSM A;  1ZHW A;  3PQU A;  4GCP A;  4AYI D;  8PRN A;  2PRN A;  4LSE A;  2X9K A;  2KC0 A;  2M07 A;  3SYB A;  4O3Z A;  2R89 A;  3VY9 X;  5GTH O;  4D65 A;  2Y0L A;  1MM5 A;  4AKM A;  4AKR B;  5AFU L;  1ZHT A;  4N59 A;  1G90 A;  4E1T A;  4AUI A;  3RBH A;  1T1L A;  4B61 A;  4UB8 O;  5G26 A;  1ZHX A;  4G76 A;  3G7G A;  4C4V B;  1GFP A;  4CTD A;  3VY8 X;  1HXU A;  3JCU O;  4N58 A;  4QQ1 A;  1GFO A;  2KZ7 A;  5GV0 A;  4FQE A;  3AAE A;  3AAA A;  4FRX A;  1BH3 A;  4FOZ A;  2FGR A;  2F1T A;  1T16 A;  2XE2 A;  2Y0H A;  5DL8 A;  3UAQ A;  2K0L A;  4RLC A;  2J4U P;  5B5E O;  5IYU A;  1E54 A;  2ZFG A;  3AA0 B;  3DA4 A;  3VZW X;  1MM4 A;  4GF4 A;  5KAF O;  2ODJ A;  3WU2 O;  2M06 A;  2XMX A;  3NSG A;  4O4U A;  2XE5 A;  5DL6 A;  4LSH A;  4AYE C;  4AYM C;  4AYN A;  2LHF A;  2ZLD A;  4FZM A;  2XE3 A;  4K3C A;  3SY9 A;  2R4L A;  3PGR A;  4AZL A;  5B66 O;  4O49 A;  1BT9 A;  5G39 A;  3SY7 A;  5D5D A;  4C00 A;  1P4T A;  4FMS A;  2F1V A;  3AA7 A;  4FRT A;  2KXP B;  3WI5 A;  3LK2 A;  3AA6 A;  2Y2X A;  4RJW A;  4AFK A;  1Q9G A;  3PRN A;  2WJQ A;  4PUX A;  4UB6 O;  1GFQ A;  3AA1 A;  4JCH A;  4E1S A;  4JFB A;  1S5L O;  5T5F A;  2FGQ X;  5JDP A;  2AXT O;  2Y0K A;  5G38 A;  2IWV A;  1QJ8 A;  2W80 C;  3POX A;  2JMM A;  4FT6 A;  4XNL A;  1QJP A;  3FYX A;  5EE2 A;  1ZHZ A;  2R88 A;  2IWW A;  2O4V A;  3HOL A;  5KAI O;  5ADX K;  4IL6 O;  2WVP A;  3C5O A;  3BRY A;  4AYD C;  2YNK A;  2OMF A;  2ERV A;  5H2F O;  4BUM X;  1IZN A;  3AA6 B;  4GHB A;  3LK4 2;  4O3X B;  3PGS A;  4KR4 A;  5E79 O;  4C69 X;  4GCQ A;  3PQS A;  2K4T A;  2QTK A;  7PRN A;  2KZ7 B;  2XG6 A;  4G75 A;  3K19 A;  1QJ9 A;  3AAE B;  3AAA B;  3EMN X;  1GFN A;  3V8U A;  4Z3T A;  1ORM A;  1PHO A;  3VZU X;  2R4O A;  1PRN A;  2R8A A;  3A2S X;  4K3B A;  2KDY A;  4FSO A;  3QRC A;  5G3A A;  4AKR A;  2W81 C;  4D5U A;  3BS0 A;  3KZI O;  2GE4 A;  1YS5 A;  3T20 A;  2WJR A;  2POR A;  4LSF A;  2Y7S A;  3DA3 A;  3HOE A;  4RJX A;  3BRZ A;  2XE1 A;  4C4V A;  3PF1 A;  2MNH A;  2J1N A;  3O0E A;  4GCS A;  3WI4 A;  3SZD A;  5DL7 A;  3DZM A;  2JQY A;  3KVD D;  3A0H O;  5ADX L;  1ZHY A;  2X27 X;  3POR A;  3POQ A;  3A0B O;  4O3W A;  3SZV A;  3AA0 A;  4O3Y A;  3AA7 B;  3LK3 A;  1HXX A;  3LK2 B;  4FSP A;  3HW9 A;  3UPG A;  3VE1 A;  4KR8 A;  4XNK A;  3AA1 B;  5AFU K;  4RLB A;  3HWB A;  3TZG A;  3PGU A;  2F1C X;  2XTQ A;  4D64 A;  3T24 A;  3VE2 A;  2LFU A;  2YPV A;  4KRA A;  3LK4 1;  1OPF A;  4FUV A;  4FZL A;  5PRN A;  2N2M A;  4LSI A;  3VZT X;  4PJ0 O;  3DWN A;  2N2L A;  4PR7 A; 
#chains in the Genus database with same CATH homology
 2KXP A;  4FZN A;  1H6S 1;  3GP6 A;  1Q9F A;  3LK3 B;  3QRA A;  1IZN B;  3SYS A;  1BXW A;  2XTR A;  3UU2 A;  2MHL A;  4RL9 A;  3JTY A;  1HXT A;  6PRN A;  4FES A;  3POU A;  1MPF A;  4F4B A;  4U9C A;  4O4X A;  3T0S A;  1THQ A;  5DL5 A;  1GFM A;  5FVN A;  8PRN A;  4AYI D;  1OSM A;  1ZHW A;  3PQU A;  4GCP A;  2PRN A;  4LSE A;  2KC0 A;  2M07 A;  3SYB A;  4O3Z A;  3VY9 X;  4D65 A;  2Y0L A;  1MM5 A;  4AKM A;  4AKR B;  5AFU L;  1ZHT A;  4N59 A;  1G90 A;  4E1T A;  3RBH A;  4B61 A;  5G26 A;  1ZHX A;  4G76 A;  3G7G A;  1GFP A;  3VY8 X;  1HXU A;  4N58 A;  4QQ1 A;  1GFO A;  2KZ7 A;  5GV0 A;  3AAE A;  3AAA A;  4FRX A;  1BH3 A;  4FOZ A;  2FGR A;  2F1T A;  2Y0H A;  2XE2 A;  5DL8 A;  3UAQ A;  2J4U P;  2K0L A;  4RLC A;  5IYU A;  1E54 A;  2ZFG A;  3AA0 B;  3DA4 A;  3VZW X;  1MM4 A;  4GF4 A;  2ODJ A;  2M06 A;  2XMX A;  3NSG A;  4O4U A;  2XE5 A;  5DL6 A;  4LSH A;  4AYE C;  4AYM C;  4AYN A;  2LHF A;  2ZLD A;  4FZM A;  2XE3 A;  3SY9 A;  4AZL A;  4O49 A;  1BT9 A;  3SY7 A;  5D5D A;  1P4T A;  4FMS A;  2F1V A;  3AA7 A;  4FRT A;  2KXP B;  3WI5 A;  3LK2 A;  3AA6 A;  2Y2X A;  4RJW A;  4AFK A;  1Q9G A;  3PRN A;  4PUX A;  1GFQ A;  3AA1 A;  4JCH A;  4E1S A;  4JFB A;  5T5F A;  2FGQ X;  5JDP A;  2Y0K A;  1QJ8 A;  2W80 C;  3POX A;  2JMM A;  4FT6 A;  4XNL A;  1QJP A;  3FYX A;  5EE2 A;  1ZHZ A;  2O4V A;  3HOL A;  5ADX K;  3C5O A;  4AYD C;  2YNK A;  2OMF A;  2ERV A;  4BUM X;  1IZN A;  3AA6 B;  4GHB A;  3LK4 2;  4O3X B;  4KR4 A;  4C69 X;  4GCQ A;  3PQS A;  2K4T A;  2QTK A;  7PRN A;  2KZ7 B;  2XG6 A;  4G75 A;  3K19 A;  1QJ9 A;  3AAE B;  3AAA B;  3EMN X;  1GFN A;  3V8U A;  4Z3T A;  1ORM A;  1PHO A;  3VZU X;  1PRN A;  3A2S X;  2KDY A;  4FSO A;  3QRC A;  4AKR A;  4D5U A;  2W81 C;  2GE4 A;  1YS5 A;  3T20 A;  2POR A;  4LSF A;  2Y7S A;  3DA3 A;  3HOE A;  4RJX A;  2XE1 A;  2MNH A;  2J1N A;  3O0E A;  4GCS A;  3WI4 A;  3SZD A;  5DL7 A;  5ADX L;  3KVD D;  1ZHY A;  2X27 X;  3POR A;  3POQ A;  4O3W A;  3SZV A;  3AA0 A;  4O3Y A;  3AA7 B;  3LK3 A;  1HXX A;  3LK2 B;  4FSP A;  3HW9 A;  3UPG A;  3VE1 A;  4KR8 A;  4XNK A;  3AA1 B;  5AFU K;  4RLB A;  3HWB A;  3TZG A;  2XTQ A;  3T24 A;  3VE2 A;  2LFU A;  2YPV A;  4KRA A;  3LK4 1;  1OPF A;  4FUV A;  4FZL A;  5PRN A;  2N2M A;  4LSI A;  3VZT X;  4D64 A;  4AUI A;  2N2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...