2LHFA

Solution structure of outer membrane protein h (oprh) from p. aeruginosa in dhpc micelles
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
178
structure length
178
Chain Sequence
ADNFVGLTWGETSNNIQKSKSLNRNLNSPNLDKVIDNTGTWGIRAGQQFEQGRYYATYENISDTSSGNKLRQQNLLGSYDAFLPIGDNNTKLFGGATLGLVKLEQDGKGFKRDSDVGYAAGLQAGILQELSKNASIEGGYRYLRTNASTEMTPHGGNKLGSLDLHSSSQFYLGANYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Interaction of Lipopolysaccharide with Outer Membrane Protein H (OprH) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Outer membrane protein H1
total genus 20
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2lhfA00
3GP6A 2MNHA 2K0LA 2LHFA 2M07A 2F1TA 3QRCA 2X27X 1BXWA 2ERVA 1ORMA 1QJPA 2MHLA 1P4TA 1G90A 2N2LA 1Q9FA 1QJ9A 2GE4A 1MM5A 1Q9GA 1QJ8A 2F1VA 3G7GA 3C5OA 4PUXA 2N2MA 1THQA 2M06A 4RLCA 1MM4A 2JMMA 3QRAA
chains in the Genus database with same CATH superfamily
4FESA 3RBHA 4FZLA 4RJWA 4FZMA 3AA6B 4FRTA 3KVDD 5EE2A 3LK42 2K0LA 4AKMA 4QQ1A 2F1TA 3DWNA 5AFUK 4F4BA 3TZGA 2WJRA 5G3AA 4LSFA 4XNLA 3SZVA 4E1SA 5DL8A 4O4XA 1ORMA 3LK3A 3T20A 5ADXL 2XTRA 2O4VA 3VE1A 4D5UA 3SZDA 1G90A 1MM5A 4K3BA 3G7GA 3C5OA 4JCHA 4UB8O 4D64A 3PRNA 4RL9A 5DL5A 4FZNA 1HXXA 3A2SX 2IWVA 5E79O 4AYEC 7PRNA 5JDPA 2Y7SA 2ZFGA 3UU2A 5B66O 3SYBA 3AA6A 3WI5A 2R4PA 2XE5A 1IZNB 3PORA 2W80C 3T24A 4KR4A 3HOEA 3GP6A 4N74A 6PRNA 3BRZA 5DL7A 2MNHA 5DL6A 3UPGA 3K19A 5T5FA 5TISO 5PRNA 2M07A 3SYSA 8PRNA 2K4TA 1HXUA 1BXWA 2R4NA 2XMXA 4K3CA 5GTIO 1GFQA 3BRYA 3PGSA 2XE2A 4PJ0O 4C4VB 1OPFA 4FSPA 5D5DA 2XTQA 4KRAA 1PHOA 4PR7A 3V8UA 2ZLDA 3AA7B 5G38A 4BUMX 3BS0A 3WI4A 2PRNA 1T1LA 4CTDA 2J4UP 3PGRA 1P4TA 4AFKA 2J1NA 2N2LA 2GE4A 3JCUO 4KR8A 5G26A 4AYNA 2KXPA 4IL6O 4AYMC 3AA1A 4B61A 1GFMA 3T0SA 2M06A 4GCPA 4FT6A 5ADXK 4U9CA 2R89A 1MM4A 2R8AA 4N59A 3VY8X 2OMFA 4C00A 3POXA 5B5EO 4LSIA 3DA4A 5GV0A 2YPVA 4AYDC 4XNKA 5G39A 1ZHXA 1ZHTA 3DZMA 2R4OA 4AKRB 4AUIA 2KXPB 2XE1A 4O3WA 4AZLA 1IZNA 2LHFA 4C69X 5AFUL 3UAQA 1ZHWA 2KC0A 1OSMA 3EMNX 3LK41 4FOZA 4E1TA 1PRNA 3AAEA 2YNKA 4O49A 3NSGA 4N75A 1T16A 3VY9X 1BH3A 4LSHA 4G76A 3JTYA 3VE2A 1BT9A 1YS5A 3DA3A 1H6S1 3POQA 1ZHZA 4C4VA 1GFNA 2ODJA 3A0HO 4O4UA 2F1VA 3NJTA 2W81C 4GHBA 2Y0LA 2Y2XA 5GTHO 4UB6O 3A0BO 3AA0A 2N2MA 3VZWX 2WJQA 4GF4A 3PQSA 4N58A 3POUA 1HXTA 4FSOA 2JMMA 3AA1B 3QRAA 3VZTX 2JQYA 3SY9A 2KZ7A 3PF1A 2IWWA 3KZIO 4O3XB 2KDYA 3AAEB 3VZUX 3HW9A 1ZHYA 3DWOX 3AAAA 5FVNA 1E54A 2X27X 3QRCA 4FUVA 4AKRA 3HOLA 4D65A 2XE3A 2ERVA 3LK2A 2Y0HA 3O0EA 5KAFO 4AYID 5KAIO 2AXTO 3FYXA 3SY7A 1MPFA 1QJPA 2MHLA 2R4LA 3PQUA 4FQEA 4G75A 3HWBA 4GCSA 4GCQA 1GFOA 2QTKA 2XG6A 3AA0B 1Q9FA 1QJ9A 2FGQX 1Q9GA 1QJ8A 2X9KA 4O3YA 4PUXA 3AAAB 4FRXA 3WU2O 5H2FO 4JFBA 4LSEA 4Z3TA 5IYUA 2F1CX 4RJXA 2LFUA 3PGUA 4O3ZA 2WVPA 2Y0KA 3LK2B 1GFPA 1THQA 2FGRA 1S5LO 2KZ7B 2PORA 4RLCA 3AA7A 4FMSA 2R88A 4RLBA 3LK3B
chains in the Genus database with same CATH topology
4FESA 3RBHA 4FZLA 4RJWA 4FZMA 3AA6B 4FRTA 3KVDD 5EE2A 3LK42 2K0LA 4AKMA 4QQ1A 2F1TA 5AFUK 4F4BA 3TZGA 4LSFA 4XNLA 3SZVA 4E1SA 5DL8A 4O4XA 1ORMA 3LK3A 3T20A 5ADXL 2XTRA 2O4VA 3VE1A 4D5UA 3SZDA 1G90A 1MM5A 3G7GA 3C5OA 4D64A 3PRNA 4RL9A 5DL5A 4FZNA 1HXXA 3A2SX 4AYEC 7PRNA 5JDPA 2Y7SA 2ZFGA 3UU2A 3SYBA 3AA6A 3WI5A 2XE5A 1IZNB 3PORA 2W80C 3T24A 4KR4A 3HOEA 3GP6A 6PRNA 5DL7A 2MNHA 5DL6A 3UPGA 3K19A 5T5FA 3SYSA 5PRNA 2M07A 8PRNA 2K4TA 1HXUA 1BXWA 2XMXA 1GFQA 2XE2A 1OPFA 4FSPA 5D5DA 2XTQA 4KRAA 1PHOA 3V8UA 2ZLDA 3AA7B 4BUMX 3WI4A 2PRNA 2J4UP 1P4TA 4AFKA 2J1NA 2N2LA 2GE4A 4KR8A 5G26A 4AYNA 2KXPA 4AYMC 3AA1A 4B61A 1GFMA 3T0SA 2M06A 4GCPA 4FT6A 4U9CA 1MM4A 4N59A 3VY8X 2OMFA 3POXA 4LSIA 3DA4A 5GV0A 2YPVA 4AYDC 4XNKA 1ZHXA 1ZHTA 4AKRB 4AUIA 4AZLA 2KXPB 2XE1A 4O3WA 1IZNA 2LHFA 4C69X 5AFUL 3UAQA 1ZHWA 2KC0A 1OSMA 3EMNX 3LK41 4FOZA 4E1TA 1PRNA 3AAEA 2YNKA 4O49A 3NSGA 3VY9X 1BH3A 4LSHA 4G76A 3JTYA 3VE2A 1BT9A 1YS5A 3DA3A 1H6S1 3POQA 1ZHZA 1GFNA 4O4UA 2F1VA 2W81C 4GHBA 2Y0LA 2Y2XA 3AA0A 2N2MA 3VZWX 4GF4A 3PQSA 4N58A 3POUA 1HXTA 4FSOA 2JMMA 3AA1B 3QRAA 3VZTX 3SY9A 2KZ7A 4O3XB 2KDYA 3AAEB 3VZUX 3HW9A 1ZHYA 3AAAA 5FVNA 1E54A 2X27X 3QRCA 4FUVA 4AKRA 3HOLA 4D65A 2XE3A 2ERVA 3LK2A 2Y0HA 3O0EA 4AYID 3FYXA 3SY7A 1MPFA 1QJPA 2MHLA 4G75A 3PQUA 4GCSA 4JCHA 3HWBA 4GCQA 5ADXK 1GFOA 2QTKA 2XG6A 3AA0B 1Q9FA 1QJ9A 2FGQX 1Q9GA 1QJ8A 4O3YA 4PUXA 3AAAB 4FRXA 5IYUA 4JFBA 4LSEA 4Z3TA 4RJXA 2LFUA 4O3ZA 2Y0KA 3LK2B 1GFPA 1THQA 2FGRA 2KZ7B 2PORA 4RLCA 3AA7A 4FMSA 2ODJA 4RLBA 3LK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP6 A;  2MNH A;  2K0L A;  2LHF A;  2M07 A;  2F1T A;  3QRC A;  2X27 X;  1BXW A;  2ERV A;  1ORM A;  1QJP A;  2MHL A;  1P4T A;  1G90 A;  2N2L A;  1Q9F A;  1QJ9 A;  2GE4 A;  1MM5 A;  1Q9G A;  1QJ8 A;  2F1V A;  3G7G A;  3C5O A;  4PUX A;  2N2M A;  1THQ A;  2M06 A;  4RLC A;  1MM4 A;  2JMM A;  3QRA A; 
#chains in the Genus database with same CATH topology
 4FES A;  3RBH A;  4FZL A;  4RJW A;  4FZM A;  3AA6 B;  4FRT A;  3KVD D;  5EE2 A;  3LK4 2;  2K0L A;  4AKM A;  4QQ1 A;  2F1T A;  3DWN A;  5AFU K;  4F4B A;  3TZG A;  2WJR A;  5G3A A;  4LSF A;  4XNL A;  3SZV A;  4E1S A;  5DL8 A;  4O4X A;  1ORM A;  3LK3 A;  3T20 A;  5ADX L;  2XTR A;  2O4V A;  3VE1 A;  4D5U A;  3SZD A;  1G90 A;  1MM5 A;  4K3B A;  3G7G A;  3C5O A;  4JCH A;  4UB8 O;  4D64 A;  3PRN A;  4RL9 A;  5DL5 A;  4FZN A;  1HXX A;  3A2S X;  2IWV A;  5E79 O;  4AYE C;  7PRN A;  5JDP A;  2Y7S A;  2ZFG A;  3UU2 A;  5B66 O;  3SYB A;  3AA6 A;  3WI5 A;  2R4P A;  2XE5 A;  1IZN B;  3POR A;  2W80 C;  3T24 A;  4KR4 A;  3HOE A;  3GP6 A;  4N74 A;  6PRN A;  3BRZ A;  5DL7 A;  2MNH A;  5DL6 A;  3UPG A;  3K19 A;  5T5F A;  5TIS O;  5PRN A;  2M07 A;  3SYS A;  8PRN A;  2K4T A;  1HXU A;  1BXW A;  2R4N A;  2XMX A;  4K3C A;  5GTI O;  1GFQ A;  3BRY A;  3PGS A;  2XE2 A;  4PJ0 O;  4C4V B;  1OPF A;  4FSP A;  5D5D A;  2XTQ A;  4KRA A;  1PHO A;  4PR7 A;  3V8U A;  2ZLD A;  3AA7 B;  5G38 A;  4BUM X;  3BS0 A;  3WI4 A;  2PRN A;  1T1L A;  4CTD A;  2J4U P;  3PGR A;  1P4T A;  4AFK A;  2J1N A;  2N2L A;  2GE4 A;  3JCU O;  4KR8 A;  5G26 A;  4AYN A;  2KXP A;  4IL6 O;  4AYM C;  3AA1 A;  4B61 A;  1GFM A;  3T0S A;  2M06 A;  4GCP A;  4FT6 A;  5ADX K;  4U9C A;  2R89 A;  1MM4 A;  2R8A A;  4N59 A;  3VY8 X;  2OMF A;  4C00 A;  3POX A;  5B5E O;  4LSI A;  3DA4 A;  5GV0 A;  2YPV A;  4AYD C;  4XNK A;  5G39 A;  1ZHX A;  1ZHT A;  3DZM A;  2R4O A;  4AKR B;  4AUI A;  2KXP B;  2XE1 A;  4O3W A;  4AZL A;  1IZN A;  2LHF A;  4C69 X;  5AFU L;  3UAQ A;  1ZHW A;  2KC0 A;  1OSM A;  3EMN X;  3LK4 1;  4FOZ A;  4E1T A;  1PRN A;  3AAE A;  2YNK A;  4O49 A;  3NSG A;  4N75 A;  1T16 A;  3VY9 X;  1BH3 A;  4LSH A;  4G76 A;  3JTY A;  3VE2 A;  1BT9 A;  1YS5 A;  3DA3 A;  1H6S 1;  3POQ A;  1ZHZ A;  4C4V A;  1GFN A;  2ODJ A;  3A0H O;  4O4U A;  2F1V A;  3NJT A;  2W81 C;  4GHB A;  2Y0L A;  2Y2X A;  5GTH O;  4UB6 O;  3A0B O;  3AA0 A;  2N2M A;  3VZW X;  2WJQ A;  4GF4 A;  3PQS A;  4N58 A;  3POU A;  1HXT A;  4FSO A;  2JMM A;  3AA1 B;  3QRA A;  3VZT X;  2JQY A;  3SY9 A;  2KZ7 A;  3PF1 A;  2IWW A;  3KZI O;  4O3X B;  2KDY A;  3AAE B;  3VZU X;  3HW9 A;  1ZHY A;  3DWO X;  3AAA A;  5FVN A;  1E54 A;  2X27 X;  3QRC A;  4FUV A;  4AKR A;  3HOL A;  4D65 A;  2XE3 A;  2ERV A;  3LK2 A;  2Y0H A;  3O0E A;  5KAF O;  4AYI D;  5KAI O;  2AXT O;  3FYX A;  3SY7 A;  1MPF A;  1QJP A;  2MHL A;  2R4L A;  3PQU A;  4FQE A;  4G75 A;  3HWB A;  4GCS A;  4GCQ A;  1GFO A;  2QTK A;  2XG6 A;  3AA0 B;  1Q9F A;  1QJ9 A;  2FGQ X;  1Q9G A;  1QJ8 A;  2X9K A;  4O3Y A;  4PUX A;  3AAA B;  4FRX A;  3WU2 O;  5H2F O;  4JFB A;  4LSE A;  4Z3T A;  5IYU A;  2F1C X;  4RJX A;  2LFU A;  3PGU A;  4O3Z A;  2WVP A;  2Y0K A;  3LK2 B;  1GFP A;  1THQ A;  2FGR A;  1S5L O;  2KZ7 B;  2POR A;  4RLC A;  3AA7 A;  4FMS A;  2R88 A;  4RLB A;  3LK3 B; 
#chains in the Genus database with same CATH homology
 4FES A;  3RBH A;  4FZL A;  4RJW A;  4FZM A;  3AA6 B;  4FRT A;  3KVD D;  5EE2 A;  3LK4 2;  2K0L A;  4AKM A;  4QQ1 A;  2F1T A;  5AFU K;  4F4B A;  3TZG A;  4LSF A;  4XNL A;  3SZV A;  4E1S A;  5DL8 A;  4O4X A;  1ORM A;  3LK3 A;  3T20 A;  5ADX L;  2XTR A;  2O4V A;  3VE1 A;  4D5U A;  3SZD A;  1G90 A;  1MM5 A;  3G7G A;  3C5O A;  4D64 A;  3PRN A;  4RL9 A;  5DL5 A;  4FZN A;  1HXX A;  3A2S X;  4AYE C;  7PRN A;  5JDP A;  2Y7S A;  2ZFG A;  3UU2 A;  3SYB A;  3AA6 A;  3WI5 A;  2XE5 A;  1IZN B;  3POR A;  2W80 C;  3T24 A;  4KR4 A;  3HOE A;  3GP6 A;  6PRN A;  5DL7 A;  2MNH A;  5DL6 A;  3UPG A;  3K19 A;  5T5F A;  3SYS A;  5PRN A;  2M07 A;  8PRN A;  2K4T A;  1HXU A;  1BXW A;  2XMX A;  1GFQ A;  2XE2 A;  1OPF A;  4FSP A;  5D5D A;  2XTQ A;  4KRA A;  1PHO A;  3V8U A;  2ZLD A;  3AA7 B;  4BUM X;  3WI4 A;  2PRN A;  2J4U P;  1P4T A;  4AFK A;  2J1N A;  2N2L A;  2GE4 A;  4KR8 A;  5G26 A;  4AYN A;  2KXP A;  4AYM C;  3AA1 A;  4B61 A;  1GFM A;  3T0S A;  2M06 A;  4GCP A;  4FT6 A;  4U9C A;  1MM4 A;  4N59 A;  3VY8 X;  2OMF A;  3POX A;  4LSI A;  3DA4 A;  5GV0 A;  2YPV A;  4AYD C;  4XNK A;  1ZHX A;  1ZHT A;  4AKR B;  4AUI A;  4AZL A;  2KXP B;  2XE1 A;  4O3W A;  1IZN A;  2LHF A;  4C69 X;  5AFU L;  3UAQ A;  1ZHW A;  2KC0 A;  1OSM A;  3EMN X;  3LK4 1;  4FOZ A;  4E1T A;  1PRN A;  3AAE A;  2YNK A;  4O49 A;  3NSG A;  3VY9 X;  1BH3 A;  4LSH A;  4G76 A;  3JTY A;  3VE2 A;  1BT9 A;  1YS5 A;  3DA3 A;  1H6S 1;  3POQ A;  1ZHZ A;  1GFN A;  4O4U A;  2F1V A;  2W81 C;  4GHB A;  2Y0L A;  2Y2X A;  3AA0 A;  2N2M A;  3VZW X;  4GF4 A;  3PQS A;  4N58 A;  3POU A;  1HXT A;  4FSO A;  2JMM A;  3AA1 B;  3QRA A;  3VZT X;  3SY9 A;  2KZ7 A;  4O3X B;  2KDY A;  3AAE B;  3VZU X;  3HW9 A;  1ZHY A;  3AAA A;  5FVN A;  1E54 A;  2X27 X;  3QRC A;  4FUV A;  4AKR A;  3HOL A;  4D65 A;  2XE3 A;  2ERV A;  3LK2 A;  2Y0H A;  3O0E A;  4AYI D;  3FYX A;  3SY7 A;  1MPF A;  1QJP A;  2MHL A;  4G75 A;  3PQU A;  4GCS A;  4JCH A;  3HWB A;  4GCQ A;  5ADX K;  1GFO A;  2QTK A;  2XG6 A;  3AA0 B;  1Q9F A;  1QJ9 A;  2FGQ X;  1Q9G A;  1QJ8 A;  4O3Y A;  4PUX A;  3AAA B;  4FRX A;  5IYU A;  4JFB A;  4LSE A;  4Z3T A;  4RJX A;  2LFU A;  4O3Z A;  2Y0K A;  3LK2 B;  1GFP A;  1THQ A;  2FGR A;  2KZ7 B;  2POR A;  4RLC A;  3AA7 A;  4FMS A;  2ODJ A;  4RLB A;  3LK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...