2LHFA

Solution structure of outer membrane protein h (oprh) from p. aeruginosa in dhpc micelles
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
178
structure length
178
Chain Sequence
b'ADNFVGLTWGETSNNIQKSKSLNRNLNSPNLDKVIDNTGTWGIRAGQQFEQGRYYATYENISDTSSGNKLRQQNLLGSYDAFLPIGDNNTKLFGGATLGLVKLEQDGKGFKRDSDVGYAAGLQAGILQELSKNASIEGGYRYLRTNASTEMTPHGGNKLGSLDLHSSSQFYLGANYKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein H1
publication title Structural Basis for the Interaction of Lipopolysaccharide with Outer Membrane Protein H (OprH) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 20
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2lhfA00
3QRAA 2ERVA 2M06A 2N2MA 1Q9FA 2F1VA 4RLCA 4PUXA 3C5OA 3GP6A 1ORMA 1P4TA 2JMMA 1MM5A 1QJ8A 2MHLA 1QJ9A 1BXWA 1Q9GA 1G90A 3QRCA 3G7GA 1MM4A 2X27X 2F1TA 2LHFA 2K0LA 2M07A 2MNHA 2N2LA 1QJPA 2GE4A 1THQA
chains in the Genus database with same CATH superfamily
3LK41 2N2MA 1PRNA 3LK2A 1Q9FA 1ZHZA 2KDYA 3A0HO 3QRAA 2FGRA 2Y7SA 4FZLA 4JCHA 1BT9A 5FVNA 2KXPA 3VZUX 4LSFA 4E1TA 3LK3A 1MM5A 4K3BA 4O4XA 2YPVA 4AKRB 3LK42 2R4OA 4GHBA 1IZNA 4FSPA 3WI4A 2LFUA 4LSEA 5KAFO 1QJ9A 2KC0A 5JDPA 1GFPA 1HXTA 3PQSA 4FESA 4C69X 3NSGA 3EMNX 3LK2B 4AKMA 4KRAA 2F1CX 3G7GA 4C00A 5B5EO 5ADXK 3POUA 3UAQA 4FMSA 3DZMA 4N74A 6PRNA 4UB6O 4BUMX 4AKRA 3DA3A 3HOEA 1HXXA 1QJPA 3K19A 2X9KA 3HW9A 4C4VB 4D65A 3VZTX 4JFBA 2IWWA 3VY8X 2ERVA 4O3ZA 2R4PA 2XE3A 3PF1A 2F1VA 3PORA 4G76A 4LSHA 3BRYA 4O4UA 2XMXA 3TZGA 2QTKA 3GP6A 5D5DA 1ORMA 2R89A 1P4TA 3FYXA 2ODJA 3WU2O 4D5UA 2MHLA 4XNLA 4C4VA 4GCSA 3A2SX 4AYNA 1Q9GA 1BH3A 3AA6B 4PR7A 4GCQA 2Y0LA 5H2FO 3PGRA 3QRCA 5DL7A 3SYBA 1MM4A 3UPGA 2WJRA 2MNHA 5AFUK 4O3YA 2K4TA 4RLBA 1E54A 3A0BO 4G75A 2IWVA 1S5LO 3PRNA 5TISO 4IL6O 4AFKA 2J4UP 2ZLDA 3DWNA 1GFQA 1ZHTA 3AA6A 4N75A 4PJ0O 4QQ1A 2WJQA 3BS0A 4O3WA 4PUXA 5G38A 4RL9A 4K3CA 1T1LA 4GCPA 3AAAB 3UU2A 3VE2A 2JMMA 3NJTA 1ZHWA 2R4NA 4O3XB 4FRTA 2XE2A 4AYMC 2OMFA 4FUVA 5ADXL 3PGSA 5G39A 8PRNA 1BXWA 3AA0A 5T5FA 3VY9X 4AYDC 4GF4A 4RJWA 2JQYA 2XTQA 4N59A 5G3AA 3KVDD 3V8UA 1G90A 5B66O 1GFOA 3JTYA 1HXUA 3DWOX 2Y0HA 5DL8A 2R4LA 3PGUA 1T16A 3SYSA 2F1TA 3AAEA 1GFMA 4E1SA 2LHFA 2K0LA 3AAAA 2KZ7B 3VZWX 2WVPA 2XE1A 2YNKA 4FT6A 4KR8A 4N58A 4O49A 4B61A 3WI5A 3AA7B 3AA1B 4F4BA 5G26A 2PORA 5DL5A 5GTHO 1THQA 4RJXA 5DL6A 5KAIO 2FGQX 1ZHXA 2M06A 3DA4A 4FRXA 3AA0B 4CTDA 1YS5A 5PRNA 4RLCA 2W80C 3SZVA 2XTRA 2ZFGA 3HOLA 3PQUA 5EE2A 3T0SA 4AZLA 3C5OA 2KZ7A 2PRNA 1MPFA 3VE1A 2Y0KA 3AAEB 3SZDA 3SY9A 4AYEC 1QJ8A 1ZHYA 3AA7A 4Z3TA 3AA1A 7PRNA 2AXTO 2R88A 3JCUO 4FQEA 4FSOA 4XNKA 2W81C 3T24A 1H6S1 5IYUA 3T20A 4D64A 4AYID 5AFUL 2J1NA 1PHOA 5GTIO 5GV0A 4KR4A 1OPFA 4U9CA 2XG6A 4FZMA 1GFNA 2R8AA 2X27X 3POQA 2Y2XA 2XE5A 2M07A 2KXPB 4AUIA 3HWBA 3KZIO 3BRZA 2N2LA 3LK3B 3O0EA 3POXA 4FOZA 4UB8O 5E79O 2GE4A 4FZNA 3RBHA 4LSIA 1OSMA 1IZNB 2O4VA 3SY7A
chains in the Genus database with same CATH topology
3LK41 2N2MA 1PRNA 3LK2A 1Q9FA 1ZHZA 2KDYA 3QRAA 3UAQA 2FGRA 2Y7SA 4FZLA 4JCHA 1BT9A 5FVNA 2KXPA 3VZUX 4LSFA 4E1TA 3LK3A 1MM5A 4O4XA 2YPVA 4AKRB 3LK42 4GHBA 3WI4A 1IZNA 4FSPA 2LFUA 4LSEA 1QJ9A 2KC0A 5JDPA 1GFPA 1HXTA 3PQSA 4FESA 4C69X 3NSGA 3EMNX 3LK2B 4AKMA 4KRAA 3G7GA 5ADXK 3POUA 4FMSA 6PRNA 4BUMX 4AKRA 3DA3A 3HOEA 1HXXA 1QJPA 3K19A 3HW9A 4D65A 3VZTX 4JFBA 3VY8X 2ERVA 4O3ZA 2XE3A 2F1VA 3PORA 4G76A 4LSHA 4O4UA 2XMXA 3TZGA 2QTKA 3GP6A 5D5DA 1ORMA 1P4TA 3FYXA 2ODJA 4D5UA 2MHLA 4XNLA 4GCSA 3A2SX 4AYNA 1Q9GA 1BH3A 3AA6B 4GCQA 2Y0LA 3QRCA 5DL7A 3SYBA 1MM4A 3UPGA 2MNHA 5AFUK 4O3YA 2K4TA 4RLBA 1E54A 4G75A 3PRNA 4AFKA 2J4UP 2ZLDA 1GFQA 1ZHTA 3AA6A 4QQ1A 4O3WA 4PUXA 4RL9A 4GCPA 3AAAB 3UU2A 3VE2A 2JMMA 1ZHWA 4O3XB 4FRTA 2XE2A 4AYMC 2OMFA 4FUVA 5ADXL 8PRNA 1BXWA 3AA0A 5T5FA 3VY9X 4AYDC 4GF4A 4RJWA 4N59A 2XTQA 3V8UA 3KVDD 1G90A 1GFOA 3JTYA 1HXUA 2Y0HA 5DL8A 3SYSA 4E1SA 2F1TA 3AAEA 1GFMA 2LHFA 2K0LA 3AAAA 2KZ7B 3VZWX 2XE1A 4O49A 2YNKA 4FT6A 4KR8A 4N58A 4B61A 3WI5A 3AA7B 3AA1B 4F4BA 5G26A 2PORA 5DL5A 1THQA 4RJXA 5DL6A 2FGQX 1ZHXA 2M06A 3DA4A 4FRXA 3AA0B 1YS5A 5PRNA 4RLCA 2W80C 3SZVA 2XTRA 2ZFGA 3HOLA 3PQUA 5EE2A 3T0SA 4AZLA 3C5OA 2KZ7A 2PRNA 1MPFA 3VE1A 2Y0KA 3AAEB 3SZDA 3SY9A 4AYEC 1QJ8A 1ZHYA 3AA7A 4Z3TA 3AA1A 7PRNA 4XNKA 4FSOA 3T24A 2W81C 5IYUA 1H6S1 3T20A 4D64A 4AYID 5AFUL 2J1NA 1PHOA 5GV0A 4KR4A 1OPFA 4U9CA 2XG6A 4FZMA 1GFNA 2X27X 3POQA 2Y2XA 2XE5A 2M07A 2KXPB 4AUIA 3HWBA 3O0EA 3POXA 2N2LA 3LK3B 4FOZA 3RBHA 2GE4A 4FZNA 4LSIA 1OSMA 1IZNB 2O4VA 3SY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRA A;  2ERV A;  2M06 A;  2N2M A;  1Q9F A;  2F1V A;  4RLC A;  4PUX A;  3C5O A;  3GP6 A;  1ORM A;  1P4T A;  2JMM A;  1MM5 A;  1QJ8 A;  2MHL A;  1QJ9 A;  1BXW A;  1Q9G A;  1G90 A;  3QRC A;  3G7G A;  1MM4 A;  2X27 X;  2F1T A;  2LHF A;  2K0L A;  2M07 A;  2MNH A;  2N2L A;  1QJP A;  2GE4 A;  1THQ A; 
#chains in the Genus database with same CATH topology
 3LK4 1;  2N2M A;  1PRN A;  3LK2 A;  1Q9F A;  1ZHZ A;  2KDY A;  3A0H O;  3QRA A;  2FGR A;  2Y7S A;  4FZL A;  4JCH A;  1BT9 A;  5FVN A;  2KXP A;  3VZU X;  4LSF A;  4E1T A;  3LK3 A;  1MM5 A;  4K3B A;  4O4X A;  2YPV A;  4AKR B;  3LK4 2;  2R4O A;  4GHB A;  1IZN A;  4FSP A;  3WI4 A;  2LFU A;  4LSE A;  5KAF O;  1QJ9 A;  2KC0 A;  5JDP A;  1GFP A;  1HXT A;  3PQS A;  4FES A;  4C69 X;  3NSG A;  3EMN X;  3LK2 B;  4AKM A;  4KRA A;  2F1C X;  3G7G A;  4C00 A;  5B5E O;  5ADX K;  3POU A;  3UAQ A;  4FMS A;  3DZM A;  4N74 A;  6PRN A;  4UB6 O;  4BUM X;  4AKR A;  3DA3 A;  3HOE A;  1HXX A;  1QJP A;  3K19 A;  2X9K A;  3HW9 A;  4C4V B;  4D65 A;  3VZT X;  4JFB A;  2IWW A;  3VY8 X;  2ERV A;  4O3Z A;  2R4P A;  2XE3 A;  3PF1 A;  2F1V A;  3POR A;  4G76 A;  4LSH A;  3BRY A;  4O4U A;  2XMX A;  3TZG A;  2QTK A;  3GP6 A;  5D5D A;  1ORM A;  2R89 A;  1P4T A;  3FYX A;  2ODJ A;  3WU2 O;  4D5U A;  2MHL A;  4XNL A;  4C4V A;  4GCS A;  3A2S X;  4AYN A;  1Q9G A;  1BH3 A;  3AA6 B;  4PR7 A;  4GCQ A;  2Y0L A;  5H2F O;  3PGR A;  3QRC A;  5DL7 A;  3SYB A;  1MM4 A;  3UPG A;  2WJR A;  2MNH A;  5AFU K;  4O3Y A;  2K4T A;  4RLB A;  1E54 A;  3A0B O;  4G75 A;  2IWV A;  1S5L O;  3PRN A;  5TIS O;  4IL6 O;  4AFK A;  2J4U P;  2ZLD A;  3DWN A;  1GFQ A;  1ZHT A;  3AA6 A;  4N75 A;  4PJ0 O;  4QQ1 A;  2WJQ A;  3BS0 A;  4O3W A;  4PUX A;  5G38 A;  4RL9 A;  4K3C A;  1T1L A;  4GCP A;  3AAA B;  3UU2 A;  3VE2 A;  2JMM A;  3NJT A;  1ZHW A;  2R4N A;  4O3X B;  4FRT A;  2XE2 A;  4AYM C;  2OMF A;  4FUV A;  5ADX L;  3PGS A;  5G39 A;  8PRN A;  1BXW A;  3AA0 A;  5T5F A;  3VY9 X;  4AYD C;  4GF4 A;  4RJW A;  2JQY A;  2XTQ A;  4N59 A;  5G3A A;  3KVD D;  3V8U A;  1G90 A;  5B66 O;  1GFO A;  3JTY A;  1HXU A;  3DWO X;  2Y0H A;  5DL8 A;  2R4L A;  3PGU A;  1T16 A;  3SYS A;  2F1T A;  3AAE A;  1GFM A;  4E1S A;  2LHF A;  2K0L A;  3AAA A;  2KZ7 B;  3VZW X;  2WVP A;  2XE1 A;  2YNK A;  4FT6 A;  4KR8 A;  4N58 A;  4O49 A;  4B61 A;  3WI5 A;  3AA7 B;  3AA1 B;  4F4B A;  5G26 A;  2POR A;  5DL5 A;  5GTH O;  1THQ A;  4RJX A;  5DL6 A;  5KAI O;  2FGQ X;  1ZHX A;  2M06 A;  3DA4 A;  4FRX A;  3AA0 B;  4CTD A;  1YS5 A;  5PRN A;  4RLC A;  2W80 C;  3SZV A;  2XTR A;  2ZFG A;  3HOL A;  3PQU A;  5EE2 A;  3T0S A;  4AZL A;  3C5O A;  2KZ7 A;  2PRN A;  1MPF A;  3VE1 A;  2Y0K A;  3AAE B;  3SZD A;  3SY9 A;  4AYE C;  1QJ8 A;  1ZHY A;  3AA7 A;  4Z3T A;  3AA1 A;  7PRN A;  2AXT O;  2R88 A;  3JCU O;  4FQE A;  4FSO A;  4XNK A;  2W81 C;  3T24 A;  1H6S 1;  5IYU A;  3T20 A;  4D64 A;  4AYI D;  5AFU L;  2J1N A;  1PHO A;  5GTI O;  5GV0 A;  4KR4 A;  1OPF A;  4U9C A;  2XG6 A;  4FZM A;  1GFN A;  2R8A A;  2X27 X;  3POQ A;  2Y2X A;  2XE5 A;  2M07 A;  2KXP B;  4AUI A;  3HWB A;  3KZI O;  3BRZ A;  2N2L A;  3LK3 B;  3O0E A;  3POX A;  4FOZ A;  4UB8 O;  5E79 O;  2GE4 A;  4FZN A;  3RBH A;  4LSI A;  1OSM A;  1IZN B;  2O4V A;  3SY7 A; 
#chains in the Genus database with same CATH homology
 3LK4 1;  2N2M A;  1PRN A;  3LK2 A;  1Q9F A;  1ZHZ A;  2KDY A;  3QRA A;  3UAQ A;  2FGR A;  2Y7S A;  4FZL A;  4JCH A;  1BT9 A;  5FVN A;  2KXP A;  3VZU X;  4LSF A;  4E1T A;  3LK3 A;  1MM5 A;  4O4X A;  2YPV A;  4AKR B;  3LK4 2;  4GHB A;  3WI4 A;  1IZN A;  4FSP A;  2LFU A;  4LSE A;  1QJ9 A;  2KC0 A;  5JDP A;  1GFP A;  1HXT A;  3PQS A;  4FES A;  4C69 X;  3NSG A;  3EMN X;  3LK2 B;  4AKM A;  4KRA A;  3G7G A;  5ADX K;  3POU A;  4FMS A;  6PRN A;  4BUM X;  4AKR A;  3DA3 A;  3HOE A;  1HXX A;  1QJP A;  3K19 A;  3HW9 A;  4D65 A;  3VZT X;  4JFB A;  3VY8 X;  2ERV A;  4O3Z A;  2XE3 A;  2F1V A;  3POR A;  4G76 A;  4LSH A;  4O4U A;  2XMX A;  3TZG A;  2QTK A;  3GP6 A;  5D5D A;  1ORM A;  1P4T A;  3FYX A;  2ODJ A;  4D5U A;  2MHL A;  4XNL A;  4GCS A;  3A2S X;  4AYN A;  1Q9G A;  1BH3 A;  3AA6 B;  4GCQ A;  2Y0L A;  3QRC A;  5DL7 A;  3SYB A;  1MM4 A;  3UPG A;  2MNH A;  5AFU K;  4O3Y A;  2K4T A;  4RLB A;  1E54 A;  4G75 A;  3PRN A;  4AFK A;  2J4U P;  2ZLD A;  1GFQ A;  1ZHT A;  3AA6 A;  4QQ1 A;  4O3W A;  4PUX A;  4RL9 A;  4GCP A;  3AAA B;  3UU2 A;  3VE2 A;  2JMM A;  1ZHW A;  4O3X B;  4FRT A;  2XE2 A;  4AYM C;  2OMF A;  4FUV A;  5ADX L;  8PRN A;  1BXW A;  3AA0 A;  5T5F A;  3VY9 X;  4AYD C;  4GF4 A;  4RJW A;  4N59 A;  2XTQ A;  3V8U A;  3KVD D;  1G90 A;  1GFO A;  3JTY A;  1HXU A;  2Y0H A;  5DL8 A;  3SYS A;  4E1S A;  2F1T A;  3AAE A;  1GFM A;  2LHF A;  2K0L A;  3AAA A;  2KZ7 B;  3VZW X;  2XE1 A;  4O49 A;  2YNK A;  4FT6 A;  4KR8 A;  4N58 A;  4B61 A;  3WI5 A;  3AA7 B;  3AA1 B;  4F4B A;  5G26 A;  2POR A;  5DL5 A;  1THQ A;  4RJX A;  5DL6 A;  2FGQ X;  1ZHX A;  2M06 A;  3DA4 A;  4FRX A;  3AA0 B;  1YS5 A;  5PRN A;  4RLC A;  2W80 C;  3SZV A;  2XTR A;  2ZFG A;  3HOL A;  3PQU A;  5EE2 A;  3T0S A;  4AZL A;  3C5O A;  2KZ7 A;  2PRN A;  1MPF A;  3VE1 A;  2Y0K A;  3AAE B;  3SZD A;  3SY9 A;  4AYE C;  1QJ8 A;  1ZHY A;  3AA7 A;  4Z3T A;  3AA1 A;  7PRN A;  4XNK A;  4FSO A;  3T24 A;  2W81 C;  5IYU A;  1H6S 1;  3T20 A;  4D64 A;  4AYI D;  5AFU L;  2J1N A;  1PHO A;  5GV0 A;  4KR4 A;  1OPF A;  4U9C A;  2XG6 A;  4FZM A;  1GFN A;  2X27 X;  3POQ A;  2Y2X A;  2XE5 A;  2M07 A;  2KXP B;  4AUI A;  3HWB A;  3O0E A;  3POX A;  2N2L A;  3LK3 B;  4FOZ A;  3RBH A;  2GE4 A;  4FZN A;  4LSI A;  1OSM A;  1IZN B;  2O4V A;  3SY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...