2LHIA

Solution structure of ca2+/cna1 peptide-bound ycam
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
GSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSKGSSTGTRRKALRNKILAIAKVSRMFSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Serine/threonine-protein phosphatase 2B catalyti
publication title Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, synthetic, saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 41
structure length 176
sequence length 176
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhiA00
1XK4A 1RECA 1PSRA 3DVJA 4OCIA 2SCPA 3D10A 3VRPA 3NSOA 1MHOA 2KOTA 4N5XA 2M49B 2OS8C 3LCPC 5DKQA 2K2FA 5HKZA 2MBXA 1S6JA 1IGVA 2JRFA 2B1UA 1YRUB 1ODBA 3SG4A 1BU3A 1QTXA 1J7RA 1RTP1 1WDCB 3PN7C 1BF5A 1ALWA 3EK4A 3ICBA 4OR9B 1WRKA 1UHHA 4WQ3A 1WLMA 2BL0B 1JF2A 1TCOB 1NYAA 1M31A 1QATA 4BY4A 1ZMZA 3A8RA 1OE9B 3IF7A 1DF0B 1NX2A 1CFPA 1IG5A 1J1EA 1JBAA 1NCXA 1XFXO 1CDNA 1XFZO 4MBEA 1C7VA 3DVKA 1OZSA 3PALA 1ZACA 1QV0A 1B8RA 2A4JA 2KNEA 3SG5A 4R1EA 2GV5A 1G8IA 2LP3A 5K89A 5I2QA 1UHJA 1M45A 1Y0VH 2AMIA 1F54A 1GJYA 1S3PA 4OKHA 4WQ2A 1G33A 2K0JA 2MLFC 3I5FC 4M2OA 4YGCB 3SG3A 2L51A 2CCMA 3H4SE 1BMOA 3SIBA 3VRRA 4AQJA 2BCXA 5B8IB 3EKHA 2VRGA 1TTXA 3GOFA 2L4HA 3PSRA 1K9PA 3CWGA 1SR6C 1U5IB 1OMVA 3EK7A 3GK2A 1SBJA 3AKAA 1N0YA 5AEQA 3PFVA 1SL8A 1H4BA 3SG6A 3I5HC 1DMOA 1F4QA 1OSAA 1CFDA 1WY9A 3KF9A 3OB2B 3RLZA 2JPTA 4A4BA 2ZN9A 3VROA 1MXEA 1K96A 3DD4A 2HQWA 4GUKA 2BCAA 1BJFA 2LLTA 5BPJA 1KWOB 2EGDA 1KFXL 1K8UA 2F3ZA 1LVCD 2BBMA 1UUSA 4PHNA 3A4UB 1K9KA 5PALA 2NCPA 1QX5B 2AAOA 5KU1A 1BODA 1KCYA 5D69A 3I5GC 1JFJA 1CLMA 2KI4B 2RGIA 3NSIA 2CBLA 1SCMB 1CDLA 1L2OC 4QJ4B 1V1GA 1NCZA 3AKBA 1QIVA 2BBNA 1J7PA 4NDCA 1JWDA 2L98A 2JU0A 4PHKA 3RM1A 1B4CA 1FPWA 1B7TY 2JQ6A 2KGRA 2OTGB 3BUXB 3QRXA 1CFFA 2BE4A 3JTDB 4PE7A 1CLBA 2PALA 4MN0A 2M9GA 2F2OA 1YURA 3BUNB 4JPZB 1S1EA 4GGFA 4AQIA 4F0ZB 3CTNA 1AUIB 2ISDA 3FIAA 1TNPA 1DJHA 1YRTB 3TZ1A 5HKYA 1PALA 1DT7B 1SL9A 1TN4A 1K90D 3JVTC 4N1FA 1CLLA 3NSLA 2PSRA 2I18A 2QACA 4N1GA 2LANA 4ICBA 2ZRSA 4L9MA 3O4YA 4ZCVA 1JF0A 4YI8A 2GGZA 2ZNEA 4ORAB 4MEWA 1G4YR 2JT8A 1IKUA 5ER4X 1TCFA 2JZIA 4ETOA 2ZKMX 2CNPA 1KFXS 2WCBA 3TS5B 1KK8C 1JFKA 2CTNA 4FTGA 1Y1AA 1XFWO 2KDHA 2WOSA 4GAOA 1MF8B 1PVBA 2M7NA 1UHIA 3CR4X 5AFPA 1QS7A 2COLB 4I5LB 3M0WA 4OV2A 2M1KB 1LINA 2V53A 1A29A 1A75A 4MSPA 3TDUA 4MVFA 1CFCA 1KK7Z 2K61A 3TDIA 2LUXA 3CR5X 4HSZA 3I5IB 3MSEB 1NUBA 2G2BA 4HRGA 2F3YA 1SY9A 1NCYA 2LNKA 2Y1MA 1X02A 2LVKA 3EK8A 3SG2A 1AVSA 2P6BB 1NP8A 1J7QA 2FOTA 2Y5IA 1XA5A 3OP0A 1L7ZA 2KAYA 1QX7A 2CXJA 1NSHA 1SL7A 4CIDA 4FQOA 4XYNA 2LP2A 2M8UA 2IS9A 1IQ3A 1S5GY 3NXAA 2H2KA 4P2YB 2NZ0A 3F45A 5HKWA 4UPGA 2MAZA 5I8NA 1PVAA 2KBIA 1SPYA 3WNXB 1BT6A 1LKJA 1K2HA 2I94A 1XO5A 2H61C 1JUOA 1S6IA 5F6TA 4C0JA 1BLQA 1OQPA 2LLSA 2KSPA 1QLKA 4YGDB 2KFGA 3O78A 4CFQA 3BUOB 2BKHB 2K7OA 1UWOA 4GNKB 1F55A 1K9UA 1AJ5A 1RFJA 1KSOA 2OPOA 1R2UA 3BUMB 4MRYA 4A4CA 3WHTB 4ORBB 2JTZA 1CMFA 4YI9A 5J3XA 3DF0A 4M2PA 1RK9A 1F71A 4PHMA 1B8CA 1N65A 1TRFA 1YTZC 2WNDA 4NDBA 4YBHB 4YGEB 1S36A 1JSAA 1CM4A 3LL8B 2LVIA 4BY5A 5DKNA 1NWDA 2K7DA 1XFUO 3HX4A 4YGBB 1QIWA 1QJTA 5JJGA 4U8DA 1Y1XA 2L0PA 3LLEA 4CFRA 1K93D 2JT0A 1DVIA 1TOPA 1SRAA 3O6BA 3AAJA 1CB1A 1WDCC 3D0YA 3EVUA 4C0LA 2ZFDA 1KQVA 2E30A 1H8BA 4MZJA 1DTLA 4XJKA 1WRLA 1UURA 2BL0C 1QASA 1BR1B 4I5NB 1DJGA 1EXRA 5CSFA 1DGUA 5I2LA 3IQQA 2K2AA 1V1FA 5FYXA 3SIAA 1CTRA 1S26D 4CPVA 1UHNA 1J1DA 1OZOA 1KQMB 2MRDA 4GPLB 4MZKA 2LVVA 1A4PA 3DF0B 2HQ8A 4QJ3B 3CR2A 2KQYA 1FI6A 1XYDA 2EC6B 3TUYB 3EVRA 1KFUL 2E6WA 2CT9A 2LMUA 4DUQA 2NLNA 1EH2A 3GK1A 5CPVA 4PE0A 1XK4C 1SNLA 2M7LA 2OS8B 2KQ6A 1MWNA 4WRIA 2KI6D 1SCVA 1FI5A 3EKJA 1QVIY 1SYMA 2JTTA 2F33A 1WRZA 1YUTA 1TNXA 2JNXA 4E68A 3PN7B 2Q4UA 2HPSA 3D0YB 4I5JA 3VRQA 1NIWA 2AUCA 1J7OA 1BOCA 1S6CA 4XJKB 2WORA 4D1EA 2MJWB 4I5KA 2LCPA 1EL4A 5GQQC 2LE9B 2WC8A 2O60A 2QPTA 1RROA 1ZOTB 1YVLA 3SJSA 4YRUA 5JOLA 1AP4A 2LAPA 4PALA 1NX3A 1AJ4A 1K95A 3BUWB 1QXPA 1PRWA 1F4OA 2TN4A 1CMGA 2EHBA 1R6PA 1HQVA 3FS7A 4C0KA 2M0RA 1B7TZ 1KSMA 1KWOC 2HF5A 2Q91A 3FWCA 2K7BA 2MA2A 5DKRA 4NDDA 2Y4QA 3PATA 2I2RE 2G9BA 2LMVA 3IQOA 2LC5A 3LK0A 1TIZA 1AK8A 2L4IA 5G08A 1KFUS 1SW8A 4Q04A 2KI4C 3I5FB 1IJ5A 1SCMC 3KHEA 3BOWA 1QVIZ 2I7AA 1PK0D 3FWBA 2PVBA 2ZRTA 3BXKA 1FW4A 2OTGC 1LXFC 2ZNDA 3JTDC 4TNCA 1A03A 2K8MB 2BECA 5AXIA 1CM1A 1SR6B 4PHJA 4PE4A 1M46A 1TNQA 1CDPA 2O5GA 4DRWA 2F8PA 2Y1NA 2JXCA 2FCDA 3I5HB 1IQ5A 1VRKA 4DS7A 1FBVA 1F70A 3NSKA 5CSNA 2M3WA 4PE1A 1GGWA 2D8NA 3KPXA 2KAVA 3OHMB 2LMTA 1YX7A 2KYFA 5CSJA 1EJ3A 1U5IA 1M39A 1NX1A 2JT3A 2KI6C 4GGNA 2FCEA 1A75B 5ER5A 1IWQA 1OMRA 2BCBA 2PMYA 2DOQA 4PCWA 2LHLA 1MR8A 3I5GB 1W7JB 5D7FA 2JNFA 3TS5C 2GGMA 4DCKA 1IH0A 1IRJA 2LVJA 1B9AA 1L2OB 4NQGA 1OOJA 1QV1A 3E3RA 3VGOA 2KHNA 4GBAA 1Q80A 3BOWB 5HLOA 2JOJA 1ZFSA 1F8HA 3DVEA 1DJIA 1B47A 1SMGA 2LLUA 2KYCA 3I5IC 2BKIB 4GGFC 1ALVA 1B8LA 1S5GZ 1CDMA 2BE6A 2M1UA 3VRNA 1E8AA 4DIRA 3AAKA 3PM8A 4GFTA 2MHHA 5KSZA 2K7CA 1W7IB 1UHKA 2LM5A 3JVTB 1YVHA 3C1VA 3OX6A 4CLNA 1YUSA 1CKKA 2L5XB 1GGZA 1DGVA 1D1OA 1PSBA 2LUCA 1CNPA 1AHRA 2LHIA 3O2PA 5AANA 1EG3A 1BR4B 1UP5A 1QLSA 2R2IA 2NCOA 1Y6WA 2M97A 1KK8B 2WCEA 2H61A 2JWWA 2PASA 3CGAA 1NPQA 5CSIA 4JWQA 3CZTX 1OMDA 3DVMA 3CS1A 4ZCUA 3GK4X 4IL1A 2MLEC 1C07A 4HRHA 3TDZA 2KAXA 3OB1B 1RWYA 4MZLA 1XFYO 3ZNIA 1SK6D 1TNWA 4AOMA 4PDZA 3K21A 4ORCB 3HCMA 1GQMA 1RJVA 3WXAA 1HT9A 4MRXA 3KO0A 2JULA 3BQ3A 2L50A 2JC2A 2ZN8A 4MLWA 3WHUB 1KK7Y 1M63B 1MQ1A 5TNCA 1A2XA 2M29A 1QX2A 1ZUZA 1XVJA 1JC2A 2L2EA 1BG1A 4YGAA 3LK1A 5HLVA 1NX0A 3EVVA 5KTYA 2WCFA 2LV7A 1MXLC 1SKTA 3CLNA 1MUXA 2KFHA 2SASA 2KFFA 1PULA 1EG4A 1K94A 1LA0A 4P5OE 3SG7A 1DF0A 5HYDA 1IJ6A 4OVNF 1B1GA 1YUUA 3PLFB 3ZWHA 1J55A 5IBWA 4QJ5B 1YR5A 3BYAA 1FF1A 1DJWA 1DJZA 2JXLA 2NXQA 5AERA 2FJUB 2KBMA 4USLA 1KQMC 2F2PA 1DJYA 1YX8A 1DJXA 2HETA 2PRUA 1WLZA 1LA3A 2KGBC 4M2QA 2EC6C 5I2OA 4JQ0D 3OX5A 3TUYC 1XFVO 3KEVA 4HREE 1Y1UA 1C7WA 1N2DA
chains in the Genus database with same CATH superfamily
1XK4A 1RECA 1PSRA 3DVJA 4OCIA 2SCPA 3D10A 3VRPA 3NSOA 2BNXA 1MHOA 2KOTA 4N5XA 2M49B 2OS8C 3LCPC 5DKQA 2K2FA 5HKZA 2MBXA 1S6JA 2WCLA 1IGVA 2JRFA 2B1UA 1YRUB 1ODBA 3SG4A 1BU3A 1QTXA 1J7RA 3VB1A 1RTP1 1WDCB 3PN7C 1BF5A 1ALWA 3EK4A 3ICBA 4OR9B 3OGNA 1WRKA 1UHHA 4WQ3A 1WLMA 2ERBA 2BL0B 1JF2A 1TCOB 1NYAA 1C3ZA 1M31A 1QATA 1ZMZA 3A8RA 4BY4A 1GM0A 1OE9B 3IF7A 2KLEA 1DF0B 4INXA 1NX2A 1CFPA 1IG5A 3FE8A 3S0FA 1J1EA 2BAPA 1JBAA 1NCXA 1XFXO 3CABA 1CDNA 1XFZO 4MBEA 1C7VA 3DVKA 1OZSA 3S0EA 3PALA 1ZACA 1QV0A 1B8RA 2A4JA 2KNEA 3SG5A 4R1EA 2GV5A 1G8IA 2LP3A 5K89A 5I2QA 1UHJA 1M45A 1Y0VH 2AMIA 1F54A 1GJYA 1S3PA 3NGVA 4OKHA 4WQ2A 1G33A 2K0JA 2MLFC 3I5FC 3NHIA 4M2OA 4YGCB 3SG3A 2L51A 2CCMA 3H4SE 1SSEB 1BMOA 3SIBA 3SS3A 3VRRA 4AQJA 2BCXA 5B8IB 3EKHA 2VRGA 1TTXA 3GOFA 2L4HA 3PSRA 1K9PA 3CWGA 1SR6C 1U5IB 1OMVA 3EK7A 3GK2A 1SBJA 3AKAA 1N0YA 5AEQA 5FI2A 3PFVA 1SL8A 4IJ7A 3SG6A 2WC6A 1H4BA 3I5HC 1DMOA 1F4QA 1OSAA 1CFDA 1WY9A 1DC1A 3KF9A 3OB2B 3RLZA 2JPTA 4A4BA 2ZN9A 3D77A 3VROA 1MXEA 1K96A 3DD4A 2HQWA 4GUKA 2BCAA 1BJFA 2LLTA 5BPJA 1KWOB 1OOIX 2EGDA 1KFXL 1K8UA 2F3ZA 1LVCD 2BBMA 1UUSA 4PHNA 3A4UB 1K9KA 5PALA 3S0BA 2NCPA 1QX5B 2H8VA 2AAOA 5KU1A 1BODA 1KCYA 5D69A 3I5GC 3FE6A 1JFJA 1CLMA 2KI4B 2RGIA 3NSIA 2CBLA 1SCMB 1CDLA 1L2OC 4QJ4B 1V1GA 1NCZA 2WCKA 1QIVA 2BBNA 3AKBA 3DXLA 4NDCA 1J7PA 1JWDA 2L98A 2JU0A 4PHKA 3RM1A 1B4CA 1FPWA 1B7TY 2JQ6A 2KGRA 2OTGB 3BUXB 3B7AA 3QRXA 1CFFA 2BE4A 3JTDB 4PE7A 1CLBA 2PALA 3B87A 4MN0A 2M9GA 2F2OA 1YURA 3BUNB 4JPZB 1S1EA 4GGFA 4AQIA 4F0ZB 3RZSA 3CTNA 1AUIB 2ISDA 3FIAA 1TNPA 1DJHA 1YRTB 3TZ1A 5HKYA 1PALA 1DEKA 4F7FA 1SL9A 5I94A 1DT7B 1TN4A 1K90D 3JVTC 4N1FA 1CLLA 3NSLA 2L2CA 2PSRA 2I18A 2QACA 3QMEA 4N1GA 2LANA 4ICBA 2ZRSA 4L9MA 3O4YA 4ZCVA 1JF0A 4YI8A 2GGZA 2ZNEA 4ORAB 4MEWA 1G4YR 2JT8A 5FI7A 1IKUA 5ER4X 1TCFA 2JZIA 4ETOA 2ZKMX 2CNPA 1KFXS 2WCBA 3TS5B 1KK8C 1JFKA 2CTNA 4FTGA 1Y1AA 1XFWO 2KDHA 2WOSA 4GAOA 1MF8B 3CDNA 1PVBA 2M7NA 3CZ1A 1UHIA 3R1VA 2PQLA 3CR4X 5AFPA 1DELA 1QS7A 2COLB 4I5LB 3S0AA 3FE9A 3M0WA 4OV2A 2M1KB 1LINA 2V53A 1A29A 1A75A 4MSPA 3TDUA 4MVFA 1CFCA 1KK7Z 2K61A 3TDIA 2LUXA 3CR5X 4HSZA 3I5IB 3MSEB 1NUBA 2G2BA 2P70A 4HRGA 2F3YA 1SY9A 1NCYA 1TUJA 2LNKA 2Y1MA 1X02A 2LVKA 3EK8A 3SG2A 1AVSA 2GTEA 2P6BB 1NP8A 1J7QA 2FOTA 2Y5IA 1XA5A 3OP0A 1L7ZA 2KAYA 1QX7A 2CXJA 1NSHA 1SL7A 4CIDA 4FQOA 4XYNA 2LP2A 2M8UA 2IS9A 1IQ3A 1S5GY 3NXAA 2H2KA 3Q8IA 4P2YB 2NZ0A 3F45A 5HKWA 4UPGA 2MAZA 5I8NA 1PVAA 2KBIA 1SPYA 3WNXB 1BT6A 1LKJA 1K2HA 2I94A 1XO5A 2H61C 1JUOA 1S6IA 3PJIA 5F6TA 4C0JA 3BJHA 1BLQA 1OQPA 2LLSA 2KSPA 1QLKA 4YGDB 2KFGA 3O78A 4CFQA 3BUOB 3CZ0A 2BKHB 2K7OA 1UWOA 4GNKB 1F55A 1K9UA 1AJ5A 1RFJA 2JPOA 1KSOA 2OPOA 1R2UA 3BUMB 4MRYA 4A4CA 4JD9A 3WHTB 4ORBB 2JTZA 1CMFA 4YI9A 5J3XA 3DF0A 2KPHA 1RK9A 2WCHA 4M2PA 4PHMA 1F71A 1B8CA 3B86A 1N65A 1TRFA 1YTZC 2WNDA 4NDBA 4YBHB 4YGEB 1S36A 1JSAA 1CM4A 3LL8B 2LVIA 3DY9A 4BY5A 5DKNA 1NWDA 2K7DA 1XFUO 3HX4A 4YGBB 1QIWA 1QJTA 5JJGA 4U8DA 1Y1XA 2L0PA 3LLEA 4CFRA 1K93D 2JT0A 1DVIA 1OOFA 1TOPA 1SRAA 3O6BA 3AAJA 1CB1A 1WDCC 3D0YA 3EVUA 3BFAA 4C0LA 2ZFDA 1KQVA 2E30A 1H8BA 4MZJA 1DTLA 3O4XA 4XJKA 1WRLA 5HL1A 2KLDA 1UURA 2BL0C 1TWOA 1QASA 1BR1B 4I5NB 1DJGA 1EXRA 5CSFA 2FJYA 1DGUA 2L5YA 5I2LA 3IQQA 2K2AA 1V1FA 5FYXA 2QDIA 3SIAA 1CTRA 1S26D 4CPVA 1UHNA 3PM2A 1J1DA 1OZOA 1KQMB 2MRDA 4GPLB 4MZKA 2LVVA 1A4PA 3DF0B 2HQ8A 4QJ3B 3D73A 4FQTA 3CR2A 2KQYA 1FI6A 1XYDA 2EC6B 3TUYB 3EVRA 1KFUL 2E6WA 2CT9A 2LMUA 4DUQA 2NLNA 1EH2A 3GK1A 5CPVA 4PE0A 1XK4C 1SNLA 2M7LA 2OS8B 2KQ6A 2YGUA 1MWNA 4WRIA 1C3YA 2KI6D 1SCVA 1FI5A 2PYQA 3EKJA 1QVIY 1SYMA 2JTTA 2F33A 1WRZA 1YUTA 1TNXA 2JNXA 4E68A 3PN7B 3D76A 2Q4UA 2HPSA 3D0YB 4I5JA 3VRQA 1NIWA 2AUCA 1J7OA 1BOCA 3EG5B 1S6CA 4XJKB 2WORA 4D1EA 2MJWB 4I5KA 2LCPA 3L47A 1EL4A 5GQQC 2LE9B 2WC8A 2O60A 2QPTA 1RROA 3L4AA 1ZOTB 1YVLA 3SJSA 4YRUA 5JOLA 1AP4A 3R1OA 2LAPA 4PALA 1Z2CB 5EL2A 1NX3A 1AJ4A 1K95A 3BUWB 1QXPA 1W9ZA 1PRWA 1F4OA 2TN4A 1CMGA 2EHBA 1R6PA 1HQVA 3D78A 3FS7A 4C0KA 2M0RA 1B7TZ 1KSMA 1KWOC 2HF5A 2Q91A 3FWCA 2K7BA 2MA2A 5DKRA 4NDDA 2Y4QA 3DZTA 3B88A 3PATA 2I2RE 2G9BA 2LMVA 1ORGA 3IQOA 2LC5A 3LK0A 1P28A 1TIZA 1AK8A 2L4IA 5G08A 1KFUS 1SW8A 4Q04A 2KI4C 3I5FB 1IJ5A 1SCMC 3KHEA 3BOWA 1QVIZ 2I7AA 1PK0D 3FWBA 2PVBA 2QEHA 2ZRTA 3BXKA 1FW4A 5D3OA 2OTGC 1LXFC 2ZNDA 3JTDC 4TNCA 1A03A 1DQEA 2WCJA 2K8MB 2BECA 5AXIA 3V2LA 1CM1A 1SR6B 2QEOA 4PHJA 4PE4A 1M46A 1TNQA 1CDPA 2O5GA 4DRWA 2F8PA 1QWVA 2Y1NA 2JXCA 2FCDA 3I5HB 1IQ5A 1VRKA 5FI6A 1FBVA 4DS7A 1F70A 3NSKA 5CSNA 2M3WA 4PE1A 1GGWA 1IIOA 3S0DA 4INWA 2D8NA 3KPXA 2KAVA 3OHMB 2LMTA 1YX7A 2KYFA 5CSJA 1EJ3A 1U5IA 1M39A 1NX1A 2JT3A 2KI6C 4GGNA 2FCEA 1A75B 5ER5A 1IWQA 1OMRA 2BCBA 2PMYA 4JKTA 2DOQA 3CZ2A 2LHLA 4PCWA 1MR8A 3I5GB 1W7JB 5D7FA 2JNFA 3TS5C 2GGMA 4DCKA 1IH0A 1IRJA 2LVJA 1B9AA 1L2OB 4NQGA 1OOJA 1QV1A 3E3RA 3VGOA 2KHNA 4GBAA 1Q80A 3BOWB 3R1PA 2QEBA 5HLOA 2P71A 2JOJA 1ZFSA 1F8HA 3DVEA 1DJIA 1B47A 1SMGA 2LLUA 2KYCA 3I5IC 3L4LA 2QEVA 2BKIB 4GGFC 1ALVA 1B8LA 1S5GZ 3B6XA 3K1EA 1CDMA 2BE6A 2M1UA 3VRNA 1E8AA 4DIRA 2WC5A 3AAKA 3PM8A 2MHHA 4GFTA 2K7CA 5KSZA 1W7IB 1UHKA 2LM5A 3JVTB 1YVHA 3C1VA 3OX6A 4CLNA 1YUSA 1CKKA 2L5XB 1GGZA 3DYEA 1DGVA 1D1OA 1PSBA 2LUCA 1CNPA 1AHRA 2LHIA 3O2PA 5AANA 3OBVA 4KYNA 1OW4A 1EG3A 3NHTA 1BR4B 1UP5A 2WCMA 3D75A 1QLSA 3IVTA 3UNWA 2R2IA 2NCOA 1Y6WA 5DICA 2M97A 1KK8B 1XFRA 2WCEA 3S0GA 2H61A 2JWWA 2PASA 3CGAA 4OZDA 1NPQA 5CSIA 4JWQA 3CZTX 1OMDA 3SS4A 3DVMA 3CS1A 4ZCUA 1T14A 3GK4X 4IL1A 2MLEC 1C07A 4HRHA 3TDZA 1LS8A 2KAXA 3OB1B 1RWYA 4MZLA 1XFYO 2K60A 1SK6D 1TNWA 3ZNIA 4PDZA 4AOMA 3K21A 4ORCB 3HCMA 1GQMA 1RJVA 3WXAA 1HT9A 4MRXA 3KO0A 1TUZA 2JULA 3BFBA 3BQ3A 2L50A 2JC2A 2ZN8A 4MLWA 3WHUB 1KK7Y 1M63B 1MQ1A 5TNCA 1A2XA 2M29A 1QX2A 1ZUZA 1XVJA 1JC2A 2L2EA 1BG1A 4YGAA 3LK1A 5HLVA 4PT1A 1NX0A 3EVVA 5KTYA 2WCFA 2LV7A 1MXLC 1SKTA 3CLNA 1MUXA 2KFHA 3CYZA 2SASA 2KFFA 1PULA 1EG4A 1K94A 1LA0A 3D74A 4P5OE 3SG7A 1DF0A 3N7HA 5HYDA 1IJ6A 4OVNF 1B1GA 1YUUA 3PLFB 3ZWHA 1J55A 5IBWA 4QJ5B 1YR5A 3BYAA 3UO9A 1FF1A 1DJWA 1DJZA 2JXLA 2NXQA 3BFHA 5AERA 2FJUB 2KBMA 4USLA 1KQMC 1OOHA 1DJYA 2F2PA 1YX8A 1DJXA 2HETA 2PRUA 1Z4HA 3R72A 1WLZA 1LA3A 2KGBC 1OOGA 4M2QA 2EC6C 5I2OA 4JQ0D 3OX5A 3TUYC 1XFVO 3KEVA 3SS5A 4HREE 1Y1UA 1C7WA 1N2DA
chains in the Genus database with same CATH topology
1XK4A 1RECA 1PSRA 3DVJA 4OCIA 2SCPA 3D10A 3VRPA 3NSOA 1MHOA 2KOTA 4N5XA 2M49B 2OS8C 3LCPC 5DKQA 2K2FA 5HKZA 2MBXA 1S6JA 1IGVA 2JRFA 2B1UA 1YRUB 1ODBA 3SG4A 1BU3A 1QTXA 1J7RA 1RTP1 1WDCB 3PN7C 1BF5A 1ALWA 3EK4A 3ICBA 4OR9B 1WRKA 1UHHA 4WQ3A 1WLMA 2BL0B 1JF2A 1TCOB 1NYAA 1M31A 1QATA 4BY4A 1ZMZA 3A8RA 1OE9B 3IF7A 1DF0B 1NX2A 1CFPA 1IG5A 1J1EA 1JBAA 1NCXA 1XFXO 1CDNA 1XFZO 4MBEA 1C7VA 3DVKA 1OZSA 3PALA 1ZACA 1QV0A 1B8RA 2A4JA 2KNEA 3SG5A 4R1EA 2GV5A 1G8IA 2LP3A 5K89A 5I2QA 1UHJA 1M45A 1Y0VH 2AMIA 1F54A 1GJYA 1S3PA 4OKHA 4WQ2A 1G33A 2K0JA 2MLFC 3I5FC 4M2OA 4YGCB 3SG3A 2L51A 2CCMA 3H4SE 1BMOA 3SIBA 3VRRA 4AQJA 2BCXA 5B8IB 3EKHA 2VRGA 1TTXA 3GOFA 2L4HA 3PSRA 1K9PA 3CWGA 1SR6C 1U5IB 1OMVA 3EK7A 3GK2A 1SBJA 3AKAA 1N0YA 5AEQA 3PFVA 1SL8A 1H4BA 3SG6A 3I5HC 1DMOA 1F4QA 1OSAA 1CFDA 1WY9A 3KF9A 3OB2B 3RLZA 2JPTA 4A4BA 2ZN9A 3VROA 1MXEA 1K96A 3DD4A 2HQWA 4GUKA 2BCAA 1BJFA 2LLTA 5BPJA 1KWOB 2EGDA 1KFXL 1K8UA 2F3ZA 1LVCD 2BBMA 1UUSA 4PHNA 3A4UB 1K9KA 5PALA 2NCPA 1QX5B 2AAOA 5KU1A 1BODA 1KCYA 5D69A 3I5GC 1JFJA 1CLMA 2KI4B 2RGIA 3NSIA 2CBLA 1SCMB 1CDLA 1L2OC 4QJ4B 1V1GA 1NCZA 3AKBA 1QIVA 2BBNA 1J7PA 4NDCA 1JWDA 2L98A 2JU0A 4PHKA 3RM1A 1B4CA 1FPWA 1B7TY 2JQ6A 2KGRA 2OTGB 3BUXB 3QRXA 1CFFA 2BE4A 3JTDB 4PE7A 1CLBA 2PALA 4MN0A 2M9GA 2F2OA 1YURA 3BUNB 4JPZB 1S1EA 4GGFA 4AQIA 4F0ZB 3CTNA 1AUIB 2ISDA 3FIAA 1TNPA 1DJHA 1YRTB 3TZ1A 5HKYA 1PALA 1DT7B 1SL9A 1TN4A 1K90D 3JVTC 4N1FA 1CLLA 3NSLA 2PSRA 2I18A 2QACA 4N1GA 2LANA 4ICBA 2ZRSA 4L9MA 3O4YA 4ZCVA 1JF0A 4YI8A 2GGZA 2ZNEA 4ORAB 4MEWA 1G4YR 2JT8A 1IKUA 5ER4X 1TCFA 2JZIA 4ETOA 2ZKMX 2CNPA 1KFXS 2WCBA 3TS5B 1KK8C 1JFKA 2CTNA 4FTGA 1Y1AA 1XFWO 2KDHA 2WOSA 4GAOA 1MF8B 1PVBA 2M7NA 1UHIA 3CR4X 5AFPA 1QS7A 2COLB 4I5LB 3M0WA 4OV2A 2M1KB 1LINA 2V53A 1A29A 1A75A 4MSPA 3TDUA 4MVFA 1CFCA 1KK7Z 2K61A 3TDIA 2LUXA 3CR5X 4HSZA 3I5IB 3MSEB 1NUBA 2G2BA 4HRGA 2F3YA 1SY9A 1NCYA 2LNKA 2Y1MA 1X02A 2LVKA 3EK8A 3SG2A 1AVSA 2P6BB 1NP8A 1J7QA 2FOTA 2Y5IA 1XA5A 3OP0A 1L7ZA 2KAYA 1QX7A 2CXJA 1NSHA 1SL7A 4CIDA 4FQOA 4XYNA 2LP2A 2M8UA 2IS9A 1IQ3A 1S5GY 3NXAA 2H2KA 4P2YB 2NZ0A 3F45A 5HKWA 4UPGA 2MAZA 5I8NA 1PVAA 2KBIA 1SPYA 3WNXB 1BT6A 1LKJA 1K2HA 2I94A 1XO5A 2H61C 1JUOA 1S6IA 5F6TA 4C0JA 1BLQA 1OQPA 2LLSA 2KSPA 1QLKA 4YGDB 2KFGA 3O78A 4CFQA 3BUOB 2BKHB 2K7OA 1UWOA 4GNKB 1F55A 1K9UA 1AJ5A 1RFJA 1KSOA 2OPOA 1R2UA 3BUMB 4MRYA 4A4CA 3WHTB 4ORBB 2JTZA 1CMFA 4YI9A 5J3XA 3DF0A 4M2PA 1RK9A 1F71A 4PHMA 1B8CA 1N65A 1TRFA 1YTZC 2WNDA 4NDBA 4YBHB 4YGEB 1S36A 1JSAA 1CM4A 3LL8B 2LVIA 4BY5A 5DKNA 1NWDA 2K7DA 1XFUO 3HX4A 4YGBB 1QIWA 1QJTA 5JJGA 4U8DA 1Y1XA 2L0PA 3LLEA 4CFRA 1K93D 2JT0A 1DVIA 1TOPA 1SRAA 3O6BA 3AAJA 1CB1A 1WDCC 3D0YA 3EVUA 4C0LA 2ZFDA 1KQVA 2E30A 1H8BA 4MZJA 1DTLA 4XJKA 1WRLA 1UURA 2BL0C 1QASA 1BR1B 4I5NB 1DJGA 1EXRA 5CSFA 1DGUA 5I2LA 3IQQA 2K2AA 1V1FA 5FYXA 3SIAA 1CTRA 1S26D 4CPVA 1UHNA 1J1DA 1OZOA 1KQMB 2MRDA 4GPLB 4MZKA 2LVVA 1A4PA 3DF0B 2HQ8A 4QJ3B 3CR2A 2KQYA 1FI6A 1XYDA 2EC6B 3TUYB 3EVRA 1KFUL 2E6WA 2CT9A 2LMUA 4DUQA 2NLNA 1EH2A 3GK1A 5CPVA 4PE0A 1XK4C 1SNLA 2M7LA 2OS8B 2KQ6A 1MWNA 4WRIA 2KI6D 1SCVA 1FI5A 3EKJA 1QVIY 1SYMA 2JTTA 2F33A 1WRZA 1YUTA 1TNXA 2JNXA 4E68A 3PN7B 2Q4UA 2HPSA 3D0YB 4I5JA 3VRQA 1NIWA 2AUCA 1J7OA 1BOCA 1S6CA 4XJKB 2WORA 4D1EA 2MJWB 4I5KA 2LCPA 1EL4A 5GQQC 2LE9B 2WC8A 2O60A 2QPTA 1RROA 1ZOTB 1YVLA 3SJSA 4YRUA 5JOLA 1AP4A 2LAPA 4PALA 1NX3A 1AJ4A 1K95A 3BUWB 1QXPA 1PRWA 1F4OA 2TN4A 1CMGA 2EHBA 1R6PA 1HQVA 3FS7A 4C0KA 2M0RA 1B7TZ 1KSMA 1KWOC 2HF5A 2Q91A 3FWCA 2K7BA 2MA2A 5DKRA 4NDDA 2Y4QA 3PATA 2I2RE 2G9BA 2LMVA 3IQOA 2LC5A 3LK0A 1TIZA 1AK8A 2L4IA 5G08A 1KFUS 1SW8A 4Q04A 2KI4C 3I5FB 1IJ5A 1SCMC 3KHEA 3BOWA 1QVIZ 2I7AA 1PK0D 3FWBA 2PVBA 2ZRTA 3BXKA 1FW4A 2OTGC 1LXFC 2ZNDA 3JTDC 4TNCA 1A03A 2K8MB 2BECA 5AXIA 1CM1A 1SR6B 4PHJA 4PE4A 1M46A 1TNQA 1CDPA 2O5GA 4DRWA 2F8PA 2Y1NA 2JXCA 2FCDA 3I5HB 1IQ5A 1VRKA 4DS7A 1FBVA 1F70A 3NSKA 5CSNA 2M3WA 4PE1A 1GGWA 2D8NA 3KPXA 2KAVA 3OHMB 2LMTA 1YX7A 2KYFA 5CSJA 1EJ3A 1U5IA 1M39A 1NX1A 2JT3A 2KI6C 4GGNA 2FCEA 1A75B 5ER5A 1IWQA 1OMRA 2BCBA 2PMYA 2DOQA 4PCWA 2LHLA 1MR8A 3I5GB 1W7JB 5D7FA 2JNFA 3TS5C 2GGMA 4DCKA 1IH0A 1IRJA 2LVJA 1B9AA 1L2OB 4NQGA 1OOJA 1QV1A 3E3RA 3VGOA 2KHNA 4GBAA 1Q80A 3BOWB 5HLOA 2JOJA 1ZFSA 1F8HA 3DVEA 1DJIA 1B47A 1SMGA 2LLUA 2KYCA 3I5IC 2BKIB 4GGFC 1ALVA 1B8LA 1S5GZ 1CDMA 2BE6A 2M1UA 3VRNA 1E8AA 4DIRA 3AAKA 3PM8A 4GFTA 2MHHA 5KSZA 2K7CA 1W7IB 1UHKA 2LM5A 3JVTB 1YVHA 3C1VA 3OX6A 4CLNA 1YUSA 1CKKA 2L5XB 1GGZA 1DGVA 1D1OA 1PSBA 2LUCA 1CNPA 1AHRA 2LHIA 3O2PA 5AANA 1EG3A 1BR4B 1UP5A 1QLSA 2R2IA 2NCOA 1Y6WA 2M97A 1KK8B 2WCEA 2H61A 2JWWA 2PASA 3CGAA 1NPQA 5CSIA 4JWQA 3CZTX 1OMDA 3DVMA 3CS1A 4ZCUA 3GK4X 4IL1A 2MLEC 1C07A 4HRHA 3TDZA 2KAXA 3OB1B 1RWYA 4MZLA 1XFYO 3ZNIA 1SK6D 1TNWA 4AOMA 4PDZA 3K21A 4ORCB 3HCMA 1GQMA 1RJVA 3WXAA 1HT9A 4MRXA 3KO0A 2JULA 3BQ3A 2L50A 2JC2A 2ZN8A 4MLWA 3WHUB 1KK7Y 1M63B 1MQ1A 5TNCA 1A2XA 2M29A 1QX2A 1ZUZA 1XVJA 1JC2A 2L2EA 1BG1A 4YGAA 3LK1A 5HLVA 1NX0A 3EVVA 5KTYA 2WCFA 2LV7A 1MXLC 1SKTA 3CLNA 1MUXA 2KFHA 2SASA 2KFFA 1PULA 1EG4A 1K94A 1LA0A 4P5OE 3SG7A 1DF0A 5HYDA 1IJ6A 4OVNF 1B1GA 1YUUA 3PLFB 3ZWHA 1J55A 5IBWA 4QJ5B 1YR5A 3BYAA 1FF1A 1DJWA 1DJZA 2JXLA 2NXQA 5AERA 2FJUB 2KBMA 4USLA 1KQMC 2F2PA 1DJYA 1YX8A 1DJXA 2HETA 2PRUA 1WLZA 1LA3A 2KGBC 4M2QA 2EC6C 5I2OA 4JQ0D 3OX5A 3TUYC 1XFVO 3KEVA 4HREE 1Y1UA 1C7WA 1N2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XK4 A;  1REC A;  1PSR A;  3DVJ A;  4OCI A;  2SCP A;  3D10 A;  3VRP A;  3NSO A;  1MHO A;  2KOT A;  4N5X A;  2M49 B;  2OS8 C;  3LCP C;  5DKQ A;  2K2F A;  5HKZ A;  2MBX A;  1S6J A;  1IGV A;  2JRF A;  2B1U A;  1YRU B;  1ODB A;  3SG4 A;  1BU3 A;  1QTX A;  1J7R A;  1RTP 1;  1WDC B;  3PN7 C;  1BF5 A;  1ALW A;  3EK4 A;  3ICB A;  4OR9 B;  1WRK A;  1UHH A;  4WQ3 A;  1WLM A;  2BL0 B;  1JF2 A;  1TCO B;  1NYA A;  1M31 A;  1QAT A;  4BY4 A;  1ZMZ A;  3A8R A;  1OE9 B;  3IF7 A;  1DF0 B;  1NX2 A;  1CFP A;  1IG5 A;  1J1E A;  1JBA A;  1NCX A;  1XFX O;  1CDN A;  1XFZ O;  4MBE A;  1C7V A;  3DVK A;  1OZS A;  3PAL A;  1ZAC A;  1QV0 A;  1B8R A;  2A4J A;  2KNE A;  3SG5 A;  4R1E A;  2GV5 A;  1G8I A;  2LP3 A;  5K89 A;  5I2Q A;  1UHJ A;  1M45 A;  1Y0V H;  2AMI A;  1F54 A;  1GJY A;  1S3P A;  4OKH A;  4WQ2 A;  1G33 A;  2K0J A;  2MLF C;  3I5F C;  4M2O A;  4YGC B;  3SG3 A;  2L51 A;  2CCM A;  3H4S E;  1BMO A;  3SIB A;  3VRR A;  4AQJ A;  2BCX A;  5B8I B;  3EKH A;  2VRG A;  1TTX A;  3GOF A;  2L4H A;  3PSR A;  1K9P A;  3CWG A;  1SR6 C;  1U5I B;  1OMV A;  3EK7 A;  3GK2 A;  1SBJ A;  3AKA A;  1N0Y A;  5AEQ A;  3PFV A;  1SL8 A;  1H4B A;  3SG6 A;  3I5H C;  1DMO A;  1F4Q A;  1OSA A;  1CFD A;  1WY9 A;  3KF9 A;  3OB2 B;  3RLZ A;  2JPT A;  4A4B A;  2ZN9 A;  3VRO A;  1MXE A;  1K96 A;  3DD4 A;  2HQW A;  4GUK A;  2BCA A;  1BJF A;  2LLT A;  5BPJ A;  1KWO B;  2EGD A;  1KFX L;  1K8U A;  2F3Z A;  1LVC D;  2BBM A;  1UUS A;  4PHN A;  3A4U B;  1K9K A;  5PAL A;  2NCP A;  1QX5 B;  2AAO A;  5KU1 A;  1BOD A;  1KCY A;  5D69 A;  3I5G C;  1JFJ A;  1CLM A;  2KI4 B;  2RGI A;  3NSI A;  2CBL A;  1SCM B;  1CDL A;  1L2O C;  4QJ4 B;  1V1G A;  1NCZ A;  3AKB A;  1QIV A;  2BBN A;  1J7P A;  4NDC A;  1JWD A;  2L98 A;  2JU0 A;  4PHK A;  3RM1 A;  1B4C A;  1FPW A;  1B7T Y;  2JQ6 A;  2KGR A;  2OTG B;  3BUX B;  3QRX A;  1CFF A;  2BE4 A;  3JTD B;  4PE7 A;  1CLB A;  2PAL A;  4MN0 A;  2M9G A;  2F2O A;  1YUR A;  3BUN B;  4JPZ B;  1S1E A;  4GGF A;  4AQI A;  4F0Z B;  3CTN A;  1AUI B;  2ISD A;  3FIA A;  1TNP A;  1DJH A;  1YRT B;  3TZ1 A;  5HKY A;  1PAL A;  1DT7 B;  1SL9 A;  1TN4 A;  1K90 D;  3JVT C;  4N1F A;  1CLL A;  3NSL A;  2PSR A;  2I18 A;  2QAC A;  4N1G A;  2LAN A;  4ICB A;  2ZRS A;  4L9M A;  3O4Y A;  4ZCV A;  1JF0 A;  4YI8 A;  2GGZ A;  2ZNE A;  4ORA B;  4MEW A;  1G4Y R;  2JT8 A;  1IKU A;  5ER4 X;  1TCF A;  2JZI A;  4ETO A;  2ZKM X;  2CNP A;  1KFX S;  2WCB A;  3TS5 B;  1KK8 C;  1JFK A;  2CTN A;  4FTG A;  1Y1A A;  1XFW O;  2KDH A;  2WOS A;  4GAO A;  1MF8 B;  1PVB A;  2M7N A;  1UHI A;  3CR4 X;  5AFP A;  1QS7 A;  2COL B;  4I5L B;  3M0W A;  4OV2 A;  2M1K B;  1LIN A;  2V53 A;  1A29 A;  1A75 A;  4MSP A;  3TDU A;  4MVF A;  1CFC A;  1KK7 Z;  2K61 A;  3TDI A;  2LUX A;  3CR5 X;  4HSZ A;  3I5I B;  3MSE B;  1NUB A;  2G2B A;  4HRG A;  2F3Y A;  1SY9 A;  1NCY A;  2LNK A;  2Y1M A;  1X02 A;  2LVK A;  3EK8 A;  3SG2 A;  1AVS A;  2P6B B;  1NP8 A;  1J7Q A;  2FOT A;  2Y5I A;  1XA5 A;  3OP0 A;  1L7Z A;  2KAY A;  1QX7 A;  2CXJ A;  1NSH A;  1SL7 A;  4CID A;  4FQO A;  4XYN A;  2LP2 A;  2M8U A;  2IS9 A;  1IQ3 A;  1S5G Y;  3NXA A;  2H2K A;  4P2Y B;  2NZ0 A;  3F45 A;  5HKW A;  4UPG A;  2MAZ A;  5I8N A;  1PVA A;  2KBI A;  1SPY A;  3WNX B;  1BT6 A;  1LKJ A;  1K2H A;  2I94 A;  1XO5 A;  2H61 C;  1JUO A;  1S6I A;  5F6T A;  4C0J A;  1BLQ A;  1OQP A;  2LLS A;  2KSP A;  1QLK A;  4YGD B;  2KFG A;  3O78 A;  4CFQ A;  3BUO B;  2BKH B;  2K7O A;  1UWO A;  4GNK B;  1F55 A;  1K9U A;  1AJ5 A;  1RFJ A;  1KSO A;  2OPO A;  1R2U A;  3BUM B;  4MRY A;  4A4C A;  3WHT B;  4ORB B;  2JTZ A;  1CMF A;  4YI9 A;  5J3X A;  3DF0 A;  4M2P A;  1RK9 A;  1F71 A;  4PHM A;  1B8C A;  1N65 A;  1TRF A;  1YTZ C;  2WND A;  4NDB A;  4YBH B;  4YGE B;  1S36 A;  1JSA A;  1CM4 A;  3LL8 B;  2LVI A;  4BY5 A;  5DKN A;  1NWD A;  2K7D A;  1XFU O;  3HX4 A;  4YGB B;  1QIW A;  1QJT A;  5JJG A;  4U8D A;  1Y1X A;  2L0P A;  3LLE A;  4CFR A;  1K93 D;  2JT0 A;  1DVI A;  1TOP A;  1SRA A;  3O6B A;  3AAJ A;  1CB1 A;  1WDC C;  3D0Y A;  3EVU A;  4C0L A;  2ZFD A;  1KQV A;  2E30 A;  1H8B A;  4MZJ A;  1DTL A;  4XJK A;  1WRL A;  1UUR A;  2BL0 C;  1QAS A;  1BR1 B;  4I5N B;  1DJG A;  1EXR A;  5CSF A;  1DGU A;  5I2L A;  3IQQ A;  2K2A A;  1V1F A;  5FYX A;  3SIA A;  1CTR A;  1S26 D;  4CPV A;  1UHN A;  1J1D A;  1OZO A;  1KQM B;  2MRD A;  4GPL B;  4MZK A;  2LVV A;  1A4P A;  3DF0 B;  2HQ8 A;  4QJ3 B;  3CR2 A;  2KQY A;  1FI6 A;  1XYD A;  2EC6 B;  3TUY B;  3EVR A;  1KFU L;  2E6W A;  2CT9 A;  2LMU A;  4DUQ A;  2NLN A;  1EH2 A;  3GK1 A;  5CPV A;  4PE0 A;  1XK4 C;  1SNL A;  2M7L A;  2OS8 B;  2KQ6 A;  1MWN A;  4WRI A;  2KI6 D;  1SCV A;  1FI5 A;  3EKJ A;  1QVI Y;  1SYM A;  2JTT A;  2F33 A;  1WRZ A;  1YUT A;  1TNX A;  2JNX A;  4E68 A;  3PN7 B;  2Q4U A;  2HPS A;  3D0Y B;  4I5J A;  3VRQ A;  1NIW A;  2AUC A;  1J7O A;  1BOC A;  1S6C A;  4XJK B;  2WOR A;  4D1E A;  2MJW B;  4I5K A;  2LCP A;  1EL4 A;  5GQQ C;  2LE9 B;  2WC8 A;  2O60 A;  2QPT A;  1RRO A;  1ZOT B;  1YVL A;  3SJS A;  4YRU A;  5JOL A;  1AP4 A;  2LAP A;  4PAL A;  1NX3 A;  1AJ4 A;  1K95 A;  3BUW B;  1QXP A;  1PRW A;  1F4O A;  2TN4 A;  1CMG A;  2EHB A;  1R6P A;  1HQV A;  3FS7 A;  4C0K A;  2M0R A;  1B7T Z;  1KSM A;  1KWO C;  2HF5 A;  2Q91 A;  3FWC A;  2K7B A;  2MA2 A;  5DKR A;  4NDD A;  2Y4Q A;  3PAT A;  2I2R E;  2G9B A;  2LMV A;  3IQO A;  2LC5 A;  3LK0 A;  1TIZ A;  1AK8 A;  2L4I A;  5G08 A;  1KFU S;  1SW8 A;  4Q04 A;  2KI4 C;  3I5F B;  1IJ5 A;  1SCM C;  3KHE A;  3BOW A;  1QVI Z;  2I7A A;  1PK0 D;  3FWB A;  2PVB A;  2ZRT A;  3BXK A;  1FW4 A;  2OTG C;  1LXF C;  2ZND A;  3JTD C;  4TNC A;  1A03 A;  2K8M B;  2BEC A;  5AXI A;  1CM1 A;  1SR6 B;  4PHJ A;  4PE4 A;  1M46 A;  1TNQ A;  1CDP A;  2O5G A;  4DRW A;  2F8P A;  2Y1N A;  2JXC A;  2FCD A;  3I5H B;  1IQ5 A;  1VRK A;  4DS7 A;  1FBV A;  1F70 A;  3NSK A;  5CSN A;  2M3W A;  4PE1 A;  1GGW A;  2D8N A;  3KPX A;  2KAV A;  3OHM B;  2LMT A;  1YX7 A;  2KYF A;  5CSJ A;  1EJ3 A;  1U5I A;  1M39 A;  1NX1 A;  2JT3 A;  2KI6 C;  4GGN A;  2FCE A;  1A75 B;  5ER5 A;  1IWQ A;  1OMR A;  2BCB A;  2PMY A;  2DOQ A;  4PCW A;  2LHL A;  1MR8 A;  3I5G B;  1W7J B;  5D7F A;  2JNF A;  3TS5 C;  2GGM A;  4DCK A;  1IH0 A;  1IRJ A;  2LVJ A;  1B9A A;  1L2O B;  4NQG A;  1OOJ A;  1QV1 A;  3E3R A;  3VGO A;  2KHN A;  4GBA A;  1Q80 A;  3BOW B;  5HLO A;  2JOJ A;  1ZFS A;  1F8H A;  3DVE A;  1DJI A;  1B47 A;  1SMG A;  2LLU A;  2KYC A;  3I5I C;  2BKI B;  4GGF C;  1ALV A;  1B8L A;  1S5G Z;  1CDM A;  2BE6 A;  2M1U A;  3VRN A;  1E8A A;  4DIR A;  3AAK A;  3PM8 A;  4GFT A;  2MHH A;  5KSZ A;  2K7C A;  1W7I B;  1UHK A;  2LM5 A;  3JVT B;  1YVH A;  3C1V A;  3OX6 A;  4CLN A;  1YUS A;  1CKK A;  2L5X B;  1GGZ A;  1DGV A;  1D1O A;  1PSB A;  2LUC A;  1CNP A;  1AHR A;  2LHI A;  3O2P A;  5AAN A;  1EG3 A;  1BR4 B;  1UP5 A;  1QLS A;  2R2I A;  2NCO A;  1Y6W A;  2M97 A;  1KK8 B;  2WCE A;  2H61 A;  2JWW A;  2PAS A;  3CGA A;  1NPQ A;  5CSI A;  4JWQ A;  3CZT X;  1OMD A;  3DVM A;  3CS1 A;  4ZCU A;  3GK4 X;  4IL1 A;  2MLE C;  1C07 A;  4HRH A;  3TDZ A;  2KAX A;  3OB1 B;  1RWY A;  4MZL A;  1XFY O;  3ZNI A;  1SK6 D;  1TNW A;  4AOM A;  4PDZ A;  3K21 A;  4ORC B;  3HCM A;  1GQM A;  1RJV A;  3WXA A;  1HT9 A;  4MRX A;  3KO0 A;  2JUL A;  3BQ3 A;  2L50 A;  2JC2 A;  2ZN8 A;  4MLW A;  3WHU B;  1KK7 Y;  1M63 B;  1MQ1 A;  5TNC A;  1A2X A;  2M29 A;  1QX2 A;  1ZUZ A;  1XVJ A;  1JC2 A;  2L2E A;  1BG1 A;  4YGA A;  3LK1 A;  5HLV A;  1NX0 A;  3EVV A;  5KTY A;  2WCF A;  2LV7 A;  1MXL C;  1SKT A;  3CLN A;  1MUX A;  2KFH A;  2SAS A;  2KFF A;  1PUL A;  1EG4 A;  1K94 A;  1LA0 A;  4P5O E;  3SG7 A;  1DF0 A;  5HYD A;  1IJ6 A;  4OVN F;  1B1G A;  1YUU A;  3PLF B;  3ZWH A;  1J55 A;  5IBW A;  4QJ5 B;  1YR5 A;  3BYA A;  1FF1 A;  1DJW A;  1DJZ A;  2JXL A;  2NXQ A;  5AER A;  2FJU B;  2KBM A;  4USL A;  1KQM C;  2F2P A;  1DJY A;  1YX8 A;  1DJX A;  2HET A;  2PRU A;  1WLZ A;  1LA3 A;  2KGB C;  4M2Q A;  2EC6 C;  5I2O A;  4JQ0 D;  3OX5 A;  3TUY C;  1XFV O;  3KEV A;  4HRE E;  1Y1U A;  1C7W A;  1N2D A; 
#chains in the Genus database with same CATH topology
 1XK4 A;  1REC A;  1PSR A;  3DVJ A;  4OCI A;  2SCP A;  3D10 A;  3VRP A;  3NSO A;  2BNX A;  1MHO A;  2KOT A;  4N5X A;  2M49 B;  2OS8 C;  3LCP C;  5DKQ A;  2K2F A;  5HKZ A;  2MBX A;  1S6J A;  2WCL A;  1IGV A;  2JRF A;  2B1U A;  1YRU B;  1ODB A;  3SG4 A;  1BU3 A;  1QTX A;  1J7R A;  3VB1 A;  1RTP 1;  1WDC B;  3PN7 C;  1BF5 A;  1ALW A;  3EK4 A;  3ICB A;  4OR9 B;  3OGN A;  1WRK A;  1UHH A;  4WQ3 A;  1WLM A;  2ERB A;  2BL0 B;  1JF2 A;  1TCO B;  1NYA A;  1C3Z A;  1M31 A;  1QAT A;  1ZMZ A;  3A8R A;  4BY4 A;  1GM0 A;  1OE9 B;  3IF7 A;  2KLE A;  1DF0 B;  4INX A;  1NX2 A;  1CFP A;  1IG5 A;  3FE8 A;  3S0F A;  1J1E A;  2BAP A;  1JBA A;  1NCX A;  1XFX O;  3CAB A;  1CDN A;  1XFZ O;  4MBE A;  1C7V A;  3DVK A;  1OZS A;  3S0E A;  3PAL A;  1ZAC A;  1QV0 A;  1B8R A;  2A4J A;  2KNE A;  3SG5 A;  4R1E A;  2GV5 A;  1G8I A;  2LP3 A;  5K89 A;  5I2Q A;  1UHJ A;  1M45 A;  1Y0V H;  2AMI A;  1F54 A;  1GJY A;  1S3P A;  3NGV A;  4OKH A;  4WQ2 A;  1G33 A;  2K0J A;  2MLF C;  3I5F C;  3NHI A;  4M2O A;  4YGC B;  3SG3 A;  2L51 A;  2CCM A;  3H4S E;  1SSE B;  1BMO A;  3SIB A;  3SS3 A;  3VRR A;  4AQJ A;  2BCX A;  5B8I B;  3EKH A;  2VRG A;  1TTX A;  3GOF A;  2L4H A;  3PSR A;  1K9P A;  3CWG A;  1SR6 C;  1U5I B;  1OMV A;  3EK7 A;  3GK2 A;  1SBJ A;  3AKA A;  1N0Y A;  5AEQ A;  5FI2 A;  3PFV A;  1SL8 A;  4IJ7 A;  3SG6 A;  2WC6 A;  1H4B A;  3I5H C;  1DMO A;  1F4Q A;  1OSA A;  1CFD A;  1WY9 A;  1DC1 A;  3KF9 A;  3OB2 B;  3RLZ A;  2JPT A;  4A4B A;  2ZN9 A;  3D77 A;  3VRO A;  1MXE A;  1K96 A;  3DD4 A;  2HQW A;  4GUK A;  2BCA A;  1BJF A;  2LLT A;  5BPJ A;  1KWO B;  1OOI X;  2EGD A;  1KFX L;  1K8U A;  2F3Z A;  1LVC D;  2BBM A;  1UUS A;  4PHN A;  3A4U B;  1K9K A;  5PAL A;  3S0B A;  2NCP A;  1QX5 B;  2H8V A;  2AAO A;  5KU1 A;  1BOD A;  1KCY A;  5D69 A;  3I5G C;  3FE6 A;  1JFJ A;  1CLM A;  2KI4 B;  2RGI A;  3NSI A;  2CBL A;  1SCM B;  1CDL A;  1L2O C;  4QJ4 B;  1V1G A;  1NCZ A;  2WCK A;  1QIV A;  2BBN A;  3AKB A;  3DXL A;  4NDC A;  1J7P A;  1JWD A;  2L98 A;  2JU0 A;  4PHK A;  3RM1 A;  1B4C A;  1FPW A;  1B7T Y;  2JQ6 A;  2KGR A;  2OTG B;  3BUX B;  3B7A A;  3QRX A;  1CFF A;  2BE4 A;  3JTD B;  4PE7 A;  1CLB A;  2PAL A;  3B87 A;  4MN0 A;  2M9G A;  2F2O A;  1YUR A;  3BUN B;  4JPZ B;  1S1E A;  4GGF A;  4AQI A;  4F0Z B;  3RZS A;  3CTN A;  1AUI B;  2ISD A;  3FIA A;  1TNP A;  1DJH A;  1YRT B;  3TZ1 A;  5HKY A;  1PAL A;  1DEK A;  4F7F A;  1SL9 A;  5I94 A;  1DT7 B;  1TN4 A;  1K90 D;  3JVT C;  4N1F A;  1CLL A;  3NSL A;  2L2C A;  2PSR A;  2I18 A;  2QAC A;  3QME A;  4N1G A;  2LAN A;  4ICB A;  2ZRS A;  4L9M A;  3O4Y A;  4ZCV A;  1JF0 A;  4YI8 A;  2GGZ A;  2ZNE A;  4ORA B;  4MEW A;  1G4Y R;  2JT8 A;  5FI7 A;  1IKU A;  5ER4 X;  1TCF A;  2JZI A;  4ETO A;  2ZKM X;  2CNP A;  1KFX S;  2WCB A;  3TS5 B;  1KK8 C;  1JFK A;  2CTN A;  4FTG A;  1Y1A A;  1XFW O;  2KDH A;  2WOS A;  4GAO A;  1MF8 B;  3CDN A;  1PVB A;  2M7N A;  3CZ1 A;  1UHI A;  3R1V A;  2PQL A;  3CR4 X;  5AFP A;  1DEL A;  1QS7 A;  2COL B;  4I5L B;  3S0A A;  3FE9 A;  3M0W A;  4OV2 A;  2M1K B;  1LIN A;  2V53 A;  1A29 A;  1A75 A;  4MSP A;  3TDU A;  4MVF A;  1CFC A;  1KK7 Z;  2K61 A;  3TDI A;  2LUX A;  3CR5 X;  4HSZ A;  3I5I B;  3MSE B;  1NUB A;  2G2B A;  2P70 A;  4HRG A;  2F3Y A;  1SY9 A;  1NCY A;  1TUJ A;  2LNK A;  2Y1M A;  1X02 A;  2LVK A;  3EK8 A;  3SG2 A;  1AVS A;  2GTE A;  2P6B B;  1NP8 A;  1J7Q A;  2FOT A;  2Y5I A;  1XA5 A;  3OP0 A;  1L7Z A;  2KAY A;  1QX7 A;  2CXJ A;  1NSH A;  1SL7 A;  4CID A;  4FQO A;  4XYN A;  2LP2 A;  2M8U A;  2IS9 A;  1IQ3 A;  1S5G Y;  3NXA A;  2H2K A;  3Q8I A;  4P2Y B;  2NZ0 A;  3F45 A;  5HKW A;  4UPG A;  2MAZ A;  5I8N A;  1PVA A;  2KBI A;  1SPY A;  3WNX B;  1BT6 A;  1LKJ A;  1K2H A;  2I94 A;  1XO5 A;  2H61 C;  1JUO A;  1S6I A;  3PJI A;  5F6T A;  4C0J A;  3BJH A;  1BLQ A;  1OQP A;  2LLS A;  2KSP A;  1QLK A;  4YGD B;  2KFG A;  3O78 A;  4CFQ A;  3BUO B;  3CZ0 A;  2BKH B;  2K7O A;  1UWO A;  4GNK B;  1F55 A;  1K9U A;  1AJ5 A;  1RFJ A;  2JPO A;  1KSO A;  2OPO A;  1R2U A;  3BUM B;  4MRY A;  4A4C A;  4JD9 A;  3WHT B;  4ORB B;  2JTZ A;  1CMF A;  4YI9 A;  5J3X A;  3DF0 A;  2KPH A;  1RK9 A;  2WCH A;  4M2P A;  4PHM A;  1F71 A;  1B8C A;  3B86 A;  1N65 A;  1TRF A;  1YTZ C;  2WND A;  4NDB A;  4YBH B;  4YGE B;  1S36 A;  1JSA A;  1CM4 A;  3LL8 B;  2LVI A;  3DY9 A;  4BY5 A;  5DKN A;  1NWD A;  2K7D A;  1XFU O;  3HX4 A;  4YGB B;  1QIW A;  1QJT A;  5JJG A;  4U8D A;  1Y1X A;  2L0P A;  3LLE A;  4CFR A;  1K93 D;  2JT0 A;  1DVI A;  1OOF A;  1TOP A;  1SRA A;  3O6B A;  3AAJ A;  1CB1 A;  1WDC C;  3D0Y A;  3EVU A;  3BFA A;  4C0L A;  2ZFD A;  1KQV A;  2E30 A;  1H8B A;  4MZJ A;  1DTL A;  3O4X A;  4XJK A;  1WRL A;  5HL1 A;  2KLD A;  1UUR A;  2BL0 C;  1TWO A;  1QAS A;  1BR1 B;  4I5N B;  1DJG A;  1EXR A;  5CSF A;  2FJY A;  1DGU A;  2L5Y A;  5I2L A;  3IQQ A;  2K2A A;  1V1F A;  5FYX A;  2QDI A;  3SIA A;  1CTR A;  1S26 D;  4CPV A;  1UHN A;  3PM2 A;  1J1D A;  1OZO A;  1KQM B;  2MRD A;  4GPL B;  4MZK A;  2LVV A;  1A4P A;  3DF0 B;  2HQ8 A;  4QJ3 B;  3D73 A;  4FQT A;  3CR2 A;  2KQY A;  1FI6 A;  1XYD A;  2EC6 B;  3TUY B;  3EVR A;  1KFU L;  2E6W A;  2CT9 A;  2LMU A;  4DUQ A;  2NLN A;  1EH2 A;  3GK1 A;  5CPV A;  4PE0 A;  1XK4 C;  1SNL A;  2M7L A;  2OS8 B;  2KQ6 A;  2YGU A;  1MWN A;  4WRI A;  1C3Y A;  2KI6 D;  1SCV A;  1FI5 A;  2PYQ A;  3EKJ A;  1QVI Y;  1SYM A;  2JTT A;  2F33 A;  1WRZ A;  1YUT A;  1TNX A;  2JNX A;  4E68 A;  3PN7 B;  3D76 A;  2Q4U A;  2HPS A;  3D0Y B;  4I5J A;  3VRQ A;  1NIW A;  2AUC A;  1J7O A;  1BOC A;  3EG5 B;  1S6C A;  4XJK B;  2WOR A;  4D1E A;  2MJW B;  4I5K A;  2LCP A;  3L47 A;  1EL4 A;  5GQQ C;  2LE9 B;  2WC8 A;  2O60 A;  2QPT A;  1RRO A;  3L4A A;  1ZOT B;  1YVL A;  3SJS A;  4YRU A;  5JOL A;  1AP4 A;  3R1O A;  2LAP A;  4PAL A;  1Z2C B;  5EL2 A;  1NX3 A;  1AJ4 A;  1K95 A;  3BUW B;  1QXP A;  1W9Z A;  1PRW A;  1F4O A;  2TN4 A;  1CMG A;  2EHB A;  1R6P A;  1HQV A;  3D78 A;  3FS7 A;  4C0K A;  2M0R A;  1B7T Z;  1KSM A;  1KWO C;  2HF5 A;  2Q91 A;  3FWC A;  2K7B A;  2MA2 A;  5DKR A;  4NDD A;  2Y4Q A;  3DZT A;  3B88 A;  3PAT A;  2I2R E;  2G9B A;  2LMV A;  1ORG A;  3IQO A;  2LC5 A;  3LK0 A;  1P28 A;  1TIZ A;  1AK8 A;  2L4I A;  5G08 A;  1KFU S;  1SW8 A;  4Q04 A;  2KI4 C;  3I5F B;  1IJ5 A;  1SCM C;  3KHE A;  3BOW A;  1QVI Z;  2I7A A;  1PK0 D;  3FWB A;  2PVB A;  2QEH A;  2ZRT A;  3BXK A;  1FW4 A;  5D3O A;  2OTG C;  1LXF C;  2ZND A;  3JTD C;  4TNC A;  1A03 A;  1DQE A;  2WCJ A;  2K8M B;  2BEC A;  5AXI A;  3V2L A;  1CM1 A;  1SR6 B;  2QEO A;  4PHJ A;  4PE4 A;  1M46 A;  1TNQ A;  1CDP A;  2O5G A;  4DRW A;  2F8P A;  1QWV A;  2Y1N A;  2JXC A;  2FCD A;  3I5H B;  1IQ5 A;  1VRK A;  5FI6 A;  1FBV A;  4DS7 A;  1F70 A;  3NSK A;  5CSN A;  2M3W A;  4PE1 A;  1GGW A;  1IIO A;  3S0D A;  4INW A;  2D8N A;  3KPX A;  2KAV A;  3OHM B;  2LMT A;  1YX7 A;  2KYF A;  5CSJ A;  1EJ3 A;  1U5I A;  1M39 A;  1NX1 A;  2JT3 A;  2KI6 C;  4GGN A;  2FCE A;  1A75 B;  5ER5 A;  1IWQ A;  1OMR A;  2BCB A;  2PMY A;  4JKT A;  2DOQ A;  3CZ2 A;  2LHL A;  4PCW A;  1MR8 A;  3I5G B;  1W7J B;  5D7F A;  2JNF A;  3TS5 C;  2GGM A;  4DCK A;  1IH0 A;  1IRJ A;  2LVJ A;  1B9A A;  1L2O B;  4NQG A;  1OOJ A;  1QV1 A;  3E3R A;  3VGO A;  2KHN A;  4GBA A;  1Q80 A;  3BOW B;  3R1P A;  2QEB A;  5HLO A;  2P71 A;  2JOJ A;  1ZFS A;  1F8H A;  3DVE A;  1DJI A;  1B47 A;  1SMG A;  2LLU A;  2KYC A;  3I5I C;  3L4L A;  2QEV A;  2BKI B;  4GGF C;  1ALV A;  1B8L A;  1S5G Z;  3B6X A;  3K1E A;  1CDM A;  2BE6 A;  2M1U A;  3VRN A;  1E8A A;  4DIR A;  2WC5 A;  3AAK A;  3PM8 A;  2MHH A;  4GFT A;  2K7C A;  5KSZ A;  1W7I B;  1UHK A;  2LM5 A;  3JVT B;  1YVH A;  3C1V A;  3OX6 A;  4CLN A;  1YUS A;  1CKK A;  2L5X B;  1GGZ A;  3DYE A;  1DGV A;  1D1O A;  1PSB A;  2LUC A;  1CNP A;  1AHR A;  2LHI A;  3O2P A;  5AAN A;  3OBV A;  4KYN A;  1OW4 A;  1EG3 A;  3NHT A;  1BR4 B;  1UP5 A;  2WCM A;  3D75 A;  1QLS A;  3IVT A;  3UNW A;  2R2I A;  2NCO A;  1Y6W A;  5DIC A;  2M97 A;  1KK8 B;  1XFR A;  2WCE A;  3S0G A;  2H61 A;  2JWW A;  2PAS A;  3CGA A;  4OZD A;  1NPQ A;  5CSI A;  4JWQ A;  3CZT X;  1OMD A;  3SS4 A;  3DVM A;  3CS1 A;  4ZCU A;  1T14 A;  3GK4 X;  4IL1 A;  2MLE C;  1C07 A;  4HRH A;  3TDZ A;  1LS8 A;  2KAX A;  3OB1 B;  1RWY A;  4MZL A;  1XFY O;  2K60 A;  1SK6 D;  1TNW A;  3ZNI A;  4PDZ A;  4AOM A;  3K21 A;  4ORC B;  3HCM A;  1GQM A;  1RJV A;  3WXA A;  1HT9 A;  4MRX A;  3KO0 A;  1TUZ A;  2JUL A;  3BFB A;  3BQ3 A;  2L50 A;  2JC2 A;  2ZN8 A;  4MLW A;  3WHU B;  1KK7 Y;  1M63 B;  1MQ1 A;  5TNC A;  1A2X A;  2M29 A;  1QX2 A;  1ZUZ A;  1XVJ A;  1JC2 A;  2L2E A;  1BG1 A;  4YGA A;  3LK1 A;  5HLV A;  4PT1 A;  1NX0 A;  3EVV A;  5KTY A;  2WCF A;  2LV7 A;  1MXL C;  1SKT A;  3CLN A;  1MUX A;  2KFH A;  3CYZ A;  2SAS A;  2KFF A;  1PUL A;  1EG4 A;  1K94 A;  1LA0 A;  3D74 A;  4P5O E;  3SG7 A;  1DF0 A;  3N7H A;  5HYD A;  1IJ6 A;  4OVN F;  1B1G A;  1YUU A;  3PLF B;  3ZWH A;  1J55 A;  5IBW A;  4QJ5 B;  1YR5 A;  3BYA A;  3UO9 A;  1FF1 A;  1DJW A;  1DJZ A;  2JXL A;  2NXQ A;  3BFH A;  5AER A;  2FJU B;  2KBM A;  4USL A;  1KQM C;  1OOH A;  1DJY A;  2F2P A;  1YX8 A;  1DJX A;  2HET A;  2PRU A;  1Z4H A;  3R72 A;  1WLZ A;  1LA3 A;  2KGB C;  1OOG A;  4M2Q A;  2EC6 C;  5I2O A;  4JQ0 D;  3OX5 A;  3TUY C;  1XFV O;  3KEV A;  3SS5 A;  4HRE E;  1Y1U A;  1C7W A;  1N2D A; 
#chains in the Genus database with same CATH homology
 1XK4 A;  1REC A;  1PSR A;  3DVJ A;  4OCI A;  2SCP A;  3D10 A;  3VRP A;  3NSO A;  1MHO A;  2KOT A;  4N5X A;  2M49 B;  2OS8 C;  3LCP C;  5DKQ A;  2K2F A;  5HKZ A;  2MBX A;  1S6J A;  1IGV A;  2JRF A;  2B1U A;  1YRU B;  1ODB A;  3SG4 A;  1BU3 A;  1QTX A;  1J7R A;  1RTP 1;  1WDC B;  3PN7 C;  1BF5 A;  1ALW A;  3EK4 A;  3ICB A;  4OR9 B;  1WRK A;  1UHH A;  4WQ3 A;  1WLM A;  2BL0 B;  1JF2 A;  1TCO B;  1NYA A;  1M31 A;  1QAT A;  4BY4 A;  1ZMZ A;  3A8R A;  1OE9 B;  3IF7 A;  1DF0 B;  1NX2 A;  1CFP A;  1IG5 A;  1J1E A;  1JBA A;  1NCX A;  1XFX O;  1CDN A;  1XFZ O;  4MBE A;  1C7V A;  3DVK A;  1OZS A;  3PAL A;  1ZAC A;  1QV0 A;  1B8R A;  2A4J A;  2KNE A;  3SG5 A;  4R1E A;  2GV5 A;  1G8I A;  2LP3 A;  5K89 A;  5I2Q A;  1UHJ A;  1M45 A;  1Y0V H;  2AMI A;  1F54 A;  1GJY A;  1S3P A;  4OKH A;  4WQ2 A;  1G33 A;  2K0J A;  2MLF C;  3I5F C;  4M2O A;  4YGC B;  3SG3 A;  2L51 A;  2CCM A;  3H4S E;  1BMO A;  3SIB A;  3VRR A;  4AQJ A;  2BCX A;  5B8I B;  3EKH A;  2VRG A;  1TTX A;  3GOF A;  2L4H A;  3PSR A;  1K9P A;  3CWG A;  1SR6 C;  1U5I B;  1OMV A;  3EK7 A;  3GK2 A;  1SBJ A;  3AKA A;  1N0Y A;  5AEQ A;  3PFV A;  1SL8 A;  1H4B A;  3SG6 A;  3I5H C;  1DMO A;  1F4Q A;  1OSA A;  1CFD A;  1WY9 A;  3KF9 A;  3OB2 B;  3RLZ A;  2JPT A;  4A4B A;  2ZN9 A;  3VRO A;  1MXE A;  1K96 A;  3DD4 A;  2HQW A;  4GUK A;  2BCA A;  1BJF A;  2LLT A;  5BPJ A;  1KWO B;  2EGD A;  1KFX L;  1K8U A;  2F3Z A;  1LVC D;  2BBM A;  1UUS A;  4PHN A;  3A4U B;  1K9K A;  5PAL A;  2NCP A;  1QX5 B;  2AAO A;  5KU1 A;  1BOD A;  1KCY A;  5D69 A;  3I5G C;  1JFJ A;  1CLM A;  2KI4 B;  2RGI A;  3NSI A;  2CBL A;  1SCM B;  1CDL A;  1L2O C;  4QJ4 B;  1V1G A;  1NCZ A;  3AKB A;  1QIV A;  2BBN A;  1J7P A;  4NDC A;  1JWD A;  2L98 A;  2JU0 A;  4PHK A;  3RM1 A;  1B4C A;  1FPW A;  1B7T Y;  2JQ6 A;  2KGR A;  2OTG B;  3BUX B;  3QRX A;  1CFF A;  2BE4 A;  3JTD B;  4PE7 A;  1CLB A;  2PAL A;  4MN0 A;  2M9G A;  2F2O A;  1YUR A;  3BUN B;  4JPZ B;  1S1E A;  4GGF A;  4AQI A;  4F0Z B;  3CTN A;  1AUI B;  2ISD A;  3FIA A;  1TNP A;  1DJH A;  1YRT B;  3TZ1 A;  5HKY A;  1PAL A;  1DT7 B;  1SL9 A;  1TN4 A;  1K90 D;  3JVT C;  4N1F A;  1CLL A;  3NSL A;  2PSR A;  2I18 A;  2QAC A;  4N1G A;  2LAN A;  4ICB A;  2ZRS A;  4L9M A;  3O4Y A;  4ZCV A;  1JF0 A;  4YI8 A;  2GGZ A;  2ZNE A;  4ORA B;  4MEW A;  1G4Y R;  2JT8 A;  1IKU A;  5ER4 X;  1TCF A;  2JZI A;  4ETO A;  2ZKM X;  2CNP A;  1KFX S;  2WCB A;  3TS5 B;  1KK8 C;  1JFK A;  2CTN A;  4FTG A;  1Y1A A;  1XFW O;  2KDH A;  2WOS A;  4GAO A;  1MF8 B;  1PVB A;  2M7N A;  1UHI A;  3CR4 X;  5AFP A;  1QS7 A;  2COL B;  4I5L B;  3M0W A;  4OV2 A;  2M1K B;  1LIN A;  2V53 A;  1A29 A;  1A75 A;  4MSP A;  3TDU A;  4MVF A;  1CFC A;  1KK7 Z;  2K61 A;  3TDI A;  2LUX A;  3CR5 X;  4HSZ A;  3I5I B;  3MSE B;  1NUB A;  2G2B A;  4HRG A;  2F3Y A;  1SY9 A;  1NCY A;  2LNK A;  2Y1M A;  1X02 A;  2LVK A;  3EK8 A;  3SG2 A;  1AVS A;  2P6B B;  1NP8 A;  1J7Q A;  2FOT A;  2Y5I A;  1XA5 A;  3OP0 A;  1L7Z A;  2KAY A;  1QX7 A;  2CXJ A;  1NSH A;  1SL7 A;  4CID A;  4FQO A;  4XYN A;  2LP2 A;  2M8U A;  2IS9 A;  1IQ3 A;  1S5G Y;  3NXA A;  2H2K A;  4P2Y B;  2NZ0 A;  3F45 A;  5HKW A;  4UPG A;  2MAZ A;  5I8N A;  1PVA A;  2KBI A;  1SPY A;  3WNX B;  1BT6 A;  1LKJ A;  1K2H A;  2I94 A;  1XO5 A;  2H61 C;  1JUO A;  1S6I A;  5F6T A;  4C0J A;  1BLQ A;  1OQP A;  2LLS A;  2KSP A;  1QLK A;  4YGD B;  2KFG A;  3O78 A;  4CFQ A;  3BUO B;  2BKH B;  2K7O A;  1UWO A;  4GNK B;  1F55 A;  1K9U A;  1AJ5 A;  1RFJ A;  1KSO A;  2OPO A;  1R2U A;  3BUM B;  4MRY A;  4A4C A;  3WHT B;  4ORB B;  2JTZ A;  1CMF A;  4YI9 A;  5J3X A;  3DF0 A;  4M2P A;  1RK9 A;  1F71 A;  4PHM A;  1B8C A;  1N65 A;  1TRF A;  1YTZ C;  2WND A;  4NDB A;  4YBH B;  4YGE B;  1S36 A;  1JSA A;  1CM4 A;  3LL8 B;  2LVI A;  4BY5 A;  5DKN A;  1NWD A;  2K7D A;  1XFU O;  3HX4 A;  4YGB B;  1QIW A;  1QJT A;  5JJG A;  4U8D A;  1Y1X A;  2L0P A;  3LLE A;  4CFR A;  1K93 D;  2JT0 A;  1DVI A;  1TOP A;  1SRA A;  3O6B A;  3AAJ A;  1CB1 A;  1WDC C;  3D0Y A;  3EVU A;  4C0L A;  2ZFD A;  1KQV A;  2E30 A;  1H8B A;  4MZJ A;  1DTL A;  4XJK A;  1WRL A;  1UUR A;  2BL0 C;  1QAS A;  1BR1 B;  4I5N B;  1DJG A;  1EXR A;  5CSF A;  1DGU A;  5I2L A;  3IQQ A;  2K2A A;  1V1F A;  5FYX A;  3SIA A;  1CTR A;  1S26 D;  4CPV A;  1UHN A;  1J1D A;  1OZO A;  1KQM B;  2MRD A;  4GPL B;  4MZK A;  2LVV A;  1A4P A;  3DF0 B;  2HQ8 A;  4QJ3 B;  3CR2 A;  2KQY A;  1FI6 A;  1XYD A;  2EC6 B;  3TUY B;  3EVR A;  1KFU L;  2E6W A;  2CT9 A;  2LMU A;  4DUQ A;  2NLN A;  1EH2 A;  3GK1 A;  5CPV A;  4PE0 A;  1XK4 C;  1SNL A;  2M7L A;  2OS8 B;  2KQ6 A;  1MWN A;  4WRI A;  2KI6 D;  1SCV A;  1FI5 A;  3EKJ A;  1QVI Y;  1SYM A;  2JTT A;  2F33 A;  1WRZ A;  1YUT A;  1TNX A;  2JNX A;  4E68 A;  3PN7 B;  2Q4U A;  2HPS A;  3D0Y B;  4I5J A;  3VRQ A;  1NIW A;  2AUC A;  1J7O A;  1BOC A;  1S6C A;  4XJK B;  2WOR A;  4D1E A;  2MJW B;  4I5K A;  2LCP A;  1EL4 A;  5GQQ C;  2LE9 B;  2WC8 A;  2O60 A;  2QPT A;  1RRO A;  1ZOT B;  1YVL A;  3SJS A;  4YRU A;  5JOL A;  1AP4 A;  2LAP A;  4PAL A;  1NX3 A;  1AJ4 A;  1K95 A;  3BUW B;  1QXP A;  1PRW A;  1F4O A;  2TN4 A;  1CMG A;  2EHB A;  1R6P A;  1HQV A;  3FS7 A;  4C0K A;  2M0R A;  1B7T Z;  1KSM A;  1KWO C;  2HF5 A;  2Q91 A;  3FWC A;  2K7B A;  2MA2 A;  5DKR A;  4NDD A;  2Y4Q A;  3PAT A;  2I2R E;  2G9B A;  2LMV A;  3IQO A;  2LC5 A;  3LK0 A;  1TIZ A;  1AK8 A;  2L4I A;  5G08 A;  1KFU S;  1SW8 A;  4Q04 A;  2KI4 C;  3I5F B;  1IJ5 A;  1SCM C;  3KHE A;  3BOW A;  1QVI Z;  2I7A A;  1PK0 D;  3FWB A;  2PVB A;  2ZRT A;  3BXK A;  1FW4 A;  2OTG C;  1LXF C;  2ZND A;  3JTD C;  4TNC A;  1A03 A;  2K8M B;  2BEC A;  5AXI A;  1CM1 A;  1SR6 B;  4PHJ A;  4PE4 A;  1M46 A;  1TNQ A;  1CDP A;  2O5G A;  4DRW A;  2F8P A;  2Y1N A;  2JXC A;  2FCD A;  3I5H B;  1IQ5 A;  1VRK A;  4DS7 A;  1FBV A;  1F70 A;  3NSK A;  5CSN A;  2M3W A;  4PE1 A;  1GGW A;  2D8N A;  3KPX A;  2KAV A;  3OHM B;  2LMT A;  1YX7 A;  2KYF A;  5CSJ A;  1EJ3 A;  1U5I A;  1M39 A;  1NX1 A;  2JT3 A;  2KI6 C;  4GGN A;  2FCE A;  1A75 B;  5ER5 A;  1IWQ A;  1OMR A;  2BCB A;  2PMY A;  2DOQ A;  4PCW A;  2LHL A;  1MR8 A;  3I5G B;  1W7J B;  5D7F A;  2JNF A;  3TS5 C;  2GGM A;  4DCK A;  1IH0 A;  1IRJ A;  2LVJ A;  1B9A A;  1L2O B;  4NQG A;  1OOJ A;  1QV1 A;  3E3R A;  3VGO A;  2KHN A;  4GBA A;  1Q80 A;  3BOW B;  5HLO A;  2JOJ A;  1ZFS A;  1F8H A;  3DVE A;  1DJI A;  1B47 A;  1SMG A;  2LLU A;  2KYC A;  3I5I C;  2BKI B;  4GGF C;  1ALV A;  1B8L A;  1S5G Z;  1CDM A;  2BE6 A;  2M1U A;  3VRN A;  1E8A A;  4DIR A;  3AAK A;  3PM8 A;  4GFT A;  2MHH A;  5KSZ A;  2K7C A;  1W7I B;  1UHK A;  2LM5 A;  3JVT B;  1YVH A;  3C1V A;  3OX6 A;  4CLN A;  1YUS A;  1CKK A;  2L5X B;  1GGZ A;  1DGV A;  1D1O A;  1PSB A;  2LUC A;  1CNP A;  1AHR A;  2LHI A;  3O2P A;  5AAN A;  1EG3 A;  1BR4 B;  1UP5 A;  1QLS A;  2R2I A;  2NCO A;  1Y6W A;  2M97 A;  1KK8 B;  2WCE A;  2H61 A;  2JWW A;  2PAS A;  3CGA A;  1NPQ A;  5CSI A;  4JWQ A;  3CZT X;  1OMD A;  3DVM A;  3CS1 A;  4ZCU A;  3GK4 X;  4IL1 A;  2MLE C;  1C07 A;  4HRH A;  3TDZ A;  2KAX A;  3OB1 B;  1RWY A;  4MZL A;  1XFY O;  3ZNI A;  1SK6 D;  1TNW A;  4AOM A;  4PDZ A;  3K21 A;  4ORC B;  3HCM A;  1GQM A;  1RJV A;  3WXA A;  1HT9 A;  4MRX A;  3KO0 A;  2JUL A;  3BQ3 A;  2L50 A;  2JC2 A;  2ZN8 A;  4MLW A;  3WHU B;  1KK7 Y;  1M63 B;  1MQ1 A;  5TNC A;  1A2X A;  2M29 A;  1QX2 A;  1ZUZ A;  1XVJ A;  1JC2 A;  2L2E A;  1BG1 A;  4YGA A;  3LK1 A;  5HLV A;  1NX0 A;  3EVV A;  5KTY A;  2WCF A;  2LV7 A;  1MXL C;  1SKT A;  3CLN A;  1MUX A;  2KFH A;  2SAS A;  2KFF A;  1PUL A;  1EG4 A;  1K94 A;  1LA0 A;  4P5O E;  3SG7 A;  1DF0 A;  5HYD A;  1IJ6 A;  4OVN F;  1B1G A;  1YUU A;  3PLF B;  3ZWH A;  1J55 A;  5IBW A;  4QJ5 B;  1YR5 A;  3BYA A;  1FF1 A;  1DJW A;  1DJZ A;  2JXL A;  2NXQ A;  5AER A;  2FJU B;  2KBM A;  4USL A;  1KQM C;  2F2P A;  1DJY A;  1YX8 A;  1DJX A;  2HET A;  2PRU A;  1WLZ A;  1LA3 A;  2KGB C;  4M2Q A;  2EC6 C;  5I2O A;  4JQ0 D;  3OX5 A;  3TUY C;  1XFV O;  3KEV A;  4HRE E;  1Y1U A;  1C7W A;  1N2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...