2LHIA

Solution structure of ca2+/cna1 peptide-bound ycam
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
b'GSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSKGSSTGTRRKALRNKILAIAKVSRMFSVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Serine/threonine-protein phosphatase 2B catalyti
publication title Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, synthetic, saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 41
structure length 176
sequence length 176
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhiA00
1WRKA 2AMIA 1NX0A 1SKTA 2LLUA 5DKRA 1KK8C 1K9UA 4CFQA 5KTYA 3OX6A 3SG7A 1RTP1 2PRUA 4N1FA 2EC6C 2KAXA 2CT9A 1SCMB 1M63B 1NCZA 1DMOA 2KGRA 2L4HA 3ICBA 1BODA 2JWWA 1KFXS 3PATA 4DS7A 5KSZA 2Y4QA 1RJVA 5G08A 1SR6B 3BQ3A 2JOJA 2KAVA 5FYXA 2JT3A 1ALVA 1BJFA 2L98A 3TS5B 1RK9A 1YVLA 1CDLA 1TIZA 2I7AA 3K21A 2MLEC 3NSOA 1KSOA 2KNEA 1IRJA 1PVAA 5ER4X 1YRTB 1CLMA 1UHNA 2LUCA 1QS7A 1RWYA 2BCBA 2M1KB 3VRPA 2PASA 2WC8A 3JVTB 1QATA 5HLVA 2BE6A 1CFCA 2KFGA 3WXAA 3AKAA 3NSKA 3OB2B 5DKQA 2CTNA 1BR4B 4MN0A 1IQ3A 2LC5A 1CM1A 1MF8B 3NSLA 3JTDB 4CIDA 1AP4A 1K9PA 2ZRTA 1VRKA 2KYFA 1PVBA 3DF0A 3EKJA 2Q4UA 1LKJA 2M0RA 1M45A 4DUQA 2LP2A 3PSRA 1JC2A 4WRIA 4MZLA 1MR8A 1M46A 2K7OA 2PALA 2H2KA 1FW4A 2LVVA 3M0WA 4OV2A 1SK6D 3KPXA 5PALA 5JJGA 4N5XA 1QV1A 2TN4A 1IH0A 2KFHA 1EJ3A 3BOWA 4YGCB 2LV7A 1NX3A 3I5IC 2CBLA 1QIVA 4P5OE 2OTGB 4ORAB 1MXEA 4TNCA 4XYNA 4YI8A 2I2RE 1WDCB 1CNPA 5I2LA 2BE4A 2BL0B 2R2IA 1F70A 1K93D 4NQGA 1PSRA 3I5GB 5AEQA 1OZSA 3D0YA 2KAYA 1DF0B 1IJ6A 3HX4A 4GGFA 1JFKA 1L2OB 1YX7A 4NDCA 1YR5A 4M2OA 2OS8B 4GFTA 2FCEA 2MAZA 4GGNA 3BUOB 4PHKA 3LLEA 1GQMA 1CLLA 2NLNA 2M49B 3PN7C 1SW8A 2G9BA 3I5HB 1AK8A 3H4SE 2KGBC 5F6TA 1IG5A 1QTXA 1AUIB 1J7QA 2WOSA 4BY5A 1NX1A 3IQQA 1XA5A 1SNLA 1DJIA 1G8IA 3ZNIA 3EK8A 1AJ5A 1NWDA 4MBEA 4Q04A 2M8UA 1SBJA 4M2PA 2COLB 3SG3A 1DJYA 1DT7B 2CCMA 1QX7A 1XYDA 2JT0A 1UHKA 1XO5A 2JU0A 4I5KA 1CTRA 2DOQA 2LNKA 1L7ZA 1WRLA 2JULA 1A75A 1JFJA 1FF1A 4AQIA 3SIAA 4PCWA 1S5GZ 3DVEA 1IJ5A 5I2OA 1WY9A 1MXLC 2KQ6A 5HYDA 2P6BB 1SCMC 2LCPA 4C0KA 1BU3A 3CLNA 5BPJA 3VRQA 1PSBA 4IL1A 2KBIA 2HQWA 2L5XB 2JZIA 1SR6C 2G2BA 1Y6WA 2JPTA 3DF0B 4HRHA 4YRUA 3FIAA 3C1VA 5B8IB 1K2HA 3CR5X 1ZFSA 4BY4A 1F54A 5DKNA 3TS5C 3ZWHA 3I5FC 2L50A 1WLMA 3KEVA 1TN4A 1BG1A 2JNXA 2MBXA 1N2DA 1MUXA 2KSPA 4PE1A 1KFXL 1GJYA 1S5GY 1M31A 2F2PA 2ZNEA 3IQOA 3DVJA 4ZCUA 1A03A 1TNQA 4QJ5B 2NXQA 4R1EA 1YUUA 1QLKA 2BBMA 1S6IA 2K61A 2WCEA 2ZN9A 3JVTC 4I5JA 1F4QA 3I5FB 3BOWB 2LMVA 2EHBA 4PHJA 1DJZA 3F45A 1BT6A 2M97A 4GGFC 2JC2A 3KF9A 3OB1B 2L51A 1M39A 4PHMA 3CZTX 3JTDC 1QIWA 1NPQA 4F0ZB 1SYMA 1YVHA 2PVBA 3D0YB 5KU1A 1TCOB 2KI4C 4YBHB 2SASA 2M3WA 1JBAA 2F3ZA 1DJGA 4QJ3B 1SL7A 2LVKA 1IGVA 4L9MA 2BBNA 1JSAA 1JUOA 3HCMA 1QASA 2M1UA 1J55A 1Y1UA 1V1GA 1OSAA 2KI4B 4XJKA 1NUBA 1EG3A 1CM4A 3SG4A 4NDDA 3KHEA 1XFVO 1LINA 1FI5A 3E3RA 3LL8B 1S36A 3EK7A 1J1EA 1B8LA 2JRFA 1NCXA 2AAOA 2OTGC 2GGMA 4JWQA 1A4PA 1WDCC 1PK0D 2BL0C 3GK4X 1A29A 2M29A 2QPTA 1DTLA 1S6CA 1Y1XA 3I5GC 4MLWA 4PDZA 1BLQA 1CMGA 2K7CA 2ISDA 2KOTA 2LAPA 1XFWO 2K2AA 1UHJA 5IBWA 5HKYA 1SL9A 4WQ3A 1L2OC 2B1UA 2WCFA 3TDUA 1Y1AA 1CMFA 2OS8C 1BF5A 4QJ4B 1KQMB 3BYAA 5HLOA 4C0JA 2LMUA 5JOLA 3RM1A 1ZOTB 2VRGA 3RLZA 4ETOA 1YTZC 3TZ1A 1UP5A 2K0JA 1B1GA 5I8NA 2I18A 2JXCA 4MVFA 1XK4C 1YUTA 1E8AA 4PE7A 1UUSA 3I5HC 1DJWA 1QXPA 3BXKA 4NDBA 1CDNA 4I5LB 1IWQA 1LVCD 1DGVA 1RFJA 4P2YB 1OMRA 1PRWA 4PE0A 3TUYB 1A75B 1G33A 2GV5A 2LLSA 2LUXA 1OQPA 1PALA 3PALA 5D7FA 1KQVA 4USLA 2F3YA 1UHIA 2RGIA 1QV0A 3EVVA 3VRRA 3SIBA 2NCOA 1GGWA 2LVIA 3GK2A 1SL8A 2BECA 2CNPA 1TNWA 2LM5A 2HF5A 3O2PA 1XFZO 4D1EA 1HT9A 4ORCB 2OPOA 4GUKA 3CTNA 2LP3A 5I2QA 1XVJA 1QJTA 3QRXA 1NYAA 2BCXA 2H61A 3SG2A 4C0LA 3OP0A 3VROA 2JT8A 1A2XA 1XFYO 1J1DA 2IS9A 3LCPC 1B4CA 3PM8A 4OVNF 1NP8A 4CPVA 2E30A 4DIRA 1WLZA 1SRAA 2MA2A 1W7JB 1WRZA 5HKWA 1TRFA 2AUCA 1CDMA 1U5IA 4DRWA 1FPWA 3TDZA 1K96A 1Q80A 3BUMB 4PHNA 3CR2A 4FTGA 1CFFA 4ORBB 1NSHA 4XJKB 1BMOA 4MRYA 2L4IA 3PFVA 2ZNDA 2D8NA 1OOJA 2KBMA 1V1FA 1CKKA 4YGDB 1EG4A 4MZKA 4MEWA 1DGUA 2LANA 2FCDA 3O78A 1B47A 1LXFC 2KQYA 1IQ5A 3DVMA 3NXAA 1SPYA 2KI6C 4MZJA 1H4BA 1YURA 1AVSA 3SG5A 1NCYA 1K90D 3FS7A 1ZMZA 4WQ2A 4ZCVA 2MRDA 2GGZA 2F2OA 1K94A 2PMYA 3EK4A 1EH2A 3CWGA 3VGOA 2JTZA 1KWOB 4FQOA 1LA0A 2BCAA 4U8DA 1H8BA 5ER5A 1KK8B 1RROA 1TNXA 2KFFA 1GGZA 1J7PA 3AAKA 5CSJA 3IF7A 2Y1MA 2JQ6A 5TNCA 5D69A 1JWDA 2EC6B 1OZOA 2M7NA 2Q91A 1CLBA 2Y5IA 2ZKMX 1NIWA 2HQ8A 3FWCA 3LK0A 5K89A 1KK7Z 2WNDA 2WCBA 1J7RA 1Y0VH 2K8MB 2SCPA 4CFRA 2BKIB 4MRXA 1S3PA 4GNKB 1C7VA 4ICBA 1AHRA 3AAJA 1KFUS 2ZN8A 1QX5B 1CFPA 1KFUL 5J3XA 5AERA 2KI6D 3A4UB 3MSEB 4E68A 4OCIA 1KQMC 3EVUA 1MWNA 4HSZA 1IKUA 1ZACA 1LA3A 2A4JA 2H61C 1F71A 1YRUB 1QVIZ 3EKHA 2Y1NA 2ZFDA 3DD4A 3AKBA 3GK1A 2NCPA 1MQ1A 3WNXB 3KO0A 4MSPA 2ZRSA 2FJUB 1KK7Y 3D10A 4N1GA 1TTXA 2WORA 3TUYC 2KHNA 1QX2A 1ODBA 1PULA 1FI6A 1RECA 3A8RA 2CXJA 5GQQC 1SMGA 1B8RA 1B7TZ 1NX2A 4YGEB 4AQJA 1CDPA 4PE4A 2LLTA 2E6WA 3GOFA 5HKZA 1D1OA 1TOPA 1QVIY 4YGAA 1J7OA 2EGDA 1OMDA 1CFDA 2F8PA 1DJHA 4OR9B 3CS1A 3BUWB 1UWOA 2BKHB 4I5NB 1KCYA 1YX8A 1FBVA 1XFUO 2K7BA 3EVRA 4DCKA 3O4YA 1U5IB 1F8HA 1QLSA 1OE9B 2F33A 2M9GA 3TDIA 1C07A 1B7TY 2JTTA 2LHIA 1XFXO 3I5IB 4A4CA 1SY9A 1C7WA 5CSIA 2V53A 2L0PA 4HREE 1DJXA 2MHHA 1UHHA 4M2QA 5AXIA 4HRGA 2NZ0A 1CB1A 1N65A 1R2UA 3CR4X 1B8CA 2MLFC 4PALA 2L2EA 1B9AA 4AOMA 4UPGA 3BUNB 1ZUZA 1EL4A 2O5GA 2I94A 2MJWB 1R6PA 1EXRA 2O60A 2JXLA 3SJSA 5AFPA 1F55A 3WHTB 3SG6A 3OHMB 2QACA 1KSMA 3PN7B 3CGAA 1F4OA 1BR1B 3DVKA 1S26D 4GPLB 1MHOA 3NSIA 4JPZB 5CSFA 1JF0A 1N0YA 2K7DA 1W7IB 3OX5A 1AJ4A 1K9KA 1JF2A 4YI9A 2M7LA 3PLFB 2KYCA 1G4YR 2LE9B 1SCVA 1TCFA 2FOTA 1OMVA 1S1EA 2LVJA 3FWBA 1TNPA 3O6BA 4OKHA 1UURA 3WHUB 5CPVA 2HPSA 1K95A 5AANA 3VRNA 4A4BA 3LK1A 4GAOA 1YUSA 2HETA 1DF0A 2LHLA 1S6JA 1X02A 1BOCA 2PSRA 2LMTA 3BUXB 1K8UA 1ALWA 4GBAA 2KDHA 4CLNA 5CSNA 2JNFA 1DVIA 2K2FA 1HQVA 4JQ0D 4YGBB 1KWOC 1XK4A
chains in the Genus database with same CATH superfamily
1WRKA 2AMIA 3BFAA 3OBVA 1NX0A 1SKTA 2LLUA 5DKRA 1KK8C 1K9UA 4CFQA 4MVFA 5KTYA 3S0BA 3OX6A 3SG7A 4F7FA 1RTP1 2PRUA 4N1FA 2EC6C 2KAXA 2CT9A 1SCMB 1M63B 1NCZA 1DMOA 2KGRA 2L4HA 3ICBA 1BODA 2JWWA 1KFXS 3PATA 4DS7A 5KSZA 2Y4QA 1RJVA 5G08A 1SR6B 4IJ7A 3BQ3A 2JOJA 2KAVA 5FYXA 2JT3A 1ALVA 1BJFA 2L98A 2PYQA 1QWVA 3TS5B 3Q8IA 1RK9A 1YVLA 1CDLA 1TIZA 2I7AA 3K21A 2MLEC 3NSOA 1KSOA 2KNEA 1IRJA 3NHIA 1PVAA 5ER4X 1YRTB 1CLMA 1UHNA 2LUCA 1QS7A 1RWYA 2BCBA 2M1KB 3VRPA 2PASA 2WC8A 2KPHA 3JVTB 1QATA 5HLVA 2BE6A 1CFCA 2KFGA 3WXAA 3AKAA 3NSKA 3OB2B 5DKQA 2CTNA 1BR4B 3B86A 1GM0A 4MN0A 1IQ3A 2LC5A 1CM1A 1MF8B 3NSLA 3JTDB 4CIDA 1AP4A 1K9PA 2ZRTA 1VRKA 2KYFA 1PVBA 3DF0A 3EKJA 2Q4UA 1LKJA 3RZSA 3CABA 2M0RA 1M45A 4DUQA 2LP2A 3PSRA 1JC2A 3FE9A 4WRIA 4MZLA 1MR8A 3EG5B 3IVTA 1M46A 2K7OA 2PALA 2H2KA 1FW4A 1DEKA 2LVVA 3M0WA 1SK6D 3KPXA 4OV2A 5JJGA 4N5XA 5EL2A 5HL1A 1QV1A 2TN4A 1IH0A 2KFHA 1EJ3A 1OOIX 3BOWA 4YGCB 1OW4A 2LV7A 1NX3A 3I5IC 2CBLA 1QIVA 4P5OE 2OTGB 4ORAB 1MXEA 4TNCA 4XYNA 4YI8A 2I2RE 1WDCB 1CNPA 2JPOA 5I2LA 2BE4A 2BL0B 2R2IA 1F70A 1K93D 4NQGA 1PSRA 3I5GB 5AEQA 1OZSA 3D0YA 3QMEA 2KAYA 1DF0B 1IJ6A 3HX4A 4GGFA 1JFKA 1L2OB 1YX7A 3UNWA 3SS4A 4NDCA 1YR5A 4M2OA 2OS8B 4GFTA 2FCEA 3NHTA 2MAZA 1TUJA 3BUOB 4GGNA 4PHKA 3PJIA 3S0AA 3LLEA 2BNXA 1GQMA 2PQLA 1CLLA 2NLNA 2M49B 3PN7C 1SW8A 2G9BA 3S0FA 3I5HB 1AK8A 2BAPA 3H4SE 2KGBC 5F6TA 1IG5A 1QTXA 1AUIB 2L5YA 1J7QA 2WOSA 3D77A 1NX1A 4BY5A 2WC5A 3IQQA 1XA5A 1SNLA 1DJIA 1G8IA 3ZNIA 3EK8A 1AJ5A 1NWDA 4MBEA 4Q04A 2M8UA 1SBJA 4M2PA 2COLB 3SG3A 1DJYA 1C3YA 1DT7B 2CCMA 1QX7A 1XYDA 2JT0A 3R1VA 2FJYA 4JKTA 1UHKA 1XO5A 2JU0A 4I5KA 2WCKA 1CTRA 2DOQA 2LNKA 1L7ZA 1WRLA 2JULA 1A75A 1JFJA 1FF1A 3CDNA 4AQIA 3SIAA 4PCWA 1S5GZ 3DVEA 1IJ5A 5I2OA 1WY9A 1MXLC 2KQ6A 3D75A 5HYDA 2P6BB 1SCMC 2LCPA 4C0KA 1BU3A 1OOHA 3CLNA 3VRQA 1PSBA 5BPJA 4IL1A 2KBIA 2HQWA 1Z2CB 1C3ZA 2JZIA 2L5XB 1SR6C 2G2BA 1Y6WA 1DELA 2GTEA 2JPTA 3DF0B 4HRHA 4YRUA 3FIAA 3C1VA 5B8IB 1K2HA 3CR5X 1ZFSA 4BY4A 1F54A 2QEVA 5DKNA 3TS5C 3ZWHA 3I5FC 2L50A 1WLMA 3KEVA 1IIOA 1TN4A 1BG1A 2JNXA 2MBXA 1N2DA 1MUXA 2KSPA 4PE1A 1KFXL 1GJYA 1S5GY 1M31A 2F2PA 2ZNEA 3B6XA 3DVJA 3IQOA 4ZCUA 1TNQA 4QJ5B 2NXQA 4R1EA 1A03A 1YUUA 1QLKA 1W9ZA 2BBMA 1S6IA 2K61A 2WCEA 2ZN9A 3JVTC 4I5JA 1F4QA 3I5FB 3BOWB 2LMVA 2EHBA 4PHJA 1DJZA 3F45A 1BT6A 2M97A 4GGFC 2JC2A 3KF9A 3OB1B 2L51A 1M39A 3SS3A 4PHMA 3CZTX 4INWA 3JTDC 1QIWA 1NPQA 4F0ZB 1SYMA 1YVHA 2PVBA 3D0YB 3R72A 5KU1A 1TCOB 2KI4C 4YBHB 2SASA 2M3WA 1JBAA 2F3ZA 2WCHA 3BFHA 1DJGA 4QJ3B 3FE6A 1SL7A 2LVKA 1IGVA 4L9MA 2BBNA 3CYZA 1JUOA 3L4AA 1JSAA 3HCMA 1ORGA 1QASA 2M1UA 1J55A 1Y1UA 1V1GA 1OSAA 2KI4B 4XJKA 1NUBA 1EG3A 1CM4A 4KYNA 4NDDA 3SG4A 3KHEA 3K1EA 1XFVO 1LINA 1FI5A 3E3RA 3LL8B 1S36A 3EK7A 3PM2A 1J1EA 1B8LA 2JRFA 1NCXA 2AAOA 2OTGC 2GGMA 4JWQA 3NGVA 3S0GA 1A4PA 1WDCC 1PK0D 1Z4HA 2BL0C 3GK4X 1A29A 2M29A 2QPTA 1DTLA 1S6CA 1Y1XA 3I5GC 4MLWA 4PDZA 1T14A 1BLQA 1CMGA 2K7CA 2ISDA 2KOTA 2LAPA 1XFWO 2K2AA 1DQEA 1UHJA 5IBWA 5HKYA 1SL9A 4WQ3A 1L2OC 2B1UA 2WCFA 3TDUA 1Y1AA 1CMFA 2OS8C 1BF5A 4QJ4B 5FI7A 1KQMB 3BYAA 5HLOA 4C0JA 2LMUA 5JOLA 3RM1A 1ZOTB 2VRGA 3D73A 3RLZA 4ETOA 1YTZC 3D78A 3TZ1A 1UP5A 2K0JA 1B1GA 5I8NA 2H8VA 2WCLA 2I18A 2JXCA 2QEHA 3B7AA 3BFBA 1XK4C 3DZTA 1YUTA 1E8AA 2YGUA 3N7HA 1UUSA 2P70A 3I5HC 4PE7A 1DJWA 1QXPA 3BXKA 4NDBA 1CDNA 4I5LB 1IWQA 1LVCD 1DGVA 1RFJA 4P2YB 3L47A 1OMRA 1PRWA 3DXLA 4PE0A 1A75B 1G33A 2GV5A 2LLSA 2LUXA 1OQPA 1PALA 3PALA 3UO9A 5D7FA 1KQVA 4USLA 2F3YA 1UHIA 2RGIA 3L4LA 2WCJA 1QV0A 3EVVA 3VRRA 3SIBA 2NCOA 3S0EA 1GGWA 3DYEA 2LVIA 3GK2A 1SL8A 2BECA 2CNPA 1TNWA 2LM5A 2HF5A 3O2PA 1XFZO 4D1EA 1HT9A 4ORCB 2OPOA 4GUKA 3CTNA 2LP3A 5I2QA 1XVJA 1P28A 1QJTA 3QRXA 1NYAA 2BCXA 5DICA 2H61A 3SG2A 4C0LA 3OP0A 3VROA 2WCMA 2JT8A 1A2XA 1XFYO 1J1DA 2IS9A 3LCPC 1B4CA 3PM8A 4OVNF 1NP8A 2L2CA 4CPVA 2E30A 4DIRA 1WLZA 1SRAA 3D76A 3D74A 2MA2A 1W7JB 1WRZA 2KLDA 5HKWA 1TRFA 2QDIA 2AUCA 1CDMA 1U5IA 1TWOA 4DRWA 1FPWA 3TDZA 1K96A 1Q80A 3TUYB 3BUMB 4PHNA 3V2LA 3CR2A 3CZ0A 4FTGA 1CFFA 4ORBB 1NSHA 4XJKB 5D3OA 1BMOA 4MRYA 2ERBA 2L4IA 3PFVA 2ZNDA 2D8NA 1OOJA 2KBMA 1V1FA 3DY9A 1CKKA 4YGDB 1EG4A 4MZKA 4JD9A 1DGUA 2LANA 2FCDA 3O78A 4FQTA 4MEWA 1B47A 1LXFC 2KQYA 3OGNA 1IQ5A 3DVMA 3NXAA 1SPYA 2KI6C 4MZJA 1H4BA 1YURA 2WC6A 1AVSA 3SG5A 1NCYA 1K90D 3FS7A 1ZMZA 4WQ2A 4ZCVA 2MRDA 2GGZA 3CZ2A 2F2OA 1K94A 2PMYA 3EK4A 1EH2A 3CWGA 3VGOA 2JTZA 1KWOB 4FQOA 1LA0A 2BCAA 4U8DA 1H8BA 5ER5A 1KK8B 1RROA 1TNXA 5FI6A 2KFFA 1GGZA 1J7PA 3AAKA 5CSJA 3IF7A 2Y1MA 2JQ6A 5TNCA 5D69A 3O4XA 4PT1A 1JWDA 2EC6B 3VB1A 1OZOA 2M7NA 2Q91A 1CLBA 2Y5IA 2ZKMX 1NIWA 2HQ8A 3FWCA 3LK0A 5K89A 1KK7Z 2WNDA 2WCBA 3S0DA 1J7RA 1Y0VH 2K8MB 2SCPA 4CFRA 2BKIB 4MRXA 1S3PA 4GNKB 1C7VA 4ICBA 1AHRA 3AAJA 1KFUS 2ZN8A 1QX5B 1CFPA 1KFUL 1OOGA 5J3XA 5AERA 2KI6D 3A4UB 3FE8A 3MSEB 4E68A 4OCIA 1KQMC 3EVUA 1MWNA 4HSZA 1IKUA 1ZACA 1LA3A 2A4JA 2H61C 1F71A 1YRUB 1QVIZ 3EKHA 2Y1NA 2ZFDA 3DD4A 3AKBA 3GK1A 2NCPA 1MQ1A 3WNXB 1SSEB 3KO0A 2ZRSA 4MSPA 2FJUB 2P71A 1KK7Y 3D10A 4N1GA 3B87A 1TTXA 2WORA 3B88A 1TUZA 2KHNA 3TUYC 1DC1A 1QX2A 1ODBA 1PULA 1FI6A 1RECA 3A8RA 2CXJA 5GQQC 1SMGA 1B8RA 1B7TZ 1NX2A 4YGEB 4AQJA 2KLEA 1CDPA 4PE4A 2LLTA 2E6WA 3GOFA 5HKZA 1D1OA 1TOPA 1QVIY 4YGAA 1J7OA 2EGDA 1OMDA 1CFDA 2F8PA 1DJHA 4OR9B 3CS1A 3BUWB 1UWOA 2BKHB 1OOFA 3R1OA 4I5NB 1KCYA 1YX8A 5PALA 1FBVA 1XFUO 1XFRA 2K7BA 3CZ1A 3EVRA 3SS5A 3O4YA 1U5IB 4DCKA 1F8HA 1QLSA 1OE9B 2F33A 3BJHA 2M9GA 3TDIA 1C07A 1B7TY 2JTTA 2LHIA 1XFXO 3I5IB 4A4CA 1SY9A 1C7WA 5CSIA 2V53A 2L0PA 4HREE 1DJXA 2MHHA 1UHHA 4M2QA 5AXIA 4HRGA 2NZ0A 1CB1A 1N65A 1R2UA 3CR4X 1B8CA 2MLFC 4PALA 2L2EA 1B9AA 4AOMA 1LS8A 4UPGA 3BUNB 1ZUZA 4OZDA 1EL4A 2O5GA 2I94A 2MJWB 1R6PA 1EXRA 2O60A 2JXLA 3SJSA 5AFPA 1F55A 3WHTB 3SG6A 5I94A 3OHMB 2QACA 1KSMA 3PN7B 3CGAA 1F4OA 1BR1B 3DVKA 1S26D 4GPLB 1MHOA 3NSIA 4JPZB 5CSFA 1JF0A 1N0YA 2K7DA 1W7IB 3OX5A 1AJ4A 1K9KA 1JF2A 4YI9A 2M7LA 3PLFB 2KYCA 1G4YR 2LE9B 2QEOA 1SCVA 1TCFA 2FOTA 1OMVA 1S1EA 2LVJA 3FWBA 1TNPA 3O6BA 4OKHA 1UURA 3WHUB 5CPVA 2HPSA 1K95A 5AANA 5FI2A 4INXA 3LK1A 4GAOA 3VRNA 1YUSA 4A4BA 2HETA 1DF0A 3R1PA 2LHLA 1S6JA 1X02A 1BOCA 2PSRA 2K60A 2LMTA 3BUXB 1K8UA 1ALWA 4GBAA 2KDHA 4CLNA 5CSNA 2QEBA 2JNFA 1DVIA 2K2FA 1HQVA 4JQ0D 4YGBB 1KWOC 1XK4A
chains in the Genus database with same CATH topology
1WRKA 2AMIA 1NX0A 1SKTA 2LLUA 5DKRA 1KK8C 1K9UA 4CFQA 5KTYA 3OX6A 3SG7A 1RTP1 2PRUA 4N1FA 2EC6C 2KAXA 2CT9A 1SCMB 1M63B 1NCZA 1DMOA 2KGRA 2L4HA 3ICBA 1BODA 2JWWA 1KFXS 3PATA 4DS7A 5KSZA 2Y4QA 1RJVA 5G08A 1SR6B 3BQ3A 2JOJA 2KAVA 5FYXA 2JT3A 1ALVA 1BJFA 2L98A 3TS5B 1RK9A 1YVLA 1CDLA 1TIZA 2I7AA 3K21A 2MLEC 3NSOA 1KSOA 2KNEA 1IRJA 1PVAA 5ER4X 1YRTB 1CLMA 1UHNA 2LUCA 1QS7A 1RWYA 2BCBA 2M1KB 3VRPA 2PASA 2WC8A 3JVTB 1QATA 5HLVA 2BE6A 1CFCA 2KFGA 3WXAA 3AKAA 3NSKA 3OB2B 5DKQA 2CTNA 1BR4B 4MN0A 1IQ3A 2LC5A 1CM1A 1MF8B 3NSLA 3JTDB 4CIDA 1AP4A 1K9PA 2ZRTA 1VRKA 2KYFA 1PVBA 3DF0A 3EKJA 2Q4UA 1LKJA 2M0RA 1M45A 4DUQA 2LP2A 3PSRA 1JC2A 4WRIA 4MZLA 1MR8A 1M46A 2K7OA 2PALA 2H2KA 1FW4A 2LVVA 3M0WA 4OV2A 1SK6D 3KPXA 5PALA 5JJGA 4N5XA 1QV1A 2TN4A 1IH0A 2KFHA 1EJ3A 3BOWA 4YGCB 2LV7A 1NX3A 3I5IC 2CBLA 1QIVA 4P5OE 2OTGB 4ORAB 1MXEA 4TNCA 4XYNA 4YI8A 2I2RE 1WDCB 1CNPA 5I2LA 2BE4A 2BL0B 2R2IA 1F70A 1K93D 4NQGA 1PSRA 3I5GB 5AEQA 1OZSA 3D0YA 2KAYA 1DF0B 1IJ6A 3HX4A 4GGFA 1JFKA 1L2OB 1YX7A 4NDCA 1YR5A 4M2OA 2OS8B 4GFTA 2FCEA 2MAZA 4GGNA 3BUOB 4PHKA 3LLEA 1GQMA 1CLLA 2NLNA 2M49B 3PN7C 1SW8A 2G9BA 3I5HB 1AK8A 3H4SE 2KGBC 5F6TA 1IG5A 1QTXA 1AUIB 1J7QA 2WOSA 4BY5A 1NX1A 3IQQA 1XA5A 1SNLA 1DJIA 1G8IA 3ZNIA 3EK8A 1AJ5A 1NWDA 4MBEA 4Q04A 2M8UA 1SBJA 4M2PA 2COLB 3SG3A 1DJYA 1DT7B 2CCMA 1QX7A 1XYDA 2JT0A 1UHKA 1XO5A 2JU0A 4I5KA 1CTRA 2DOQA 2LNKA 1L7ZA 1WRLA 2JULA 1A75A 1JFJA 1FF1A 4AQIA 3SIAA 4PCWA 1S5GZ 3DVEA 1IJ5A 5I2OA 1WY9A 1MXLC 2KQ6A 5HYDA 2P6BB 1SCMC 2LCPA 4C0KA 1BU3A 3CLNA 5BPJA 3VRQA 1PSBA 4IL1A 2KBIA 2HQWA 2L5XB 2JZIA 1SR6C 2G2BA 1Y6WA 2JPTA 3DF0B 4HRHA 4YRUA 3FIAA 3C1VA 5B8IB 1K2HA 3CR5X 1ZFSA 4BY4A 1F54A 5DKNA 3TS5C 3ZWHA 3I5FC 2L50A 1WLMA 3KEVA 1TN4A 1BG1A 2JNXA 2MBXA 1N2DA 1MUXA 2KSPA 4PE1A 1KFXL 1GJYA 1S5GY 1M31A 2F2PA 2ZNEA 3IQOA 3DVJA 4ZCUA 1A03A 1TNQA 4QJ5B 2NXQA 4R1EA 1YUUA 1QLKA 2BBMA 1S6IA 2K61A 2WCEA 2ZN9A 3JVTC 4I5JA 1F4QA 3I5FB 3BOWB 2LMVA 2EHBA 4PHJA 1DJZA 3F45A 1BT6A 2M97A 4GGFC 2JC2A 3KF9A 3OB1B 2L51A 1M39A 4PHMA 3CZTX 3JTDC 1QIWA 1NPQA 4F0ZB 1SYMA 1YVHA 2PVBA 3D0YB 5KU1A 1TCOB 2KI4C 4YBHB 2SASA 2M3WA 1JBAA 2F3ZA 1DJGA 4QJ3B 1SL7A 2LVKA 1IGVA 4L9MA 2BBNA 1JSAA 1JUOA 3HCMA 1QASA 2M1UA 1J55A 1Y1UA 1V1GA 1OSAA 2KI4B 4XJKA 1NUBA 1EG3A 1CM4A 3SG4A 4NDDA 3KHEA 1XFVO 1LINA 1FI5A 3E3RA 3LL8B 1S36A 3EK7A 1J1EA 1B8LA 2JRFA 1NCXA 2AAOA 2OTGC 2GGMA 4JWQA 1A4PA 1WDCC 1PK0D 2BL0C 3GK4X 1A29A 2M29A 2QPTA 1DTLA 1S6CA 1Y1XA 3I5GC 4MLWA 4PDZA 1BLQA 1CMGA 2K7CA 2ISDA 2KOTA 2LAPA 1XFWO 2K2AA 1UHJA 5IBWA 5HKYA 1SL9A 4WQ3A 1L2OC 2B1UA 2WCFA 3TDUA 1Y1AA 1CMFA 2OS8C 1BF5A 4QJ4B 1KQMB 3BYAA 5HLOA 4C0JA 2LMUA 5JOLA 3RM1A 1ZOTB 2VRGA 3RLZA 4ETOA 1YTZC 3TZ1A 1UP5A 2K0JA 1B1GA 5I8NA 2I18A 2JXCA 4MVFA 1XK4C 1YUTA 1E8AA 4PE7A 1UUSA 3I5HC 1DJWA 1QXPA 3BXKA 4NDBA 1CDNA 4I5LB 1IWQA 1LVCD 1DGVA 1RFJA 4P2YB 1OMRA 1PRWA 4PE0A 3TUYB 1A75B 1G33A 2GV5A 2LLSA 2LUXA 1OQPA 1PALA 3PALA 5D7FA 1KQVA 4USLA 2F3YA 1UHIA 2RGIA 1QV0A 3EVVA 3VRRA 3SIBA 2NCOA 1GGWA 2LVIA 3GK2A 1SL8A 2BECA 2CNPA 1TNWA 2LM5A 2HF5A 3O2PA 1XFZO 4D1EA 1HT9A 4ORCB 2OPOA 4GUKA 3CTNA 2LP3A 5I2QA 1XVJA 1QJTA 3QRXA 1NYAA 2BCXA 2H61A 3SG2A 4C0LA 3OP0A 3VROA 2JT8A 1A2XA 1XFYO 1J1DA 2IS9A 3LCPC 1B4CA 3PM8A 4OVNF 1NP8A 4CPVA 2E30A 4DIRA 1WLZA 1SRAA 2MA2A 1W7JB 1WRZA 5HKWA 1TRFA 2AUCA 1CDMA 1U5IA 4DRWA 1FPWA 3TDZA 1K96A 1Q80A 3BUMB 4PHNA 3CR2A 4FTGA 1CFFA 4ORBB 1NSHA 4XJKB 1BMOA 4MRYA 2L4IA 3PFVA 2ZNDA 2D8NA 1OOJA 2KBMA 1V1FA 1CKKA 4YGDB 1EG4A 4MZKA 4MEWA 1DGUA 2LANA 2FCDA 3O78A 1B47A 1LXFC 2KQYA 1IQ5A 3DVMA 3NXAA 1SPYA 2KI6C 4MZJA 1H4BA 1YURA 1AVSA 3SG5A 1NCYA 1K90D 3FS7A 1ZMZA 4WQ2A 4ZCVA 2MRDA 2GGZA 2F2OA 1K94A 2PMYA 3EK4A 1EH2A 3CWGA 3VGOA 2JTZA 1KWOB 4FQOA 1LA0A 2BCAA 4U8DA 1H8BA 5ER5A 1KK8B 1RROA 1TNXA 2KFFA 1GGZA 1J7PA 3AAKA 5CSJA 3IF7A 2Y1MA 2JQ6A 5TNCA 5D69A 1JWDA 2EC6B 1OZOA 2M7NA 2Q91A 1CLBA 2Y5IA 2ZKMX 1NIWA 2HQ8A 3FWCA 3LK0A 5K89A 1KK7Z 2WNDA 2WCBA 1J7RA 1Y0VH 2K8MB 2SCPA 4CFRA 2BKIB 4MRXA 1S3PA 4GNKB 1C7VA 4ICBA 1AHRA 3AAJA 1KFUS 2ZN8A 1QX5B 1CFPA 1KFUL 5J3XA 5AERA 2KI6D 3A4UB 3MSEB 4E68A 4OCIA 1KQMC 3EVUA 1MWNA 4HSZA 1IKUA 1ZACA 1LA3A 2A4JA 2H61C 1F71A 1YRUB 1QVIZ 3EKHA 2Y1NA 2ZFDA 3DD4A 3AKBA 3GK1A 2NCPA 1MQ1A 3WNXB 3KO0A 4MSPA 2ZRSA 2FJUB 1KK7Y 3D10A 4N1GA 1TTXA 2WORA 3TUYC 2KHNA 1QX2A 1ODBA 1PULA 1FI6A 1RECA 3A8RA 2CXJA 5GQQC 1SMGA 1B8RA 1B7TZ 1NX2A 4YGEB 4AQJA 1CDPA 4PE4A 2LLTA 2E6WA 3GOFA 5HKZA 1D1OA 1TOPA 1QVIY 4YGAA 1J7OA 2EGDA 1OMDA 1CFDA 2F8PA 1DJHA 4OR9B 3CS1A 3BUWB 1UWOA 2BKHB 4I5NB 1KCYA 1YX8A 1FBVA 1XFUO 2K7BA 3EVRA 4DCKA 3O4YA 1U5IB 1F8HA 1QLSA 1OE9B 2F33A 2M9GA 3TDIA 1C07A 1B7TY 2JTTA 2LHIA 1XFXO 3I5IB 4A4CA 1SY9A 1C7WA 5CSIA 2V53A 2L0PA 4HREE 1DJXA 2MHHA 1UHHA 4M2QA 5AXIA 4HRGA 2NZ0A 1CB1A 1N65A 1R2UA 3CR4X 1B8CA 2MLFC 4PALA 2L2EA 1B9AA 4AOMA 4UPGA 3BUNB 1ZUZA 1EL4A 2O5GA 2I94A 2MJWB 1R6PA 1EXRA 2O60A 2JXLA 3SJSA 5AFPA 1F55A 3WHTB 3SG6A 3OHMB 2QACA 1KSMA 3PN7B 3CGAA 1F4OA 1BR1B 3DVKA 1S26D 4GPLB 1MHOA 3NSIA 4JPZB 5CSFA 1JF0A 1N0YA 2K7DA 1W7IB 3OX5A 1AJ4A 1K9KA 1JF2A 4YI9A 2M7LA 3PLFB 2KYCA 1G4YR 2LE9B 1SCVA 1TCFA 2FOTA 1OMVA 1S1EA 2LVJA 3FWBA 1TNPA 3O6BA 4OKHA 1UURA 3WHUB 5CPVA 2HPSA 1K95A 5AANA 3VRNA 4A4BA 3LK1A 4GAOA 1YUSA 2HETA 1DF0A 2LHLA 1S6JA 1X02A 1BOCA 2PSRA 2LMTA 3BUXB 1K8UA 1ALWA 4GBAA 2KDHA 4CLNA 5CSNA 2JNFA 1DVIA 2K2FA 1HQVA 4JQ0D 4YGBB 1KWOC 1XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRK A;  2AMI A;  1NX0 A;  1SKT A;  2LLU A;  5DKR A;  1KK8 C;  1K9U A;  4CFQ A;  5KTY A;  3OX6 A;  3SG7 A;  1RTP 1;  2PRU A;  4N1F A;  2EC6 C;  2KAX A;  2CT9 A;  1SCM B;  1M63 B;  1NCZ A;  1DMO A;  2KGR A;  2L4H A;  3ICB A;  1BOD A;  2JWW A;  1KFX S;  3PAT A;  4DS7 A;  5KSZ A;  2Y4Q A;  1RJV A;  5G08 A;  1SR6 B;  3BQ3 A;  2JOJ A;  2KAV A;  5FYX A;  2JT3 A;  1ALV A;  1BJF A;  2L98 A;  3TS5 B;  1RK9 A;  1YVL A;  1CDL A;  1TIZ A;  2I7A A;  3K21 A;  2MLE C;  3NSO A;  1KSO A;  2KNE A;  1IRJ A;  1PVA A;  5ER4 X;  1YRT B;  1CLM A;  1UHN A;  2LUC A;  1QS7 A;  1RWY A;  2BCB A;  2M1K B;  3VRP A;  2PAS A;  2WC8 A;  3JVT B;  1QAT A;  5HLV A;  2BE6 A;  1CFC A;  2KFG A;  3WXA A;  3AKA A;  3NSK A;  3OB2 B;  5DKQ A;  2CTN A;  1BR4 B;  4MN0 A;  1IQ3 A;  2LC5 A;  1CM1 A;  1MF8 B;  3NSL A;  3JTD B;  4CID A;  1AP4 A;  1K9P A;  2ZRT A;  1VRK A;  2KYF A;  1PVB A;  3DF0 A;  3EKJ A;  2Q4U A;  1LKJ A;  2M0R A;  1M45 A;  4DUQ A;  2LP2 A;  3PSR A;  1JC2 A;  4WRI A;  4MZL A;  1MR8 A;  1M46 A;  2K7O A;  2PAL A;  2H2K A;  1FW4 A;  2LVV A;  3M0W A;  4OV2 A;  1SK6 D;  3KPX A;  5PAL A;  5JJG A;  4N5X A;  1QV1 A;  2TN4 A;  1IH0 A;  2KFH A;  1EJ3 A;  3BOW A;  4YGC B;  2LV7 A;  1NX3 A;  3I5I C;  2CBL A;  1QIV A;  4P5O E;  2OTG B;  4ORA B;  1MXE A;  4TNC A;  4XYN A;  4YI8 A;  2I2R E;  1WDC B;  1CNP A;  5I2L A;  2BE4 A;  2BL0 B;  2R2I A;  1F70 A;  1K93 D;  4NQG A;  1PSR A;  3I5G B;  5AEQ A;  1OZS A;  3D0Y A;  2KAY A;  1DF0 B;  1IJ6 A;  3HX4 A;  4GGF A;  1JFK A;  1L2O B;  1YX7 A;  4NDC A;  1YR5 A;  4M2O A;  2OS8 B;  4GFT A;  2FCE A;  2MAZ A;  4GGN A;  3BUO B;  4PHK A;  3LLE A;  1GQM A;  1CLL A;  2NLN A;  2M49 B;  3PN7 C;  1SW8 A;  2G9B A;  3I5H B;  1AK8 A;  3H4S E;  2KGB C;  5F6T A;  1IG5 A;  1QTX A;  1AUI B;  1J7Q A;  2WOS A;  4BY5 A;  1NX1 A;  3IQQ A;  1XA5 A;  1SNL A;  1DJI A;  1G8I A;  3ZNI A;  3EK8 A;  1AJ5 A;  1NWD A;  4MBE A;  4Q04 A;  2M8U A;  1SBJ A;  4M2P A;  2COL B;  3SG3 A;  1DJY A;  1DT7 B;  2CCM A;  1QX7 A;  1XYD A;  2JT0 A;  1UHK A;  1XO5 A;  2JU0 A;  4I5K A;  1CTR A;  2DOQ A;  2LNK A;  1L7Z A;  1WRL A;  2JUL A;  1A75 A;  1JFJ A;  1FF1 A;  4AQI A;  3SIA A;  4PCW A;  1S5G Z;  3DVE A;  1IJ5 A;  5I2O A;  1WY9 A;  1MXL C;  2KQ6 A;  5HYD A;  2P6B B;  1SCM C;  2LCP A;  4C0K A;  1BU3 A;  3CLN A;  5BPJ A;  3VRQ A;  1PSB A;  4IL1 A;  2KBI A;  2HQW A;  2L5X B;  2JZI A;  1SR6 C;  2G2B A;  1Y6W A;  2JPT A;  3DF0 B;  4HRH A;  4YRU A;  3FIA A;  3C1V A;  5B8I B;  1K2H A;  3CR5 X;  1ZFS A;  4BY4 A;  1F54 A;  5DKN A;  3TS5 C;  3ZWH A;  3I5F C;  2L50 A;  1WLM A;  3KEV A;  1TN4 A;  1BG1 A;  2JNX A;  2MBX A;  1N2D A;  1MUX A;  2KSP A;  4PE1 A;  1KFX L;  1GJY A;  1S5G Y;  1M31 A;  2F2P A;  2ZNE A;  3IQO A;  3DVJ A;  4ZCU A;  1A03 A;  1TNQ A;  4QJ5 B;  2NXQ A;  4R1E A;  1YUU A;  1QLK A;  2BBM A;  1S6I A;  2K61 A;  2WCE A;  2ZN9 A;  3JVT C;  4I5J A;  1F4Q A;  3I5F B;  3BOW B;  2LMV A;  2EHB A;  4PHJ A;  1DJZ A;  3F45 A;  1BT6 A;  2M97 A;  4GGF C;  2JC2 A;  3KF9 A;  3OB1 B;  2L51 A;  1M39 A;  4PHM A;  3CZT X;  3JTD C;  1QIW A;  1NPQ A;  4F0Z B;  1SYM A;  1YVH A;  2PVB A;  3D0Y B;  5KU1 A;  1TCO B;  2KI4 C;  4YBH B;  2SAS A;  2M3W A;  1JBA A;  2F3Z A;  1DJG A;  4QJ3 B;  1SL7 A;  2LVK A;  1IGV A;  4L9M A;  2BBN A;  1JSA A;  1JUO A;  3HCM A;  1QAS A;  2M1U A;  1J55 A;  1Y1U A;  1V1G A;  1OSA A;  2KI4 B;  4XJK A;  1NUB A;  1EG3 A;  1CM4 A;  3SG4 A;  4NDD A;  3KHE A;  1XFV O;  1LIN A;  1FI5 A;  3E3R A;  3LL8 B;  1S36 A;  3EK7 A;  1J1E A;  1B8L A;  2JRF A;  1NCX A;  2AAO A;  2OTG C;  2GGM A;  4JWQ A;  1A4P A;  1WDC C;  1PK0 D;  2BL0 C;  3GK4 X;  1A29 A;  2M29 A;  2QPT A;  1DTL A;  1S6C A;  1Y1X A;  3I5G C;  4MLW A;  4PDZ A;  1BLQ A;  1CMG A;  2K7C A;  2ISD A;  2KOT A;  2LAP A;  1XFW O;  2K2A A;  1UHJ A;  5IBW A;  5HKY A;  1SL9 A;  4WQ3 A;  1L2O C;  2B1U A;  2WCF A;  3TDU A;  1Y1A A;  1CMF A;  2OS8 C;  1BF5 A;  4QJ4 B;  1KQM B;  3BYA A;  5HLO A;  4C0J A;  2LMU A;  5JOL A;  3RM1 A;  1ZOT B;  2VRG A;  3RLZ A;  4ETO A;  1YTZ C;  3TZ1 A;  1UP5 A;  2K0J A;  1B1G A;  5I8N A;  2I18 A;  2JXC A;  4MVF A;  1XK4 C;  1YUT A;  1E8A A;  4PE7 A;  1UUS A;  3I5H C;  1DJW A;  1QXP A;  3BXK A;  4NDB A;  1CDN A;  4I5L B;  1IWQ A;  1LVC D;  1DGV A;  1RFJ A;  4P2Y B;  1OMR A;  1PRW A;  4PE0 A;  3TUY B;  1A75 B;  1G33 A;  2GV5 A;  2LLS A;  2LUX A;  1OQP A;  1PAL A;  3PAL A;  5D7F A;  1KQV A;  4USL A;  2F3Y A;  1UHI A;  2RGI A;  1QV0 A;  3EVV A;  3VRR A;  3SIB A;  2NCO A;  1GGW A;  2LVI A;  3GK2 A;  1SL8 A;  2BEC A;  2CNP A;  1TNW A;  2LM5 A;  2HF5 A;  3O2P A;  1XFZ O;  4D1E A;  1HT9 A;  4ORC B;  2OPO A;  4GUK A;  3CTN A;  2LP3 A;  5I2Q A;  1XVJ A;  1QJT A;  3QRX A;  1NYA A;  2BCX A;  2H61 A;  3SG2 A;  4C0L A;  3OP0 A;  3VRO A;  2JT8 A;  1A2X A;  1XFY O;  1J1D A;  2IS9 A;  3LCP C;  1B4C A;  3PM8 A;  4OVN F;  1NP8 A;  4CPV A;  2E30 A;  4DIR A;  1WLZ A;  1SRA A;  2MA2 A;  1W7J B;  1WRZ A;  5HKW A;  1TRF A;  2AUC A;  1CDM A;  1U5I A;  4DRW A;  1FPW A;  3TDZ A;  1K96 A;  1Q80 A;  3BUM B;  4PHN A;  3CR2 A;  4FTG A;  1CFF A;  4ORB B;  1NSH A;  4XJK B;  1BMO A;  4MRY A;  2L4I A;  3PFV A;  2ZND A;  2D8N A;  1OOJ A;  2KBM A;  1V1F A;  1CKK A;  4YGD B;  1EG4 A;  4MZK A;  4MEW A;  1DGU A;  2LAN A;  2FCD A;  3O78 A;  1B47 A;  1LXF C;  2KQY A;  1IQ5 A;  3DVM A;  3NXA A;  1SPY A;  2KI6 C;  4MZJ A;  1H4B A;  1YUR A;  1AVS A;  3SG5 A;  1NCY A;  1K90 D;  3FS7 A;  1ZMZ A;  4WQ2 A;  4ZCV A;  2MRD A;  2GGZ A;  2F2O A;  1K94 A;  2PMY A;  3EK4 A;  1EH2 A;  3CWG A;  3VGO A;  2JTZ A;  1KWO B;  4FQO A;  1LA0 A;  2BCA A;  4U8D A;  1H8B A;  5ER5 A;  1KK8 B;  1RRO A;  1TNX A;  2KFF A;  1GGZ A;  1J7P A;  3AAK A;  5CSJ A;  3IF7 A;  2Y1M A;  2JQ6 A;  5TNC A;  5D69 A;  1JWD A;  2EC6 B;  1OZO A;  2M7N A;  2Q91 A;  1CLB A;  2Y5I A;  2ZKM X;  1NIW A;  2HQ8 A;  3FWC A;  3LK0 A;  5K89 A;  1KK7 Z;  2WND A;  2WCB A;  1J7R A;  1Y0V H;  2K8M B;  2SCP A;  4CFR A;  2BKI B;  4MRX A;  1S3P A;  4GNK B;  1C7V A;  4ICB A;  1AHR A;  3AAJ A;  1KFU S;  2ZN8 A;  1QX5 B;  1CFP A;  1KFU L;  5J3X A;  5AER A;  2KI6 D;  3A4U B;  3MSE B;  4E68 A;  4OCI A;  1KQM C;  3EVU A;  1MWN A;  4HSZ A;  1IKU A;  1ZAC A;  1LA3 A;  2A4J A;  2H61 C;  1F71 A;  1YRU B;  1QVI Z;  3EKH A;  2Y1N A;  2ZFD A;  3DD4 A;  3AKB A;  3GK1 A;  2NCP A;  1MQ1 A;  3WNX B;  3KO0 A;  4MSP A;  2ZRS A;  2FJU B;  1KK7 Y;  3D10 A;  4N1G A;  1TTX A;  2WOR A;  3TUY C;  2KHN A;  1QX2 A;  1ODB A;  1PUL A;  1FI6 A;  1REC A;  3A8R A;  2CXJ A;  5GQQ C;  1SMG A;  1B8R A;  1B7T Z;  1NX2 A;  4YGE B;  4AQJ A;  1CDP A;  4PE4 A;  2LLT A;  2E6W A;  3GOF A;  5HKZ A;  1D1O A;  1TOP A;  1QVI Y;  4YGA A;  1J7O A;  2EGD A;  1OMD A;  1CFD A;  2F8P A;  1DJH A;  4OR9 B;  3CS1 A;  3BUW B;  1UWO A;  2BKH B;  4I5N B;  1KCY A;  1YX8 A;  1FBV A;  1XFU O;  2K7B A;  3EVR A;  4DCK A;  3O4Y A;  1U5I B;  1F8H A;  1QLS A;  1OE9 B;  2F33 A;  2M9G A;  3TDI A;  1C07 A;  1B7T Y;  2JTT A;  2LHI A;  1XFX O;  3I5I B;  4A4C A;  1SY9 A;  1C7W A;  5CSI A;  2V53 A;  2L0P A;  4HRE E;  1DJX A;  2MHH A;  1UHH A;  4M2Q A;  5AXI A;  4HRG A;  2NZ0 A;  1CB1 A;  1N65 A;  1R2U A;  3CR4 X;  1B8C A;  2MLF C;  4PAL A;  2L2E A;  1B9A A;  4AOM A;  4UPG A;  3BUN B;  1ZUZ A;  1EL4 A;  2O5G A;  2I94 A;  2MJW B;  1R6P A;  1EXR A;  2O60 A;  2JXL A;  3SJS A;  5AFP A;  1F55 A;  3WHT B;  3SG6 A;  3OHM B;  2QAC A;  1KSM A;  3PN7 B;  3CGA A;  1F4O A;  1BR1 B;  3DVK A;  1S26 D;  4GPL B;  1MHO A;  3NSI A;  4JPZ B;  5CSF A;  1JF0 A;  1N0Y A;  2K7D A;  1W7I B;  3OX5 A;  1AJ4 A;  1K9K A;  1JF2 A;  4YI9 A;  2M7L A;  3PLF B;  2KYC A;  1G4Y R;  2LE9 B;  1SCV A;  1TCF A;  2FOT A;  1OMV A;  1S1E A;  2LVJ A;  3FWB A;  1TNP A;  3O6B A;  4OKH A;  1UUR A;  3WHU B;  5CPV A;  2HPS A;  1K95 A;  5AAN A;  3VRN A;  4A4B A;  3LK1 A;  4GAO A;  1YUS A;  2HET A;  1DF0 A;  2LHL A;  1S6J A;  1X02 A;  1BOC A;  2PSR A;  2LMT A;  3BUX B;  1K8U A;  1ALW A;  4GBA A;  2KDH A;  4CLN A;  5CSN A;  2JNF A;  1DVI A;  2K2F A;  1HQV A;  4JQ0 D;  4YGB B;  1KWO C;  1XK4 A; 
#chains in the Genus database with same CATH topology
 1WRK A;  2AMI A;  3BFA A;  3OBV A;  1NX0 A;  1SKT A;  2LLU A;  5DKR A;  1KK8 C;  1K9U A;  4CFQ A;  4MVF A;  5KTY A;  3S0B A;  3OX6 A;  3SG7 A;  4F7F A;  1RTP 1;  2PRU A;  4N1F A;  2EC6 C;  2KAX A;  2CT9 A;  1SCM B;  1M63 B;  1NCZ A;  1DMO A;  2KGR A;  2L4H A;  3ICB A;  1BOD A;  2JWW A;  1KFX S;  3PAT A;  4DS7 A;  5KSZ A;  2Y4Q A;  1RJV A;  5G08 A;  1SR6 B;  4IJ7 A;  3BQ3 A;  2JOJ A;  2KAV A;  5FYX A;  2JT3 A;  1ALV A;  1BJF A;  2L98 A;  2PYQ A;  1QWV A;  3TS5 B;  3Q8I A;  1RK9 A;  1YVL A;  1CDL A;  1TIZ A;  2I7A A;  3K21 A;  2MLE C;  3NSO A;  1KSO A;  2KNE A;  1IRJ A;  3NHI A;  1PVA A;  5ER4 X;  1YRT B;  1CLM A;  1UHN A;  2LUC A;  1QS7 A;  1RWY A;  2BCB A;  2M1K B;  3VRP A;  2PAS A;  2WC8 A;  2KPH A;  3JVT B;  1QAT A;  5HLV A;  2BE6 A;  1CFC A;  2KFG A;  3WXA A;  3AKA A;  3NSK A;  3OB2 B;  5DKQ A;  2CTN A;  1BR4 B;  3B86 A;  1GM0 A;  4MN0 A;  1IQ3 A;  2LC5 A;  1CM1 A;  1MF8 B;  3NSL A;  3JTD B;  4CID A;  1AP4 A;  1K9P A;  2ZRT A;  1VRK A;  2KYF A;  1PVB A;  3DF0 A;  3EKJ A;  2Q4U A;  1LKJ A;  3RZS A;  3CAB A;  2M0R A;  1M45 A;  4DUQ A;  2LP2 A;  3PSR A;  1JC2 A;  3FE9 A;  4WRI A;  4MZL A;  1MR8 A;  3EG5 B;  3IVT A;  1M46 A;  2K7O A;  2PAL A;  2H2K A;  1FW4 A;  1DEK A;  2LVV A;  3M0W A;  1SK6 D;  3KPX A;  4OV2 A;  5JJG A;  4N5X A;  5EL2 A;  5HL1 A;  1QV1 A;  2TN4 A;  1IH0 A;  2KFH A;  1EJ3 A;  1OOI X;  3BOW A;  4YGC B;  1OW4 A;  2LV7 A;  1NX3 A;  3I5I C;  2CBL A;  1QIV A;  4P5O E;  2OTG B;  4ORA B;  1MXE A;  4TNC A;  4XYN A;  4YI8 A;  2I2R E;  1WDC B;  1CNP A;  2JPO A;  5I2L A;  2BE4 A;  2BL0 B;  2R2I A;  1F70 A;  1K93 D;  4NQG A;  1PSR A;  3I5G B;  5AEQ A;  1OZS A;  3D0Y A;  3QME A;  2KAY A;  1DF0 B;  1IJ6 A;  3HX4 A;  4GGF A;  1JFK A;  1L2O B;  1YX7 A;  3UNW A;  3SS4 A;  4NDC A;  1YR5 A;  4M2O A;  2OS8 B;  4GFT A;  2FCE A;  3NHT A;  2MAZ A;  1TUJ A;  3BUO B;  4GGN A;  4PHK A;  3PJI A;  3S0A A;  3LLE A;  2BNX A;  1GQM A;  2PQL A;  1CLL A;  2NLN A;  2M49 B;  3PN7 C;  1SW8 A;  2G9B A;  3S0F A;  3I5H B;  1AK8 A;  2BAP A;  3H4S E;  2KGB C;  5F6T A;  1IG5 A;  1QTX A;  1AUI B;  2L5Y A;  1J7Q A;  2WOS A;  3D77 A;  1NX1 A;  4BY5 A;  2WC5 A;  3IQQ A;  1XA5 A;  1SNL A;  1DJI A;  1G8I A;  3ZNI A;  3EK8 A;  1AJ5 A;  1NWD A;  4MBE A;  4Q04 A;  2M8U A;  1SBJ A;  4M2P A;  2COL B;  3SG3 A;  1DJY A;  1C3Y A;  1DT7 B;  2CCM A;  1QX7 A;  1XYD A;  2JT0 A;  3R1V A;  2FJY A;  4JKT A;  1UHK A;  1XO5 A;  2JU0 A;  4I5K A;  2WCK A;  1CTR A;  2DOQ A;  2LNK A;  1L7Z A;  1WRL A;  2JUL A;  1A75 A;  1JFJ A;  1FF1 A;  3CDN A;  4AQI A;  3SIA A;  4PCW A;  1S5G Z;  3DVE A;  1IJ5 A;  5I2O A;  1WY9 A;  1MXL C;  2KQ6 A;  3D75 A;  5HYD A;  2P6B B;  1SCM C;  2LCP A;  4C0K A;  1BU3 A;  1OOH A;  3CLN A;  3VRQ A;  1PSB A;  5BPJ A;  4IL1 A;  2KBI A;  2HQW A;  1Z2C B;  1C3Z A;  2JZI A;  2L5X B;  1SR6 C;  2G2B A;  1Y6W A;  1DEL A;  2GTE A;  2JPT A;  3DF0 B;  4HRH A;  4YRU A;  3FIA A;  3C1V A;  5B8I B;  1K2H A;  3CR5 X;  1ZFS A;  4BY4 A;  1F54 A;  2QEV A;  5DKN A;  3TS5 C;  3ZWH A;  3I5F C;  2L50 A;  1WLM A;  3KEV A;  1IIO A;  1TN4 A;  1BG1 A;  2JNX A;  2MBX A;  1N2D A;  1MUX A;  2KSP A;  4PE1 A;  1KFX L;  1GJY A;  1S5G Y;  1M31 A;  2F2P A;  2ZNE A;  3B6X A;  3DVJ A;  3IQO A;  4ZCU A;  1TNQ A;  4QJ5 B;  2NXQ A;  4R1E A;  1A03 A;  1YUU A;  1QLK A;  1W9Z A;  2BBM A;  1S6I A;  2K61 A;  2WCE A;  2ZN9 A;  3JVT C;  4I5J A;  1F4Q A;  3I5F B;  3BOW B;  2LMV A;  2EHB A;  4PHJ A;  1DJZ A;  3F45 A;  1BT6 A;  2M97 A;  4GGF C;  2JC2 A;  3KF9 A;  3OB1 B;  2L51 A;  1M39 A;  3SS3 A;  4PHM A;  3CZT X;  4INW A;  3JTD C;  1QIW A;  1NPQ A;  4F0Z B;  1SYM A;  1YVH A;  2PVB A;  3D0Y B;  3R72 A;  5KU1 A;  1TCO B;  2KI4 C;  4YBH B;  2SAS A;  2M3W A;  1JBA A;  2F3Z A;  2WCH A;  3BFH A;  1DJG A;  4QJ3 B;  3FE6 A;  1SL7 A;  2LVK A;  1IGV A;  4L9M A;  2BBN A;  3CYZ A;  1JUO A;  3L4A A;  1JSA A;  3HCM A;  1ORG A;  1QAS A;  2M1U A;  1J55 A;  1Y1U A;  1V1G A;  1OSA A;  2KI4 B;  4XJK A;  1NUB A;  1EG3 A;  1CM4 A;  4KYN A;  4NDD A;  3SG4 A;  3KHE A;  3K1E A;  1XFV O;  1LIN A;  1FI5 A;  3E3R A;  3LL8 B;  1S36 A;  3EK7 A;  3PM2 A;  1J1E A;  1B8L A;  2JRF A;  1NCX A;  2AAO A;  2OTG C;  2GGM A;  4JWQ A;  3NGV A;  3S0G A;  1A4P A;  1WDC C;  1PK0 D;  1Z4H A;  2BL0 C;  3GK4 X;  1A29 A;  2M29 A;  2QPT A;  1DTL A;  1S6C A;  1Y1X A;  3I5G C;  4MLW A;  4PDZ A;  1T14 A;  1BLQ A;  1CMG A;  2K7C A;  2ISD A;  2KOT A;  2LAP A;  1XFW O;  2K2A A;  1DQE A;  1UHJ A;  5IBW A;  5HKY A;  1SL9 A;  4WQ3 A;  1L2O C;  2B1U A;  2WCF A;  3TDU A;  1Y1A A;  1CMF A;  2OS8 C;  1BF5 A;  4QJ4 B;  5FI7 A;  1KQM B;  3BYA A;  5HLO A;  4C0J A;  2LMU A;  5JOL A;  3RM1 A;  1ZOT B;  2VRG A;  3D73 A;  3RLZ A;  4ETO A;  1YTZ C;  3D78 A;  3TZ1 A;  1UP5 A;  2K0J A;  1B1G A;  5I8N A;  2H8V A;  2WCL A;  2I18 A;  2JXC A;  2QEH A;  3B7A A;  3BFB A;  1XK4 C;  3DZT A;  1YUT A;  1E8A A;  2YGU A;  3N7H A;  1UUS A;  2P70 A;  3I5H C;  4PE7 A;  1DJW A;  1QXP A;  3BXK A;  4NDB A;  1CDN A;  4I5L B;  1IWQ A;  1LVC D;  1DGV A;  1RFJ A;  4P2Y B;  3L47 A;  1OMR A;  1PRW A;  3DXL A;  4PE0 A;  1A75 B;  1G33 A;  2GV5 A;  2LLS A;  2LUX A;  1OQP A;  1PAL A;  3PAL A;  3UO9 A;  5D7F A;  1KQV A;  4USL A;  2F3Y A;  1UHI A;  2RGI A;  3L4L A;  2WCJ A;  1QV0 A;  3EVV A;  3VRR A;  3SIB A;  2NCO A;  3S0E A;  1GGW A;  3DYE A;  2LVI A;  3GK2 A;  1SL8 A;  2BEC A;  2CNP A;  1TNW A;  2LM5 A;  2HF5 A;  3O2P A;  1XFZ O;  4D1E A;  1HT9 A;  4ORC B;  2OPO A;  4GUK A;  3CTN A;  2LP3 A;  5I2Q A;  1XVJ A;  1P28 A;  1QJT A;  3QRX A;  1NYA A;  2BCX A;  5DIC A;  2H61 A;  3SG2 A;  4C0L A;  3OP0 A;  3VRO A;  2WCM A;  2JT8 A;  1A2X A;  1XFY O;  1J1D A;  2IS9 A;  3LCP C;  1B4C A;  3PM8 A;  4OVN F;  1NP8 A;  2L2C A;  4CPV A;  2E30 A;  4DIR A;  1WLZ A;  1SRA A;  3D76 A;  3D74 A;  2MA2 A;  1W7J B;  1WRZ A;  2KLD A;  5HKW A;  1TRF A;  2QDI A;  2AUC A;  1CDM A;  1U5I A;  1TWO A;  4DRW A;  1FPW A;  3TDZ A;  1K96 A;  1Q80 A;  3TUY B;  3BUM B;  4PHN A;  3V2L A;  3CR2 A;  3CZ0 A;  4FTG A;  1CFF A;  4ORB B;  1NSH A;  4XJK B;  5D3O A;  1BMO A;  4MRY A;  2ERB A;  2L4I A;  3PFV A;  2ZND A;  2D8N A;  1OOJ A;  2KBM A;  1V1F A;  3DY9 A;  1CKK A;  4YGD B;  1EG4 A;  4MZK A;  4JD9 A;  1DGU A;  2LAN A;  2FCD A;  3O78 A;  4FQT A;  4MEW A;  1B47 A;  1LXF C;  2KQY A;  3OGN A;  1IQ5 A;  3DVM A;  3NXA A;  1SPY A;  2KI6 C;  4MZJ A;  1H4B A;  1YUR A;  2WC6 A;  1AVS A;  3SG5 A;  1NCY A;  1K90 D;  3FS7 A;  1ZMZ A;  4WQ2 A;  4ZCV A;  2MRD A;  2GGZ A;  3CZ2 A;  2F2O A;  1K94 A;  2PMY A;  3EK4 A;  1EH2 A;  3CWG A;  3VGO A;  2JTZ A;  1KWO B;  4FQO A;  1LA0 A;  2BCA A;  4U8D A;  1H8B A;  5ER5 A;  1KK8 B;  1RRO A;  1TNX A;  5FI6 A;  2KFF A;  1GGZ A;  1J7P A;  3AAK A;  5CSJ A;  3IF7 A;  2Y1M A;  2JQ6 A;  5TNC A;  5D69 A;  3O4X A;  4PT1 A;  1JWD A;  2EC6 B;  3VB1 A;  1OZO A;  2M7N A;  2Q91 A;  1CLB A;  2Y5I A;  2ZKM X;  1NIW A;  2HQ8 A;  3FWC A;  3LK0 A;  5K89 A;  1KK7 Z;  2WND A;  2WCB A;  3S0D A;  1J7R A;  1Y0V H;  2K8M B;  2SCP A;  4CFR A;  2BKI B;  4MRX A;  1S3P A;  4GNK B;  1C7V A;  4ICB A;  1AHR A;  3AAJ A;  1KFU S;  2ZN8 A;  1QX5 B;  1CFP A;  1KFU L;  1OOG A;  5J3X A;  5AER A;  2KI6 D;  3A4U B;  3FE8 A;  3MSE B;  4E68 A;  4OCI A;  1KQM C;  3EVU A;  1MWN A;  4HSZ A;  1IKU A;  1ZAC A;  1LA3 A;  2A4J A;  2H61 C;  1F71 A;  1YRU B;  1QVI Z;  3EKH A;  2Y1N A;  2ZFD A;  3DD4 A;  3AKB A;  3GK1 A;  2NCP A;  1MQ1 A;  3WNX B;  1SSE B;  3KO0 A;  2ZRS A;  4MSP A;  2FJU B;  2P71 A;  1KK7 Y;  3D10 A;  4N1G A;  3B87 A;  1TTX A;  2WOR A;  3B88 A;  1TUZ A;  2KHN A;  3TUY C;  1DC1 A;  1QX2 A;  1ODB A;  1PUL A;  1FI6 A;  1REC A;  3A8R A;  2CXJ A;  5GQQ C;  1SMG A;  1B8R A;  1B7T Z;  1NX2 A;  4YGE B;  4AQJ A;  2KLE A;  1CDP A;  4PE4 A;  2LLT A;  2E6W A;  3GOF A;  5HKZ A;  1D1O A;  1TOP A;  1QVI Y;  4YGA A;  1J7O A;  2EGD A;  1OMD A;  1CFD A;  2F8P A;  1DJH A;  4OR9 B;  3CS1 A;  3BUW B;  1UWO A;  2BKH B;  1OOF A;  3R1O A;  4I5N B;  1KCY A;  1YX8 A;  5PAL A;  1FBV A;  1XFU O;  1XFR A;  2K7B A;  3CZ1 A;  3EVR A;  3SS5 A;  3O4Y A;  1U5I B;  4DCK A;  1F8H A;  1QLS A;  1OE9 B;  2F33 A;  3BJH A;  2M9G A;  3TDI A;  1C07 A;  1B7T Y;  2JTT A;  2LHI A;  1XFX O;  3I5I B;  4A4C A;  1SY9 A;  1C7W A;  5CSI A;  2V53 A;  2L0P A;  4HRE E;  1DJX A;  2MHH A;  1UHH A;  4M2Q A;  5AXI A;  4HRG A;  2NZ0 A;  1CB1 A;  1N65 A;  1R2U A;  3CR4 X;  1B8C A;  2MLF C;  4PAL A;  2L2E A;  1B9A A;  4AOM A;  1LS8 A;  4UPG A;  3BUN B;  1ZUZ A;  4OZD A;  1EL4 A;  2O5G A;  2I94 A;  2MJW B;  1R6P A;  1EXR A;  2O60 A;  2JXL A;  3SJS A;  5AFP A;  1F55 A;  3WHT B;  3SG6 A;  5I94 A;  3OHM B;  2QAC A;  1KSM A;  3PN7 B;  3CGA A;  1F4O A;  1BR1 B;  3DVK A;  1S26 D;  4GPL B;  1MHO A;  3NSI A;  4JPZ B;  5CSF A;  1JF0 A;  1N0Y A;  2K7D A;  1W7I B;  3OX5 A;  1AJ4 A;  1K9K A;  1JF2 A;  4YI9 A;  2M7L A;  3PLF B;  2KYC A;  1G4Y R;  2LE9 B;  2QEO A;  1SCV A;  1TCF A;  2FOT A;  1OMV A;  1S1E A;  2LVJ A;  3FWB A;  1TNP A;  3O6B A;  4OKH A;  1UUR A;  3WHU B;  5CPV A;  2HPS A;  1K95 A;  5AAN A;  5FI2 A;  4INX A;  3LK1 A;  4GAO A;  3VRN A;  1YUS A;  4A4B A;  2HET A;  1DF0 A;  3R1P A;  2LHL A;  1S6J A;  1X02 A;  1BOC A;  2PSR A;  2K60 A;  2LMT A;  3BUX B;  1K8U A;  1ALW A;  4GBA A;  2KDH A;  4CLN A;  5CSN A;  2QEB A;  2JNF A;  1DVI A;  2K2F A;  1HQV A;  4JQ0 D;  4YGB B;  1KWO C;  1XK4 A; 
#chains in the Genus database with same CATH homology
 1WRK A;  2AMI A;  1NX0 A;  1SKT A;  2LLU A;  5DKR A;  1KK8 C;  1K9U A;  4CFQ A;  5KTY A;  3OX6 A;  3SG7 A;  1RTP 1;  2PRU A;  4N1F A;  2EC6 C;  2KAX A;  2CT9 A;  1SCM B;  1M63 B;  1NCZ A;  1DMO A;  2KGR A;  2L4H A;  3ICB A;  1BOD A;  2JWW A;  1KFX S;  3PAT A;  4DS7 A;  5KSZ A;  2Y4Q A;  1RJV A;  5G08 A;  1SR6 B;  3BQ3 A;  2JOJ A;  2KAV A;  5FYX A;  2JT3 A;  1ALV A;  1BJF A;  2L98 A;  3TS5 B;  1RK9 A;  1YVL A;  1CDL A;  1TIZ A;  2I7A A;  3K21 A;  2MLE C;  3NSO A;  1KSO A;  2KNE A;  1IRJ A;  1PVA A;  5ER4 X;  1YRT B;  1CLM A;  1UHN A;  2LUC A;  1QS7 A;  1RWY A;  2BCB A;  2M1K B;  3VRP A;  2PAS A;  2WC8 A;  3JVT B;  1QAT A;  5HLV A;  2BE6 A;  1CFC A;  2KFG A;  3WXA A;  3AKA A;  3NSK A;  3OB2 B;  5DKQ A;  2CTN A;  1BR4 B;  4MN0 A;  1IQ3 A;  2LC5 A;  1CM1 A;  1MF8 B;  3NSL A;  3JTD B;  4CID A;  1AP4 A;  1K9P A;  2ZRT A;  1VRK A;  2KYF A;  1PVB A;  3DF0 A;  3EKJ A;  2Q4U A;  1LKJ A;  2M0R A;  1M45 A;  4DUQ A;  2LP2 A;  3PSR A;  1JC2 A;  4WRI A;  4MZL A;  1MR8 A;  1M46 A;  2K7O A;  2PAL A;  2H2K A;  1FW4 A;  2LVV A;  3M0W A;  4OV2 A;  1SK6 D;  3KPX A;  5PAL A;  5JJG A;  4N5X A;  1QV1 A;  2TN4 A;  1IH0 A;  2KFH A;  1EJ3 A;  3BOW A;  4YGC B;  2LV7 A;  1NX3 A;  3I5I C;  2CBL A;  1QIV A;  4P5O E;  2OTG B;  4ORA B;  1MXE A;  4TNC A;  4XYN A;  4YI8 A;  2I2R E;  1WDC B;  1CNP A;  5I2L A;  2BE4 A;  2BL0 B;  2R2I A;  1F70 A;  1K93 D;  4NQG A;  1PSR A;  3I5G B;  5AEQ A;  1OZS A;  3D0Y A;  2KAY A;  1DF0 B;  1IJ6 A;  3HX4 A;  4GGF A;  1JFK A;  1L2O B;  1YX7 A;  4NDC A;  1YR5 A;  4M2O A;  2OS8 B;  4GFT A;  2FCE A;  2MAZ A;  4GGN A;  3BUO B;  4PHK A;  3LLE A;  1GQM A;  1CLL A;  2NLN A;  2M49 B;  3PN7 C;  1SW8 A;  2G9B A;  3I5H B;  1AK8 A;  3H4S E;  2KGB C;  5F6T A;  1IG5 A;  1QTX A;  1AUI B;  1J7Q A;  2WOS A;  4BY5 A;  1NX1 A;  3IQQ A;  1XA5 A;  1SNL A;  1DJI A;  1G8I A;  3ZNI A;  3EK8 A;  1AJ5 A;  1NWD A;  4MBE A;  4Q04 A;  2M8U A;  1SBJ A;  4M2P A;  2COL B;  3SG3 A;  1DJY A;  1DT7 B;  2CCM A;  1QX7 A;  1XYD A;  2JT0 A;  1UHK A;  1XO5 A;  2JU0 A;  4I5K A;  1CTR A;  2DOQ A;  2LNK A;  1L7Z A;  1WRL A;  2JUL A;  1A75 A;  1JFJ A;  1FF1 A;  4AQI A;  3SIA A;  4PCW A;  1S5G Z;  3DVE A;  1IJ5 A;  5I2O A;  1WY9 A;  1MXL C;  2KQ6 A;  5HYD A;  2P6B B;  1SCM C;  2LCP A;  4C0K A;  1BU3 A;  3CLN A;  5BPJ A;  3VRQ A;  1PSB A;  4IL1 A;  2KBI A;  2HQW A;  2L5X B;  2JZI A;  1SR6 C;  2G2B A;  1Y6W A;  2JPT A;  3DF0 B;  4HRH A;  4YRU A;  3FIA A;  3C1V A;  5B8I B;  1K2H A;  3CR5 X;  1ZFS A;  4BY4 A;  1F54 A;  5DKN A;  3TS5 C;  3ZWH A;  3I5F C;  2L50 A;  1WLM A;  3KEV A;  1TN4 A;  1BG1 A;  2JNX A;  2MBX A;  1N2D A;  1MUX A;  2KSP A;  4PE1 A;  1KFX L;  1GJY A;  1S5G Y;  1M31 A;  2F2P A;  2ZNE A;  3IQO A;  3DVJ A;  4ZCU A;  1A03 A;  1TNQ A;  4QJ5 B;  2NXQ A;  4R1E A;  1YUU A;  1QLK A;  2BBM A;  1S6I A;  2K61 A;  2WCE A;  2ZN9 A;  3JVT C;  4I5J A;  1F4Q A;  3I5F B;  3BOW B;  2LMV A;  2EHB A;  4PHJ A;  1DJZ A;  3F45 A;  1BT6 A;  2M97 A;  4GGF C;  2JC2 A;  3KF9 A;  3OB1 B;  2L51 A;  1M39 A;  4PHM A;  3CZT X;  3JTD C;  1QIW A;  1NPQ A;  4F0Z B;  1SYM A;  1YVH A;  2PVB A;  3D0Y B;  5KU1 A;  1TCO B;  2KI4 C;  4YBH B;  2SAS A;  2M3W A;  1JBA A;  2F3Z A;  1DJG A;  4QJ3 B;  1SL7 A;  2LVK A;  1IGV A;  4L9M A;  2BBN A;  1JSA A;  1JUO A;  3HCM A;  1QAS A;  2M1U A;  1J55 A;  1Y1U A;  1V1G A;  1OSA A;  2KI4 B;  4XJK A;  1NUB A;  1EG3 A;  1CM4 A;  3SG4 A;  4NDD A;  3KHE A;  1XFV O;  1LIN A;  1FI5 A;  3E3R A;  3LL8 B;  1S36 A;  3EK7 A;  1J1E A;  1B8L A;  2JRF A;  1NCX A;  2AAO A;  2OTG C;  2GGM A;  4JWQ A;  1A4P A;  1WDC C;  1PK0 D;  2BL0 C;  3GK4 X;  1A29 A;  2M29 A;  2QPT A;  1DTL A;  1S6C A;  1Y1X A;  3I5G C;  4MLW A;  4PDZ A;  1BLQ A;  1CMG A;  2K7C A;  2ISD A;  2KOT A;  2LAP A;  1XFW O;  2K2A A;  1UHJ A;  5IBW A;  5HKY A;  1SL9 A;  4WQ3 A;  1L2O C;  2B1U A;  2WCF A;  3TDU A;  1Y1A A;  1CMF A;  2OS8 C;  1BF5 A;  4QJ4 B;  1KQM B;  3BYA A;  5HLO A;  4C0J A;  2LMU A;  5JOL A;  3RM1 A;  1ZOT B;  2VRG A;  3RLZ A;  4ETO A;  1YTZ C;  3TZ1 A;  1UP5 A;  2K0J A;  1B1G A;  5I8N A;  2I18 A;  2JXC A;  4MVF A;  1XK4 C;  1YUT A;  1E8A A;  4PE7 A;  1UUS A;  3I5H C;  1DJW A;  1QXP A;  3BXK A;  4NDB A;  1CDN A;  4I5L B;  1IWQ A;  1LVC D;  1DGV A;  1RFJ A;  4P2Y B;  1OMR A;  1PRW A;  4PE0 A;  3TUY B;  1A75 B;  1G33 A;  2GV5 A;  2LLS A;  2LUX A;  1OQP A;  1PAL A;  3PAL A;  5D7F A;  1KQV A;  4USL A;  2F3Y A;  1UHI A;  2RGI A;  1QV0 A;  3EVV A;  3VRR A;  3SIB A;  2NCO A;  1GGW A;  2LVI A;  3GK2 A;  1SL8 A;  2BEC A;  2CNP A;  1TNW A;  2LM5 A;  2HF5 A;  3O2P A;  1XFZ O;  4D1E A;  1HT9 A;  4ORC B;  2OPO A;  4GUK A;  3CTN A;  2LP3 A;  5I2Q A;  1XVJ A;  1QJT A;  3QRX A;  1NYA A;  2BCX A;  2H61 A;  3SG2 A;  4C0L A;  3OP0 A;  3VRO A;  2JT8 A;  1A2X A;  1XFY O;  1J1D A;  2IS9 A;  3LCP C;  1B4C A;  3PM8 A;  4OVN F;  1NP8 A;  4CPV A;  2E30 A;  4DIR A;  1WLZ A;  1SRA A;  2MA2 A;  1W7J B;  1WRZ A;  5HKW A;  1TRF A;  2AUC A;  1CDM A;  1U5I A;  4DRW A;  1FPW A;  3TDZ A;  1K96 A;  1Q80 A;  3BUM B;  4PHN A;  3CR2 A;  4FTG A;  1CFF A;  4ORB B;  1NSH A;  4XJK B;  1BMO A;  4MRY A;  2L4I A;  3PFV A;  2ZND A;  2D8N A;  1OOJ A;  2KBM A;  1V1F A;  1CKK A;  4YGD B;  1EG4 A;  4MZK A;  4MEW A;  1DGU A;  2LAN A;  2FCD A;  3O78 A;  1B47 A;  1LXF C;  2KQY A;  1IQ5 A;  3DVM A;  3NXA A;  1SPY A;  2KI6 C;  4MZJ A;  1H4B A;  1YUR A;  1AVS A;  3SG5 A;  1NCY A;  1K90 D;  3FS7 A;  1ZMZ A;  4WQ2 A;  4ZCV A;  2MRD A;  2GGZ A;  2F2O A;  1K94 A;  2PMY A;  3EK4 A;  1EH2 A;  3CWG A;  3VGO A;  2JTZ A;  1KWO B;  4FQO A;  1LA0 A;  2BCA A;  4U8D A;  1H8B A;  5ER5 A;  1KK8 B;  1RRO A;  1TNX A;  2KFF A;  1GGZ A;  1J7P A;  3AAK A;  5CSJ A;  3IF7 A;  2Y1M A;  2JQ6 A;  5TNC A;  5D69 A;  1JWD A;  2EC6 B;  1OZO A;  2M7N A;  2Q91 A;  1CLB A;  2Y5I A;  2ZKM X;  1NIW A;  2HQ8 A;  3FWC A;  3LK0 A;  5K89 A;  1KK7 Z;  2WND A;  2WCB A;  1J7R A;  1Y0V H;  2K8M B;  2SCP A;  4CFR A;  2BKI B;  4MRX A;  1S3P A;  4GNK B;  1C7V A;  4ICB A;  1AHR A;  3AAJ A;  1KFU S;  2ZN8 A;  1QX5 B;  1CFP A;  1KFU L;  5J3X A;  5AER A;  2KI6 D;  3A4U B;  3MSE B;  4E68 A;  4OCI A;  1KQM C;  3EVU A;  1MWN A;  4HSZ A;  1IKU A;  1ZAC A;  1LA3 A;  2A4J A;  2H61 C;  1F71 A;  1YRU B;  1QVI Z;  3EKH A;  2Y1N A;  2ZFD A;  3DD4 A;  3AKB A;  3GK1 A;  2NCP A;  1MQ1 A;  3WNX B;  3KO0 A;  4MSP A;  2ZRS A;  2FJU B;  1KK7 Y;  3D10 A;  4N1G A;  1TTX A;  2WOR A;  3TUY C;  2KHN A;  1QX2 A;  1ODB A;  1PUL A;  1FI6 A;  1REC A;  3A8R A;  2CXJ A;  5GQQ C;  1SMG A;  1B8R A;  1B7T Z;  1NX2 A;  4YGE B;  4AQJ A;  1CDP A;  4PE4 A;  2LLT A;  2E6W A;  3GOF A;  5HKZ A;  1D1O A;  1TOP A;  1QVI Y;  4YGA A;  1J7O A;  2EGD A;  1OMD A;  1CFD A;  2F8P A;  1DJH A;  4OR9 B;  3CS1 A;  3BUW B;  1UWO A;  2BKH B;  4I5N B;  1KCY A;  1YX8 A;  1FBV A;  1XFU O;  2K7B A;  3EVR A;  4DCK A;  3O4Y A;  1U5I B;  1F8H A;  1QLS A;  1OE9 B;  2F33 A;  2M9G A;  3TDI A;  1C07 A;  1B7T Y;  2JTT A;  2LHI A;  1XFX O;  3I5I B;  4A4C A;  1SY9 A;  1C7W A;  5CSI A;  2V53 A;  2L0P A;  4HRE E;  1DJX A;  2MHH A;  1UHH A;  4M2Q A;  5AXI A;  4HRG A;  2NZ0 A;  1CB1 A;  1N65 A;  1R2U A;  3CR4 X;  1B8C A;  2MLF C;  4PAL A;  2L2E A;  1B9A A;  4AOM A;  4UPG A;  3BUN B;  1ZUZ A;  1EL4 A;  2O5G A;  2I94 A;  2MJW B;  1R6P A;  1EXR A;  2O60 A;  2JXL A;  3SJS A;  5AFP A;  1F55 A;  3WHT B;  3SG6 A;  3OHM B;  2QAC A;  1KSM A;  3PN7 B;  3CGA A;  1F4O A;  1BR1 B;  3DVK A;  1S26 D;  4GPL B;  1MHO A;  3NSI A;  4JPZ B;  5CSF A;  1JF0 A;  1N0Y A;  2K7D A;  1W7I B;  3OX5 A;  1AJ4 A;  1K9K A;  1JF2 A;  4YI9 A;  2M7L A;  3PLF B;  2KYC A;  1G4Y R;  2LE9 B;  1SCV A;  1TCF A;  2FOT A;  1OMV A;  1S1E A;  2LVJ A;  3FWB A;  1TNP A;  3O6B A;  4OKH A;  1UUR A;  3WHU B;  5CPV A;  2HPS A;  1K95 A;  5AAN A;  3VRN A;  4A4B A;  3LK1 A;  4GAO A;  1YUS A;  2HET A;  1DF0 A;  2LHL A;  1S6J A;  1X02 A;  1BOC A;  2PSR A;  2LMT A;  3BUX B;  1K8U A;  1ALW A;  4GBA A;  2KDH A;  4CLN A;  5CSN A;  2JNF A;  1DVI A;  2K2F A;  1HQV A;  4JQ0 D;  4YGB B;  1KWO C;  1XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...