2LHIA

Solution structure of ca2+/cna1 peptide-bound ycam
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
GSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSKGSSTGTRRKALRNKILAIAKVSRMFSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Serine/threonine-protein phosphatase 2B catalyti
publication title Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, synthetic, saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 41
structure length 176
sequence length 176
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lhiA00
2BE6A 1VRKA 2WORA 2LNKA 1UHIA 3NXAA 2KI6C 1LA0A 1BOCA 3TDUA 1CMFA 2K7BA 3GOFA 2F3YA 2LMVA 1K9KA 1NUBA 2LC5A 4MRYA 1KQVA 1CKKA 2M29A 1J7OA 2BECA 4GGFC 4P5OE 1S36A 2ZFDA 4FTGA 4M2PA 2SCPA 1ZFSA 4U8DA 4IL1A 4L9MA 2JZIA 1CM4A 1SKTA 2OTGC 4JWQA 5HLVA 1UHKA 1L2OC 1KQMB 1MQ1A 4CLNA 4NDDA 1A03A 1MR8A 2KBMA 4DRWA 1FI5A 3F45A 1DJXA 2PRUA 4OKHA 3JVTB 5PALA 1BG1A 1QS7A 4ZCVA 4HRHA 3SIBA 4YRUA 1N0YA 4HREE 4C0JA 3EVRA 2JU0A 1B4CA 2LHLA 1RK9A 2JTZA 1DJYA 2EC6C 3NSOA 4MRXA 2M49B 5AEQA 2BL0C 3TUYC 2BCXA 1CNPA 1CDPA 1KFXS 1XK4A 3OP0A 4XYNA 1SNLA 3SG2A 3VRQA 4PHJA 3VROA 2Q4UA 1B8LA 1SL7A 1F70A 1H8BA 2O5GA 1U5IA 1Y1UA 2M9GA 5CSIA 1SL8A 5BPJA 1K9PA 1BR1B 5I2LA 1GGZA 2I94A 4PE0A 4DUQA 1QXPA 2WCFA 2G2BA 4MN0A 4A4CA 2KYCA 3EK7A 1SK6D 4UPGA 3DVKA 5HYDA 1QX7A 2QPTA 3A4UB 1JSAA 4USLA 2AAOA 3EKHA 2BKHB 1U5IB 1J1DA 3SG4A 4GGFA 2JTTA 3VGOA 1K96A 2Y1MA 1RJVA 2ZKMX 4I5LB 4OVNF 1NCYA 3OB2B 2R2IA 3LCPC 2LMTA 5D69A 1SY9A 4YGDB 2K0JA 4R1EA 1BU3A 4I5KA 2LLTA 2QACA 5D7FA 4MZLA 1M46A 4M2QA 3KEVA 2KQYA 4PE4A 2KAYA 4OV2A 1XFVO 1TRFA 2PASA 1IGVA 1N65A 1CDLA 5JOLA 2B1UA 1CMGA 1LXFC 2CNPA 3BUXB 3IQQA 1W7JB 1YTZC 2G9BA 2OTGB 4QJ3B 1L2OB 1QLSA 2PVBA 2I7AA 1YRTB 1OMRA 2KDHA 1DJIA 1NX3A 1RFJA 3JVTC 2TN4A 1B1GA 3IF7A 3O6BA 2NXQA 4C0LA 3FWCA 2BE4A 2H2KA 5J3XA 1B8CA 2K2AA 1X02A 2F3ZA 4BY4A 1EG3A 3CTNA 5CPVA 1PK0D 3I5GB 1C7VA 1TNWA 3LL8B 1JFKA 3TZ1A 1A29A 1JF0A 1FBVA 4JQ0D 3CS1A 4WQ2A 2BL0B 3TUYB 1MXEA 4PE1A 4YGEB 1RTP1 1PULA 3O2PA 1IG5A 2JQ6A 1QIWA 1FPWA 3ZWHA 4PE7A 3CR2A 3O4YA 3PLFB 1CTRA 1OZOA 4NQGA 1CLLA 1ALWA 3NSIA 1UWOA 2HPSA 1NSHA 1XK4C 4HRGA 2GV5A 4PCWA 1S3PA 1BT6A 1YR5A 2JRFA 1FF1A 1SMGA 5ER5A 2EHBA 2JNXA 2EGDA 1W7IB 3K21A 2L50A 2JPTA 4YBHB 1JWDA 4YI9A 2BBNA 1PVBA 2M0RA 2KI4B 1EXRA 2KAVA 1XYDA 2NZ0A 3BXKA 1EG4A 1AP4A 1CB1A 1OQPA 2LVKA 2L4HA 2OPOA 3VRRA 5AERA 2CTNA 2CCMA 4GGNA 2WCBA 3TS5C 3SG3A 2LVJA 3DVEA 4M2OA 1NYAA 3D0YB 1GGWA 3OX6A 1OOJA 3I5HC 1BF5A 3BUWB 1UHNA 2K2FA 1KSOA 1V1FA 2O60A 1DMOA 2K7DA 1HQVA 1B7TY 1KK7Z 3CWGA 3QRXA 2JULA 1UURA 3BOWA 5JJGA 2L2EA 3KHEA 1KWOC 1KFXL 3A8RA 4MZJA 1F55A 2K7CA 1NX1A 1F71A 4QJ4B 3AKBA 2LCPA 1UP5A 4YI8A 4YGBB 3DF0A 4I5JA 2KOTA 1YUTA 3GK1A 4AOMA 3BUMB 4QJ5B 2JWWA 3I5GC 1SRAA 1QVIY 2AMIA 1A2XA 4TNCA 2GGMA 3BOWB 1IWQA 1DVIA 1QX5B 1NP8A 2M7NA 1G33A 3I5IC 4AQIA 1G8IA 2L98A 2E6WA 4WRIA 1XFUO 1KFUL 3C1VA 3DF0B 3EK8A 1OE9B 3EK4A 1F4OA 1Y1AA 1PVAA 4YGCB 1YUSA 1YX8A 5K89A 5DKNA 2JXLA 1WDCC 2RGIA 3WXAA 1TOPA 1EJ3A 1A75A 2M3WA 3H4SE 1R6PA 2KFFA 1PSBA 1KCYA 1UUSA 1K8UA 1QASA 1SYMA 1KFUS 1PRWA 1XO5A 3M0WA 1GJYA 1Y6WA 2NLNA 1JFJA 2KI4C 3PSRA 2Q91A 4HSZA 1NX0A 1J55A 2LAPA 1A75B 1SCMC 2PALA 2FOTA 1S5GY 1NIWA 3LLEA 3OHMB 1IJ5A 3PN7C 2COLB 2MLFC 2KQ6A 2OS8B 4OCIA 3RLZA 1J1EA 1KK7Y 1YX7A 5CSFA 3KO0A 3TS5B 2LMUA 4ORCB 2KGRA 1CDMA 1KK8B 1F8HA 1HT9A 1BLQA 1QLKA 3D10A 3EVUA 1ZUZA 3I5HB 1MWNA 3SG5A 2Y5IA 3SG7A 2HETA 1J7PA 5AFPA 1WLZA 4WQ3A 2CBLA 2ISDA 1TNXA 4NDBA 2JT0A 1FI6A 5AXIA 1KWOB 1S6JA 4GNKB 2E30A 4BY5A 2ZNEA 1XFZO 2ZRTA 2LHIA 3EKJA 3HX4A 1QTXA 2SASA 1AHRA 2A4JA 5HKYA 1M31A 1B7TZ 1S26D 2BKIB 1LKJA 1SPYA 4GBAA 3GK4X 2LLSA 2LANA 4NDCA 2JNFA 1AK8A 4GUKA 2K7OA 1C07A 2BBMA 3KF9A 2I18A 3I5IB 3VRNA 1IJ6A 1BMOA 2HQ8A 3TDIA 3SG6A 4ORBB 1J7RA 1QVIZ 5I2OA 1MF8B 1AJ5A 2WOSA 2MBXA 3CGAA 3PALA 1C7WA 1DJGA 1WDCB 4MSPA 2Y1NA 3SJSA 2L4IA 4FQOA 3CZTX 5F6TA 1RWYA 1DGUA 1YRUB 1WRKA 1MXLC 4ORAB 2BCBA 1NCXA 2WCEA 1IQ3A 1D1OA 2JXCA 1M63B 1E8AA 1NPQA 3OB1B 4DCKA 4YGAA 2IS9A 2ZN8A 3BUNB 2LUCA 2JOJA 4MBEA 2M7LA 4D1EA 5KSZA 3DD4A 4XJKA 1KSMA 1SCMB 2OS8C 2LP3A 4N1FA 1ZOTB 3PN7B 3KPXA 1DT7B 1CLBA 1XFXO 1KK8C 2F8PA 2CXJA 1K90D 1CFPA 4PHNA 4P2YB 3ICBA 2FJUB 4DS7A 2KI6D 1QV0A 3PM8A 1S5GZ 2FCEA 1LA3A 4XJKB 1NWDA 2GGZA 1K2HA 1SL9A 1S1EA 2NCPA 1Y1XA 1K95A 1DF0A 2KFHA 3WHUB 1H4BA 4C0KA 1ZACA 3DVJA 3WHTB 2HQWA 5CSJA 3PATA 1QX2A 4OR9B 3OX5A 2NCOA 4CPVA 3E3RA 1CFFA 1TNQA 1K94A 1F54A 2M97A 5HLOA 1OSAA 2BCAA 1UHJA 2LVVA 2MHHA 4F0ZB 2WC8A 1CLMA 1DF0B 1YUUA 2M1KB 1EH2A 4MEWA 1L7ZA 1DTLA 3CR5X 1JC2A 3I5FC 1PSRA 3BUOB 1XA5A 1TN4A 1SR6C 2LP2A 3NSKA 2LLUA 3LK1A 2MA2A 5CSNA 1SW8A 1BR4B 3AAJA 2MRDA 2ZN9A 1OZSA 3RM1A 2CT9A 1F4QA 5FYXA 2K61A 2AUCA 1IQ5A 4GFTA 1DJZA 2JC2A 2JT8A 4DIRA 5HKZA 3AAKA 3JTDC 1M45A 1QATA 1B47A 2WNDA 1TCFA 2M8UA 2PMYA 1IRJA 1UHHA 1S6IA 4CFRA 4E68A 3HCMA 2MLEC 2PSRA 4CIDA 1BODA 1DJWA 5I8NA 2D8NA 1WRZA 3ZNIA 1PALA 2H61A 2KBIA 1JUOA 2LE9B 1M39A 2F2OA 2KAXA 1JBAA 2HF5A 2KFGA 2LUXA 1EL4A 5G08A 3CR4X 1WLMA 4MVFA 1QJTA 1MUXA 2LM5A 3PFVA 1JF2A 1FW4A 3FIAA 1K9UA 4ICBA 5GQQC 1Y0VH 2ZNDA 4CFQA 1S6CA 5KU1A 1Q80A 2V53A 3FWBA 1ZMZA 3BQ3A 1CM1A 1AUIB 4ZCUA 3LK0A 2DOQA 1SCVA 5ER4X 2KSPA 1DGVA 2K8MB 5HKWA 1CDNA 4PALA 1G4YR 1AVSA 2P6BB 3BYAA 1TTXA 3EVVA 1TNPA 1K93D 1N2DA 3SIAA 1B8RA 4N5XA 4PHMA 3FS7A 3IQOA 1OMDA 2F33A 1QIVA 1WY9A 3I5FB 4GAOA 4Q04A 3WNXB 1KQMC 2M1UA 1SR6B 2KHNA 5I2QA 1NCZA 1NX2A 5AANA 5TNCA 1YVHA 1IKUA 1AJ4A 1IH0A 2LVIA 2F2PA 1BJFA 3GK2A 3O78A 2FCDA 1RECA 5B8IB 3VRPA 3CLNA 1QV1A 1CFDA 5KTYA 1LINA 4ETOA 1DJHA 2MJWB 2EC6B 3JTDB 3TDZA 2KNEA 2VRGA 3NSLA 4AQJA 2I2RE 4MZKA 1TIZA 2L5XB 4GPLB 4N1GA 2LV7A 1WRLA 1ODBA 3AKAA 1CFCA 4PHKA 1YVLA 4JPZB 2Y4QA 1LVCD 1J7QA 2MAZA 1V1GA 3MSEB 1XFYO 1R2UA 4I5NB 5DKRA 1TCOB 1XFWO 2L0PA 3DVMA 1OMVA 2L51A 5IBWA 4A4BA 1SBJA 2JT3A 4MLWA 1MHOA 1GQMA 2KGBC 1A4PA 1RROA 1ALVA 4PDZA 1YURA 1B9AA 2KYFA 2ZRSA 2H61C 1XVJA 3D0YA 5DKQA
chains in the Genus database with same CATH superfamily
2BE6A 1VRKA 2WORA 2LNKA 1UHIA 1Z4HA 3NXAA 2KI6C 1LA0A 1BOCA 3TDUA 3RZSA 1CMFA 2K7BA 1QWVA 3GOFA 2F3YA 4KYNA 2LMVA 1K9KA 1NUBA 2LC5A 4MRYA 1KQVA 1C3ZA 1CKKA 2M29A 1J7OA 2BECA 4GGFC 4P5OE 1S36A 2ZFDA 3D73A 4FTGA 4M2PA 2SCPA 1ORGA 1ZFSA 2GTEA 3EG5B 4U8DA 4IL1A 4L9MA 2JZIA 1CM4A 2WCHA 1SKTA 2OTGC 3K1EA 4JWQA 5HLVA 1UHKA 1L2OC 1KQMB 1MQ1A 4CLNA 4NDDA 1A03A 1MR8A 2KBMA 3CZ1A 4DRWA 1FI5A 3F45A 1DJXA 2PRUA 4OKHA 3JVTB 5PALA 1BG1A 1QS7A 4ZCVA 4HRHA 3SIBA 4YRUA 1N0YA 4HREE 4C0JA 3EVRA 2JU0A 1B4CA 2LHLA 2BAPA 1RK9A 1GM0A 2JTZA 1DJYA 2EC6C 3NSOA 4MRXA 2M49B 5AEQA 2BL0C 3TUYC 2BCXA 1CNPA 1CDPA 1KFXS 1XK4A 3OP0A 4XYNA 1SNLA 3SG2A 3L4LA 3VRQA 4PHJA 3VROA 2Q4UA 1B8LA 1SL7A 1F70A 4F7FA 1H8BA 2H8VA 2O5GA 1Y1UA 1U5IA 2M9GA 5CSIA 1SL8A 3OGNA 1K9PA 1BR1B 5I2LA 3SS3A 5BPJA 1GGZA 2I94A 4PE0A 5I94A 4DUQA 1QXPA 1TWOA 2WCFA 2G2BA 4MN0A 4A4CA 2KYCA 3EK7A 3VB1A 1SK6D 4UPGA 3DVKA 5HYDA 1QX7A 2QPTA 4OZDA 3A4UB 5HL1A 1JSAA 4USLA 2AAOA 3EKHA 2BKHB 1U5IB 1J1DA 3SG4A 4GGFA 2JTTA 3VGOA 1K96A 2Y1MA 1RJVA 2ZKMX 3D75A 4I5LB 1NCYA 3OB2B 4OVNF 2R2IA 3CZ2A 3LCPC 2LMTA 5D69A 1SY9A 4YGDB 3CYZA 2K0JA 4R1EA 1DC1A 1BU3A 4FQTA 4I5KA 3R1OA 2LLTA 2QACA 5D7FA 4MZLA 1M46A 3PJIA 4M2QA 3KEVA 2KQYA 4PE4A 2KAYA 4OV2A 1XFVO 1TRFA 2PASA 1IGVA 1N65A 1CDLA 5JOLA 1OOHA 2QEBA 2B1UA 1CMGA 1LXFC 2CNPA 2K60A 3BUXB 3IQQA 1W7JB 1YTZC 2G9BA 2OTGB 4QJ3B 1L2OB 1QLSA 2PVBA 2I7AA 3SS5A 1YRTB 1OMRA 2KDHA 1DJIA 1NX3A 1RFJA 3JVTC 2TN4A 1B1GA 3IF7A 3O6BA 2QEOA 2NXQA 4C0LA 3FWCA 2BE4A 2H2KA 5J3XA 1B8CA 2K2AA 3NHIA 1X02A 2F3ZA 4BY4A 1EG3A 3CTNA 3R1PA 5CPVA 1PK0D 2QEHA 3I5GB 1C7VA 1TNWA 3LL8B 1JFKA 3TZ1A 1A29A 1JF0A 1FBVA 4JQ0D 3CS1A 4WQ2A 3S0EA 2BL0B 3TUYB 1MXEA 4PE1A 4YGEB 3R72A 1RTP1 1PULA 3O2PA 1IG5A 2JQ6A 1QIWA 1FPWA 3ZWHA 4PE7A 3CR2A 3O4YA 3PLFB 1CTRA 1OZOA 4NQGA 1CLLA 1ALWA 4PT1A 3NSIA 5FI2A 5DICA 5EL2A 2KLDA 1UWOA 2HPSA 1NSHA 1XK4C 4HRGA 2GV5A 4PCWA 1S3PA 1BT6A 1YR5A 2JRFA 1FF1A 3FE8A 1SMGA 5ER5A 2EHBA 2JNXA 2EGDA 1W7IB 3K21A 2L50A 2JPTA 4YBHB 1JWDA 4YI9A 2BBNA 1PVBA 2L2CA 2M0RA 2KI4B 3B7AA 1EXRA 2KAVA 1XYDA 2NZ0A 3BXKA 1EG4A 1AP4A 1CB1A 1OQPA 2L5YA 2LVKA 2L4HA 2OPOA 3VRRA 5AERA 2CTNA 2CCMA 4GGNA 2WCBA 3TS5C 1LS8A 3SG3A 2LVJA 3L47A 3DVEA 4M2OA 1NYAA 3D0YB 1GGWA 3OX6A 1OOJA 3I5HC 1BF5A 3BUWB 1UHNA 2K2FA 1KSOA 1V1FA 2O60A 1DMOA 2K7DA 1HQVA 1B7TY 1KK7Z 3CWGA 3QRXA 2JULA 1TUZA 1UURA 3BOWA 5JJGA 2L2EA 3KHEA 1KWOC 1KFXL 3A8RA 4MZJA 1F55A 5D3OA 2K7CA 1NX1A 1F71A 4QJ4B 3AKBA 2LCPA 1UP5A 4YI8A 3SS4A 4YGBB 3DF0A 4I5JA 2KOTA 1YUTA 3GK1A 4AOMA 3BUMB 4QJ5B 2JWWA 3I5GC 1SRAA 1QVIY 1OOFA 2AMIA 1A2XA 4TNCA 2GGMA 3BOWB 1IWQA 1DVIA 1QX5B 1NP8A 2M7NA 1G33A 3I5IC 4AQIA 1G8IA 2L98A 2JPOA 2E6WA 2ERBA 4WRIA 1XFUO 1KFUL 3C1VA 3DF0B 3EK8A 1OE9B 3EK4A 1F4OA 1Y1AA 1PVAA 4YGCB 1YUSA 1YX8A 5K89A 5DKNA 2JXLA 1WDCC 2RGIA 3WXAA 1TOPA 3OBVA 1EJ3A 1A75A 2M3WA 3H4SE 1R6PA 2KFFA 4INXA 1PSBA 1KCYA 1JC2A 1UUSA 1SYMA 1K8UA 1QASA 1KFUS 1SSEB 1PRWA 1XO5A 3M0WA 1GJYA 1Y6WA 2NLNA 1JFJA 2KI4C 3S0GA 3PSRA 2Q91A 4HSZA 1Z2CB 1NX0A 1J55A 2LAPA 1A75B 1SCMC 2PALA 2FOTA 1S5GY 1NIWA 3LLEA 3OHMB 1IJ5A 3PN7C 1W9ZA 2COLB 2MLFC 2KQ6A 2OS8B 4OCIA 3D77A 1J1EA 3RLZA 1KK7Y 1YX7A 5CSFA 3KO0A 3TS5B 2LMUA 4ORCB 2KGRA 3BFBA 1CDMA 1KK8B 3CZ0A 1F8HA 1HT9A 1BLQA 1QLKA 3D10A 3EVUA 1ZUZA 3I5HB 1MWNA 1OOGA 3SG5A 2Y5IA 3SG7A 2HETA 1J7PA 1XFRA 5AFPA 1WLZA 4WQ3A 2CBLA 2ISDA 1TNXA 3DY9A 4NDBA 2JT0A 1FI6A 5AXIA 1KWOB 1S6JA 4GNKB 2E30A 4BY5A 3CABA 2ZNEA 3R1VA 1XFZO 2ZRTA 2P71A 2LHIA 3EKJA 3HX4A 1QTXA 2SASA 1AHRA 2A4JA 5HKYA 2YGUA 1M31A 1B7TZ 2PYQA 1OW4A 1S26D 2BKIB 1LKJA 1SPYA 4GBAA 3GK4X 2LLSA 2LANA 4NDCA 2JNFA 1AK8A 4GUKA 2K7OA 2KLEA 1C07A 2BBMA 3KF9A 2I18A 3I5IB 3VRNA 1IJ6A 1BMOA 2HQ8A 3TDIA 2WCJA 3SG6A 4ORBB 1J7RA 2PQLA 1QVIZ 5I2OA 1MF8B 1AJ5A 2WOSA 2MBXA 3CGAA 3PALA 1C7WA 1DJGA 1WDCB 3CDNA 2Y1NA 4MSPA 3SJSA 3BJHA 2L4IA 4FQOA 3CZTX 5F6TA 1RWYA 1DGUA 1YRUB 1WRKA 1MXLC 4ORAB 2BCBA 1NCXA 2WCEA 1IQ3A 1D1OA 3O4XA 2JXCA 1M63B 1E8AA 1NPQA 3OB1B 4DCKA 1C3YA 4YGAA 2IS9A 2ZN8A 3BUNB 2LUCA 2JOJA 4MBEA 2M7LA 4D1EA 5KSZA 3DD4A 4XJKA 1KSMA 1SCMB 2OS8C 2LP3A 3IVTA 1ZOTB 3PN7B 3KPXA 4N1FA 1DT7B 1CLBA 1XFXO 1KK8C 2F8PA 2CXJA 1K90D 1CFPA 4PHNA 4P2YB 3ICBA 2FJUB 4DS7A 2KI6D 1QV0A 3PM8A 1S5GZ 2FCEA 3NHTA 1LA3A 4XJKB 1NWDA 2GGZA 1K2HA 1SL9A 1S1EA 3S0AA 2NCPA 1Y1XA 1K95A 1DF0A 2KFHA 3WHUB 1H4BA 4C0KA 1ZACA 3DVJA 3WHTB 2HQWA 2WCLA 3NGVA 5CSJA 3D74A 3B88A 3PATA 1QX2A 2KPHA 4OR9B 3V2LA 3OX5A 2NCOA 4CPVA 3E3RA 1CFFA 1TNQA 1K94A 1F54A 2M97A 5HLOA 1OSAA 1UHJA 2BCAA 2LVVA 2MHHA 4F0ZB 2WC8A 1CLMA 1DF0B 1YUUA 2M1KB 1EH2A 3BFHA 4MEWA 1L7ZA 1DTLA 3CR5X 3D78A 3DXLA 3I5FC 1T14A 1PSRA 3BUOB 1XA5A 3Q8IA 1TN4A 1SR6C 2LP2A 3NSKA 2LLUA 3PM2A 3LK1A 2MA2A 3DYEA 3FE6A 5CSNA 1SW8A 1BR4B 2WC6A 3AAJA 2MRDA 2ZN9A 1OZSA 3N7HA 3RM1A 2CT9A 1F4QA 4JD9A 5FYXA 2K61A 4IJ7A 2AUCA 1IQ5A 4GFTA 1DJZA 2JC2A 2JT8A 4DIRA 5FI7A 5HKZA 3AAKA 3JTDC 1OOIX 1M45A 1QATA 1B47A 2BNXA 2WNDA 3DZTA 3FE9A 1TCFA 2M8UA 2PMYA 1IRJA 1UHHA 1S6IA 4CFRA 4E68A 3HCMA 2MLEC 2PSRA 4CIDA 1BODA 1DJWA 5I8NA 2WC5A 2D8NA 1WRZA 3ZNIA 1PALA 2H61A 2KBIA 1JUOA 2LE9B 1M39A 2F2OA 2KAXA 1JBAA 1DQEA 2HF5A 2KFGA 2LUXA 1EL4A 5G08A 3CR4X 1WLMA 4MVFA 1QJTA 1DELA 1MUXA 2LM5A 2WCKA 3PFVA 1JF2A 1FW4A 3FIAA 1K9UA 4ICBA 5GQQC 1Y0VH 2ZNDA 4CFQA 1S6CA 3B87A 5KU1A 1Q80A 2V53A 3FWBA 1ZMZA 3BFAA 3BQ3A 1CM1A 1AUIB 2QDIA 3S0DA 4ZCUA 3LK0A 2DOQA 4JKTA 4INWA 1SCVA 5ER4X 2KSPA 1DGVA 2K8MB 5HKWA 1CDNA 4PALA 1G4YR 1AVSA 2P6BB 3BYAA 1TTXA 2P70A 3QMEA 3B6XA 3EVVA 1TNPA 1K93D 1N2DA 3SIAA 1B8RA 4N5XA 4PHMA 3FS7A 3IQOA 1OMDA 2F33A 1QIVA 2WCMA 1WY9A 3I5FB 4GAOA 4Q04A 3WNXB 1KQMC 2M1UA 1SR6B 2KHNA 5I2QA 1P28A 1NCZA 1NX2A 3L4AA 5AANA 1YVHA 5TNCA 1IKUA 1AJ4A 1IH0A 2LVIA 2F2PA 1BJFA 3GK2A 3O78A 2FCDA 1RECA 5B8IB 3VRPA 3CLNA 1QV1A 1CFDA 5KTYA 1LINA 1IIOA 4ETOA 1DJHA 2MJWB 2EC6B 3JTDB 3TDZA 2KNEA 2VRGA 3NSLA 4AQJA 2I2RE 4MZKA 1TIZA 2L5XB 3D76A 4GPLB 4N1GA 2FJYA 2LV7A 1WRLA 1ODBA 1TUJA 3AKAA 3UO9A 3UNWA 4PHKA 1CFCA 2QEVA 1YVLA 4JPZB 2Y4QA 1LVCD 1J7QA 2MAZA 1V1GA 3MSEB 3S0BA 1XFYO 1R2UA 4I5NB 5DKRA 1TCOB 1XFWO 3S0FA 2L0PA 3DVMA 1OMVA 2L51A 5IBWA 4A4BA 1SBJA 2JT3A 3B86A 1MHOA 4MLWA 1DEKA 1GQMA 2KGBC 1A4PA 1RROA 1ALVA 4PDZA 1YURA 1B9AA 2KYFA 2ZRSA 5FI6A 2H61C 1XVJA 3D0YA 5DKQA
chains in the Genus database with same CATH topology
2BE6A 1VRKA 2WORA 2LNKA 1UHIA 3NXAA 2KI6C 1LA0A 1BOCA 3TDUA 1CMFA 2K7BA 3GOFA 2F3YA 2LMVA 1K9KA 1NUBA 2LC5A 4MRYA 1KQVA 1CKKA 2M29A 1J7OA 2BECA 4GGFC 4P5OE 1S36A 2ZFDA 4FTGA 4M2PA 2SCPA 1ZFSA 4U8DA 4IL1A 4L9MA 2JZIA 1CM4A 1SKTA 2OTGC 4JWQA 5HLVA 1UHKA 1L2OC 1KQMB 1MQ1A 4CLNA 4NDDA 1A03A 1MR8A 2KBMA 4DRWA 1FI5A 3F45A 1DJXA 2PRUA 4OKHA 3JVTB 5PALA 1BG1A 1QS7A 4ZCVA 4HRHA 3SIBA 4YRUA 1N0YA 4HREE 4C0JA 3EVRA 2JU0A 1B4CA 2LHLA 1RK9A 2JTZA 1DJYA 2EC6C 3NSOA 4MRXA 2M49B 5AEQA 2BL0C 3TUYC 2BCXA 1CNPA 1CDPA 1KFXS 1XK4A 3OP0A 4XYNA 1SNLA 3SG2A 3VRQA 4PHJA 3VROA 2Q4UA 1B8LA 1SL7A 1F70A 1H8BA 2O5GA 1U5IA 1Y1UA 2M9GA 5CSIA 1SL8A 5BPJA 1K9PA 1BR1B 5I2LA 1GGZA 2I94A 4PE0A 4DUQA 1QXPA 2WCFA 2G2BA 4MN0A 4A4CA 2KYCA 3EK7A 1SK6D 4UPGA 3DVKA 5HYDA 1QX7A 2QPTA 3A4UB 1JSAA 4USLA 2AAOA 3EKHA 2BKHB 1U5IB 1J1DA 3SG4A 4GGFA 2JTTA 3VGOA 1K96A 2Y1MA 1RJVA 2ZKMX 4I5LB 4OVNF 1NCYA 3OB2B 2R2IA 3LCPC 2LMTA 5D69A 1SY9A 4YGDB 2K0JA 4R1EA 1BU3A 4I5KA 2LLTA 2QACA 5D7FA 4MZLA 1M46A 4M2QA 3KEVA 2KQYA 4PE4A 2KAYA 4OV2A 1XFVO 1TRFA 2PASA 1IGVA 1N65A 1CDLA 5JOLA 2B1UA 1CMGA 1LXFC 2CNPA 3BUXB 3IQQA 1W7JB 1YTZC 2G9BA 2OTGB 4QJ3B 1L2OB 1QLSA 2PVBA 2I7AA 1YRTB 1OMRA 2KDHA 1DJIA 1NX3A 1RFJA 3JVTC 2TN4A 1B1GA 3IF7A 3O6BA 2NXQA 4C0LA 3FWCA 2BE4A 2H2KA 5J3XA 1B8CA 2K2AA 1X02A 2F3ZA 4BY4A 1EG3A 3CTNA 5CPVA 1PK0D 3I5GB 1C7VA 1TNWA 3LL8B 1JFKA 3TZ1A 1A29A 1JF0A 1FBVA 4JQ0D 3CS1A 4WQ2A 2BL0B 3TUYB 1MXEA 4PE1A 4YGEB 1RTP1 1PULA 3O2PA 1IG5A 2JQ6A 1QIWA 1FPWA 3ZWHA 4PE7A 3CR2A 3O4YA 3PLFB 1CTRA 1OZOA 4NQGA 1CLLA 1ALWA 3NSIA 1UWOA 2HPSA 1NSHA 1XK4C 4HRGA 2GV5A 4PCWA 1S3PA 1BT6A 1YR5A 2JRFA 1FF1A 1SMGA 5ER5A 2EHBA 2JNXA 2EGDA 1W7IB 3K21A 2L50A 2JPTA 4YBHB 1JWDA 4YI9A 2BBNA 1PVBA 2M0RA 2KI4B 1EXRA 2KAVA 1XYDA 2NZ0A 3BXKA 1EG4A 1AP4A 1CB1A 1OQPA 2LVKA 2L4HA 2OPOA 3VRRA 5AERA 2CTNA 2CCMA 4GGNA 2WCBA 3TS5C 3SG3A 2LVJA 3DVEA 4M2OA 1NYAA 3D0YB 1GGWA 3OX6A 1OOJA 3I5HC 1BF5A 3BUWB 1UHNA 2K2FA 1KSOA 1V1FA 2O60A 1DMOA 2K7DA 1HQVA 1B7TY 1KK7Z 3CWGA 3QRXA 2JULA 1UURA 3BOWA 5JJGA 2L2EA 3KHEA 1KWOC 1KFXL 3A8RA 4MZJA 1F55A 2K7CA 1NX1A 1F71A 4QJ4B 3AKBA 2LCPA 1UP5A 4YI8A 4YGBB 3DF0A 4I5JA 2KOTA 1YUTA 3GK1A 4AOMA 3BUMB 4QJ5B 2JWWA 3I5GC 1SRAA 1QVIY 2AMIA 1A2XA 4TNCA 2GGMA 3BOWB 1IWQA 1DVIA 1QX5B 1NP8A 2M7NA 1G33A 3I5IC 4AQIA 1G8IA 2L98A 2E6WA 4WRIA 1XFUO 1KFUL 3C1VA 3DF0B 3EK8A 1OE9B 3EK4A 1F4OA 1Y1AA 1PVAA 4YGCB 1YUSA 1YX8A 5K89A 5DKNA 2JXLA 1WDCC 2RGIA 3WXAA 1TOPA 1EJ3A 1A75A 2M3WA 3H4SE 1R6PA 2KFFA 1PSBA 1KCYA 1UUSA 1K8UA 1QASA 1SYMA 1KFUS 1PRWA 1XO5A 3M0WA 1GJYA 1Y6WA 2NLNA 1JFJA 2KI4C 3PSRA 2Q91A 4HSZA 1NX0A 1J55A 2LAPA 1A75B 1SCMC 2PALA 2FOTA 1S5GY 1NIWA 3LLEA 3OHMB 1IJ5A 3PN7C 2COLB 2MLFC 2KQ6A 2OS8B 4OCIA 3RLZA 1J1EA 1KK7Y 1YX7A 5CSFA 3KO0A 3TS5B 2LMUA 4ORCB 2KGRA 1CDMA 1KK8B 1F8HA 1HT9A 1BLQA 1QLKA 3D10A 3EVUA 1ZUZA 3I5HB 1MWNA 3SG5A 2Y5IA 3SG7A 2HETA 1J7PA 5AFPA 1WLZA 4WQ3A 2CBLA 2ISDA 1TNXA 4NDBA 2JT0A 1FI6A 5AXIA 1KWOB 1S6JA 4GNKB 2E30A 4BY5A 2ZNEA 1XFZO 2ZRTA 2LHIA 3EKJA 3HX4A 1QTXA 2SASA 1AHRA 2A4JA 5HKYA 1M31A 1B7TZ 1S26D 2BKIB 1LKJA 1SPYA 4GBAA 3GK4X 2LLSA 2LANA 4NDCA 2JNFA 1AK8A 4GUKA 2K7OA 1C07A 2BBMA 3KF9A 2I18A 3I5IB 3VRNA 1IJ6A 1BMOA 2HQ8A 3TDIA 3SG6A 4ORBB 1J7RA 1QVIZ 5I2OA 1MF8B 1AJ5A 2WOSA 2MBXA 3CGAA 3PALA 1C7WA 1DJGA 1WDCB 4MSPA 2Y1NA 3SJSA 2L4IA 4FQOA 3CZTX 5F6TA 1RWYA 1DGUA 1YRUB 1WRKA 1MXLC 4ORAB 2BCBA 1NCXA 2WCEA 1IQ3A 1D1OA 2JXCA 1M63B 1E8AA 1NPQA 3OB1B 4DCKA 4YGAA 2IS9A 2ZN8A 3BUNB 2LUCA 2JOJA 4MBEA 2M7LA 4D1EA 5KSZA 3DD4A 4XJKA 1KSMA 1SCMB 2OS8C 2LP3A 4N1FA 1ZOTB 3PN7B 3KPXA 1DT7B 1CLBA 1XFXO 1KK8C 2F8PA 2CXJA 1K90D 1CFPA 4PHNA 4P2YB 3ICBA 2FJUB 4DS7A 2KI6D 1QV0A 3PM8A 1S5GZ 2FCEA 1LA3A 4XJKB 1NWDA 2GGZA 1K2HA 1SL9A 1S1EA 2NCPA 1Y1XA 1K95A 1DF0A 2KFHA 3WHUB 1H4BA 4C0KA 1ZACA 3DVJA 3WHTB 2HQWA 5CSJA 3PATA 1QX2A 4OR9B 3OX5A 2NCOA 4CPVA 3E3RA 1CFFA 1TNQA 1K94A 1F54A 2M97A 5HLOA 1OSAA 2BCAA 1UHJA 2LVVA 2MHHA 4F0ZB 2WC8A 1CLMA 1DF0B 1YUUA 2M1KB 1EH2A 4MEWA 1L7ZA 1DTLA 3CR5X 1JC2A 3I5FC 1PSRA 3BUOB 1XA5A 1TN4A 1SR6C 2LP2A 3NSKA 2LLUA 3LK1A 2MA2A 5CSNA 1SW8A 1BR4B 3AAJA 2MRDA 2ZN9A 1OZSA 3RM1A 2CT9A 1F4QA 5FYXA 2K61A 2AUCA 1IQ5A 4GFTA 1DJZA 2JC2A 2JT8A 4DIRA 5HKZA 3AAKA 3JTDC 1M45A 1QATA 1B47A 2WNDA 1TCFA 2M8UA 2PMYA 1IRJA 1UHHA 1S6IA 4CFRA 4E68A 3HCMA 2MLEC 2PSRA 4CIDA 1BODA 1DJWA 5I8NA 2D8NA 1WRZA 3ZNIA 1PALA 2H61A 2KBIA 1JUOA 2LE9B 1M39A 2F2OA 2KAXA 1JBAA 2HF5A 2KFGA 2LUXA 1EL4A 5G08A 3CR4X 1WLMA 4MVFA 1QJTA 1MUXA 2LM5A 3PFVA 1JF2A 1FW4A 3FIAA 1K9UA 4ICBA 5GQQC 1Y0VH 2ZNDA 4CFQA 1S6CA 5KU1A 1Q80A 2V53A 3FWBA 1ZMZA 3BQ3A 1CM1A 1AUIB 4ZCUA 3LK0A 2DOQA 1SCVA 5ER4X 2KSPA 1DGVA 2K8MB 5HKWA 1CDNA 4PALA 1G4YR 1AVSA 2P6BB 3BYAA 1TTXA 3EVVA 1TNPA 1K93D 1N2DA 3SIAA 1B8RA 4N5XA 4PHMA 3FS7A 3IQOA 1OMDA 2F33A 1QIVA 1WY9A 3I5FB 4GAOA 4Q04A 3WNXB 1KQMC 2M1UA 1SR6B 2KHNA 5I2QA 1NCZA 1NX2A 5AANA 5TNCA 1YVHA 1IKUA 1AJ4A 1IH0A 2LVIA 2F2PA 1BJFA 3GK2A 3O78A 2FCDA 1RECA 5B8IB 3VRPA 3CLNA 1QV1A 1CFDA 5KTYA 1LINA 4ETOA 1DJHA 2MJWB 2EC6B 3JTDB 3TDZA 2KNEA 2VRGA 3NSLA 4AQJA 2I2RE 4MZKA 1TIZA 2L5XB 4GPLB 4N1GA 2LV7A 1WRLA 1ODBA 3AKAA 1CFCA 4PHKA 1YVLA 4JPZB 2Y4QA 1LVCD 1J7QA 2MAZA 1V1GA 3MSEB 1XFYO 1R2UA 4I5NB 5DKRA 1TCOB 1XFWO 2L0PA 3DVMA 1OMVA 2L51A 5IBWA 4A4BA 1SBJA 2JT3A 4MLWA 1MHOA 1GQMA 2KGBC 1A4PA 1RROA 1ALVA 4PDZA 1YURA 1B9AA 2KYFA 2ZRSA 2H61C 1XVJA 3D0YA 5DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE6 A;  1VRK A;  2WOR A;  2LNK A;  1UHI A;  3NXA A;  2KI6 C;  1LA0 A;  1BOC A;  3TDU A;  1CMF A;  2K7B A;  3GOF A;  2F3Y A;  2LMV A;  1K9K A;  1NUB A;  2LC5 A;  4MRY A;  1KQV A;  1CKK A;  2M29 A;  1J7O A;  2BEC A;  4GGF C;  4P5O E;  1S36 A;  2ZFD A;  4FTG A;  4M2P A;  2SCP A;  1ZFS A;  4U8D A;  4IL1 A;  4L9M A;  2JZI A;  1CM4 A;  1SKT A;  2OTG C;  4JWQ A;  5HLV A;  1UHK A;  1L2O C;  1KQM B;  1MQ1 A;  4CLN A;  4NDD A;  1A03 A;  1MR8 A;  2KBM A;  4DRW A;  1FI5 A;  3F45 A;  1DJX A;  2PRU A;  4OKH A;  3JVT B;  5PAL A;  1BG1 A;  1QS7 A;  4ZCV A;  4HRH A;  3SIB A;  4YRU A;  1N0Y A;  4HRE E;  4C0J A;  3EVR A;  2JU0 A;  1B4C A;  2LHL A;  1RK9 A;  2JTZ A;  1DJY A;  2EC6 C;  3NSO A;  4MRX A;  2M49 B;  5AEQ A;  2BL0 C;  3TUY C;  2BCX A;  1CNP A;  1CDP A;  1KFX S;  1XK4 A;  3OP0 A;  4XYN A;  1SNL A;  3SG2 A;  3VRQ A;  4PHJ A;  3VRO A;  2Q4U A;  1B8L A;  1SL7 A;  1F70 A;  1H8B A;  2O5G A;  1U5I A;  1Y1U A;  2M9G A;  5CSI A;  1SL8 A;  5BPJ A;  1K9P A;  1BR1 B;  5I2L A;  1GGZ A;  2I94 A;  4PE0 A;  4DUQ A;  1QXP A;  2WCF A;  2G2B A;  4MN0 A;  4A4C A;  2KYC A;  3EK7 A;  1SK6 D;  4UPG A;  3DVK A;  5HYD A;  1QX7 A;  2QPT A;  3A4U B;  1JSA A;  4USL A;  2AAO A;  3EKH A;  2BKH B;  1U5I B;  1J1D A;  3SG4 A;  4GGF A;  2JTT A;  3VGO A;  1K96 A;  2Y1M A;  1RJV A;  2ZKM X;  4I5L B;  4OVN F;  1NCY A;  3OB2 B;  2R2I A;  3LCP C;  2LMT A;  5D69 A;  1SY9 A;  4YGD B;  2K0J A;  4R1E A;  1BU3 A;  4I5K A;  2LLT A;  2QAC A;  5D7F A;  4MZL A;  1M46 A;  4M2Q A;  3KEV A;  2KQY A;  4PE4 A;  2KAY A;  4OV2 A;  1XFV O;  1TRF A;  2PAS A;  1IGV A;  1N65 A;  1CDL A;  5JOL A;  2B1U A;  1CMG A;  1LXF C;  2CNP A;  3BUX B;  3IQQ A;  1W7J B;  1YTZ C;  2G9B A;  2OTG B;  4QJ3 B;  1L2O B;  1QLS A;  2PVB A;  2I7A A;  1YRT B;  1OMR A;  2KDH A;  1DJI A;  1NX3 A;  1RFJ A;  3JVT C;  2TN4 A;  1B1G A;  3IF7 A;  3O6B A;  2NXQ A;  4C0L A;  3FWC A;  2BE4 A;  2H2K A;  5J3X A;  1B8C A;  2K2A A;  1X02 A;  2F3Z A;  4BY4 A;  1EG3 A;  3CTN A;  5CPV A;  1PK0 D;  3I5G B;  1C7V A;  1TNW A;  3LL8 B;  1JFK A;  3TZ1 A;  1A29 A;  1JF0 A;  1FBV A;  4JQ0 D;  3CS1 A;  4WQ2 A;  2BL0 B;  3TUY B;  1MXE A;  4PE1 A;  4YGE B;  1RTP 1;  1PUL A;  3O2P A;  1IG5 A;  2JQ6 A;  1QIW A;  1FPW A;  3ZWH A;  4PE7 A;  3CR2 A;  3O4Y A;  3PLF B;  1CTR A;  1OZO A;  4NQG A;  1CLL A;  1ALW A;  3NSI A;  1UWO A;  2HPS A;  1NSH A;  1XK4 C;  4HRG A;  2GV5 A;  4PCW A;  1S3P A;  1BT6 A;  1YR5 A;  2JRF A;  1FF1 A;  1SMG A;  5ER5 A;  2EHB A;  2JNX A;  2EGD A;  1W7I B;  3K21 A;  2L50 A;  2JPT A;  4YBH B;  1JWD A;  4YI9 A;  2BBN A;  1PVB A;  2M0R A;  2KI4 B;  1EXR A;  2KAV A;  1XYD A;  2NZ0 A;  3BXK A;  1EG4 A;  1AP4 A;  1CB1 A;  1OQP A;  2LVK A;  2L4H A;  2OPO A;  3VRR A;  5AER A;  2CTN A;  2CCM A;  4GGN A;  2WCB A;  3TS5 C;  3SG3 A;  2LVJ A;  3DVE A;  4M2O A;  1NYA A;  3D0Y B;  1GGW A;  3OX6 A;  1OOJ A;  3I5H C;  1BF5 A;  3BUW B;  1UHN A;  2K2F A;  1KSO A;  1V1F A;  2O60 A;  1DMO A;  2K7D A;  1HQV A;  1B7T Y;  1KK7 Z;  3CWG A;  3QRX A;  2JUL A;  1UUR A;  3BOW A;  5JJG A;  2L2E A;  3KHE A;  1KWO C;  1KFX L;  3A8R A;  4MZJ A;  1F55 A;  2K7C A;  1NX1 A;  1F71 A;  4QJ4 B;  3AKB A;  2LCP A;  1UP5 A;  4YI8 A;  4YGB B;  3DF0 A;  4I5J A;  2KOT A;  1YUT A;  3GK1 A;  4AOM A;  3BUM B;  4QJ5 B;  2JWW A;  3I5G C;  1SRA A;  1QVI Y;  2AMI A;  1A2X A;  4TNC A;  2GGM A;  3BOW B;  1IWQ A;  1DVI A;  1QX5 B;  1NP8 A;  2M7N A;  1G33 A;  3I5I C;  4AQI A;  1G8I A;  2L98 A;  2E6W A;  4WRI A;  1XFU O;  1KFU L;  3C1V A;  3DF0 B;  3EK8 A;  1OE9 B;  3EK4 A;  1F4O A;  1Y1A A;  1PVA A;  4YGC B;  1YUS A;  1YX8 A;  5K89 A;  5DKN A;  2JXL A;  1WDC C;  2RGI A;  3WXA A;  1TOP A;  1EJ3 A;  1A75 A;  2M3W A;  3H4S E;  1R6P A;  2KFF A;  1PSB A;  1KCY A;  1UUS A;  1K8U A;  1QAS A;  1SYM A;  1KFU S;  1PRW A;  1XO5 A;  3M0W A;  1GJY A;  1Y6W A;  2NLN A;  1JFJ A;  2KI4 C;  3PSR A;  2Q91 A;  4HSZ A;  1NX0 A;  1J55 A;  2LAP A;  1A75 B;  1SCM C;  2PAL A;  2FOT A;  1S5G Y;  1NIW A;  3LLE A;  3OHM B;  1IJ5 A;  3PN7 C;  2COL B;  2MLF C;  2KQ6 A;  2OS8 B;  4OCI A;  3RLZ A;  1J1E A;  1KK7 Y;  1YX7 A;  5CSF A;  3KO0 A;  3TS5 B;  2LMU A;  4ORC B;  2KGR A;  1CDM A;  1KK8 B;  1F8H A;  1HT9 A;  1BLQ A;  1QLK A;  3D10 A;  3EVU A;  1ZUZ A;  3I5H B;  1MWN A;  3SG5 A;  2Y5I A;  3SG7 A;  2HET A;  1J7P A;  5AFP A;  1WLZ A;  4WQ3 A;  2CBL A;  2ISD A;  1TNX A;  4NDB A;  2JT0 A;  1FI6 A;  5AXI A;  1KWO B;  1S6J A;  4GNK B;  2E30 A;  4BY5 A;  2ZNE A;  1XFZ O;  2ZRT A;  2LHI A;  3EKJ A;  3HX4 A;  1QTX A;  2SAS A;  1AHR A;  2A4J A;  5HKY A;  1M31 A;  1B7T Z;  1S26 D;  2BKI B;  1LKJ A;  1SPY A;  4GBA A;  3GK4 X;  2LLS A;  2LAN A;  4NDC A;  2JNF A;  1AK8 A;  4GUK A;  2K7O A;  1C07 A;  2BBM A;  3KF9 A;  2I18 A;  3I5I B;  3VRN A;  1IJ6 A;  1BMO A;  2HQ8 A;  3TDI A;  3SG6 A;  4ORB B;  1J7R A;  1QVI Z;  5I2O A;  1MF8 B;  1AJ5 A;  2WOS A;  2MBX A;  3CGA A;  3PAL A;  1C7W A;  1DJG A;  1WDC B;  4MSP A;  2Y1N A;  3SJS A;  2L4I A;  4FQO A;  3CZT X;  5F6T A;  1RWY A;  1DGU A;  1YRU B;  1WRK A;  1MXL C;  4ORA B;  2BCB A;  1NCX A;  2WCE A;  1IQ3 A;  1D1O A;  2JXC A;  1M63 B;  1E8A A;  1NPQ A;  3OB1 B;  4DCK A;  4YGA A;  2IS9 A;  2ZN8 A;  3BUN B;  2LUC A;  2JOJ A;  4MBE A;  2M7L A;  4D1E A;  5KSZ A;  3DD4 A;  4XJK A;  1KSM A;  1SCM B;  2OS8 C;  2LP3 A;  4N1F A;  1ZOT B;  3PN7 B;  3KPX A;  1DT7 B;  1CLB A;  1XFX O;  1KK8 C;  2F8P A;  2CXJ A;  1K90 D;  1CFP A;  4PHN A;  4P2Y B;  3ICB A;  2FJU B;  4DS7 A;  2KI6 D;  1QV0 A;  3PM8 A;  1S5G Z;  2FCE A;  1LA3 A;  4XJK B;  1NWD A;  2GGZ A;  1K2H A;  1SL9 A;  1S1E A;  2NCP A;  1Y1X A;  1K95 A;  1DF0 A;  2KFH A;  3WHU B;  1H4B A;  4C0K A;  1ZAC A;  3DVJ A;  3WHT B;  2HQW A;  5CSJ A;  3PAT A;  1QX2 A;  4OR9 B;  3OX5 A;  2NCO A;  4CPV A;  3E3R A;  1CFF A;  1TNQ A;  1K94 A;  1F54 A;  2M97 A;  5HLO A;  1OSA A;  2BCA A;  1UHJ A;  2LVV A;  2MHH A;  4F0Z B;  2WC8 A;  1CLM A;  1DF0 B;  1YUU A;  2M1K B;  1EH2 A;  4MEW A;  1L7Z A;  1DTL A;  3CR5 X;  1JC2 A;  3I5F C;  1PSR A;  3BUO B;  1XA5 A;  1TN4 A;  1SR6 C;  2LP2 A;  3NSK A;  2LLU A;  3LK1 A;  2MA2 A;  5CSN A;  1SW8 A;  1BR4 B;  3AAJ A;  2MRD A;  2ZN9 A;  1OZS A;  3RM1 A;  2CT9 A;  1F4Q A;  5FYX A;  2K61 A;  2AUC A;  1IQ5 A;  4GFT A;  1DJZ A;  2JC2 A;  2JT8 A;  4DIR A;  5HKZ A;  3AAK A;  3JTD C;  1M45 A;  1QAT A;  1B47 A;  2WND A;  1TCF A;  2M8U A;  2PMY A;  1IRJ A;  1UHH A;  1S6I A;  4CFR A;  4E68 A;  3HCM A;  2MLE C;  2PSR A;  4CID A;  1BOD A;  1DJW A;  5I8N A;  2D8N A;  1WRZ A;  3ZNI A;  1PAL A;  2H61 A;  2KBI A;  1JUO A;  2LE9 B;  1M39 A;  2F2O A;  2KAX A;  1JBA A;  2HF5 A;  2KFG A;  2LUX A;  1EL4 A;  5G08 A;  3CR4 X;  1WLM A;  4MVF A;  1QJT A;  1MUX A;  2LM5 A;  3PFV A;  1JF2 A;  1FW4 A;  3FIA A;  1K9U A;  4ICB A;  5GQQ C;  1Y0V H;  2ZND A;  4CFQ A;  1S6C A;  5KU1 A;  1Q80 A;  2V53 A;  3FWB A;  1ZMZ A;  3BQ3 A;  1CM1 A;  1AUI B;  4ZCU A;  3LK0 A;  2DOQ A;  1SCV A;  5ER4 X;  2KSP A;  1DGV A;  2K8M B;  5HKW A;  1CDN A;  4PAL A;  1G4Y R;  1AVS A;  2P6B B;  3BYA A;  1TTX A;  3EVV A;  1TNP A;  1K93 D;  1N2D A;  3SIA A;  1B8R A;  4N5X A;  4PHM A;  3FS7 A;  3IQO A;  1OMD A;  2F33 A;  1QIV A;  1WY9 A;  3I5F B;  4GAO A;  4Q04 A;  3WNX B;  1KQM C;  2M1U A;  1SR6 B;  2KHN A;  5I2Q A;  1NCZ A;  1NX2 A;  5AAN A;  5TNC A;  1YVH A;  1IKU A;  1AJ4 A;  1IH0 A;  2LVI A;  2F2P A;  1BJF A;  3GK2 A;  3O78 A;  2FCD A;  1REC A;  5B8I B;  3VRP A;  3CLN A;  1QV1 A;  1CFD A;  5KTY A;  1LIN A;  4ETO A;  1DJH A;  2MJW B;  2EC6 B;  3JTD B;  3TDZ A;  2KNE A;  2VRG A;  3NSL A;  4AQJ A;  2I2R E;  4MZK A;  1TIZ A;  2L5X B;  4GPL B;  4N1G A;  2LV7 A;  1WRL A;  1ODB A;  3AKA A;  1CFC A;  4PHK A;  1YVL A;  4JPZ B;  2Y4Q A;  1LVC D;  1J7Q A;  2MAZ A;  1V1G A;  3MSE B;  1XFY O;  1R2U A;  4I5N B;  5DKR A;  1TCO B;  1XFW O;  2L0P A;  3DVM A;  1OMV A;  2L51 A;  5IBW A;  4A4B A;  1SBJ A;  2JT3 A;  4MLW A;  1MHO A;  1GQM A;  2KGB C;  1A4P A;  1RRO A;  1ALV A;  4PDZ A;  1YUR A;  1B9A A;  2KYF A;  2ZRS A;  2H61 C;  1XVJ A;  3D0Y A;  5DKQ A; 
#chains in the Genus database with same CATH topology
 2BE6 A;  1VRK A;  2WOR A;  2LNK A;  1UHI A;  1Z4H A;  3NXA A;  2KI6 C;  1LA0 A;  1BOC A;  3TDU A;  3RZS A;  1CMF A;  2K7B A;  1QWV A;  3GOF A;  2F3Y A;  4KYN A;  2LMV A;  1K9K A;  1NUB A;  2LC5 A;  4MRY A;  1KQV A;  1C3Z A;  1CKK A;  2M29 A;  1J7O A;  2BEC A;  4GGF C;  4P5O E;  1S36 A;  2ZFD A;  3D73 A;  4FTG A;  4M2P A;  2SCP A;  1ORG A;  1ZFS A;  2GTE A;  3EG5 B;  4U8D A;  4IL1 A;  4L9M A;  2JZI A;  1CM4 A;  2WCH A;  1SKT A;  2OTG C;  3K1E A;  4JWQ A;  5HLV A;  1UHK A;  1L2O C;  1KQM B;  1MQ1 A;  4CLN A;  4NDD A;  1A03 A;  1MR8 A;  2KBM A;  3CZ1 A;  4DRW A;  1FI5 A;  3F45 A;  1DJX A;  2PRU A;  4OKH A;  3JVT B;  5PAL A;  1BG1 A;  1QS7 A;  4ZCV A;  4HRH A;  3SIB A;  4YRU A;  1N0Y A;  4HRE E;  4C0J A;  3EVR A;  2JU0 A;  1B4C A;  2LHL A;  2BAP A;  1RK9 A;  1GM0 A;  2JTZ A;  1DJY A;  2EC6 C;  3NSO A;  4MRX A;  2M49 B;  5AEQ A;  2BL0 C;  3TUY C;  2BCX A;  1CNP A;  1CDP A;  1KFX S;  1XK4 A;  3OP0 A;  4XYN A;  1SNL A;  3SG2 A;  3L4L A;  3VRQ A;  4PHJ A;  3VRO A;  2Q4U A;  1B8L A;  1SL7 A;  1F70 A;  4F7F A;  1H8B A;  2H8V A;  2O5G A;  1Y1U A;  1U5I A;  2M9G A;  5CSI A;  1SL8 A;  3OGN A;  1K9P A;  1BR1 B;  5I2L A;  3SS3 A;  5BPJ A;  1GGZ A;  2I94 A;  4PE0 A;  5I94 A;  4DUQ A;  1QXP A;  1TWO A;  2WCF A;  2G2B A;  4MN0 A;  4A4C A;  2KYC A;  3EK7 A;  3VB1 A;  1SK6 D;  4UPG A;  3DVK A;  5HYD A;  1QX7 A;  2QPT A;  4OZD A;  3A4U B;  5HL1 A;  1JSA A;  4USL A;  2AAO A;  3EKH A;  2BKH B;  1U5I B;  1J1D A;  3SG4 A;  4GGF A;  2JTT A;  3VGO A;  1K96 A;  2Y1M A;  1RJV A;  2ZKM X;  3D75 A;  4I5L B;  1NCY A;  3OB2 B;  4OVN F;  2R2I A;  3CZ2 A;  3LCP C;  2LMT A;  5D69 A;  1SY9 A;  4YGD B;  3CYZ A;  2K0J A;  4R1E A;  1DC1 A;  1BU3 A;  4FQT A;  4I5K A;  3R1O A;  2LLT A;  2QAC A;  5D7F A;  4MZL A;  1M46 A;  3PJI A;  4M2Q A;  3KEV A;  2KQY A;  4PE4 A;  2KAY A;  4OV2 A;  1XFV O;  1TRF A;  2PAS A;  1IGV A;  1N65 A;  1CDL A;  5JOL A;  1OOH A;  2QEB A;  2B1U A;  1CMG A;  1LXF C;  2CNP A;  2K60 A;  3BUX B;  3IQQ A;  1W7J B;  1YTZ C;  2G9B A;  2OTG B;  4QJ3 B;  1L2O B;  1QLS A;  2PVB A;  2I7A A;  3SS5 A;  1YRT B;  1OMR A;  2KDH A;  1DJI A;  1NX3 A;  1RFJ A;  3JVT C;  2TN4 A;  1B1G A;  3IF7 A;  3O6B A;  2QEO A;  2NXQ A;  4C0L A;  3FWC A;  2BE4 A;  2H2K A;  5J3X A;  1B8C A;  2K2A A;  3NHI A;  1X02 A;  2F3Z A;  4BY4 A;  1EG3 A;  3CTN A;  3R1P A;  5CPV A;  1PK0 D;  2QEH A;  3I5G B;  1C7V A;  1TNW A;  3LL8 B;  1JFK A;  3TZ1 A;  1A29 A;  1JF0 A;  1FBV A;  4JQ0 D;  3CS1 A;  4WQ2 A;  3S0E A;  2BL0 B;  3TUY B;  1MXE A;  4PE1 A;  4YGE B;  3R72 A;  1RTP 1;  1PUL A;  3O2P A;  1IG5 A;  2JQ6 A;  1QIW A;  1FPW A;  3ZWH A;  4PE7 A;  3CR2 A;  3O4Y A;  3PLF B;  1CTR A;  1OZO A;  4NQG A;  1CLL A;  1ALW A;  4PT1 A;  3NSI A;  5FI2 A;  5DIC A;  5EL2 A;  2KLD A;  1UWO A;  2HPS A;  1NSH A;  1XK4 C;  4HRG A;  2GV5 A;  4PCW A;  1S3P A;  1BT6 A;  1YR5 A;  2JRF A;  1FF1 A;  3FE8 A;  1SMG A;  5ER5 A;  2EHB A;  2JNX A;  2EGD A;  1W7I B;  3K21 A;  2L50 A;  2JPT A;  4YBH B;  1JWD A;  4YI9 A;  2BBN A;  1PVB A;  2L2C A;  2M0R A;  2KI4 B;  3B7A A;  1EXR A;  2KAV A;  1XYD A;  2NZ0 A;  3BXK A;  1EG4 A;  1AP4 A;  1CB1 A;  1OQP A;  2L5Y A;  2LVK A;  2L4H A;  2OPO A;  3VRR A;  5AER A;  2CTN A;  2CCM A;  4GGN A;  2WCB A;  3TS5 C;  1LS8 A;  3SG3 A;  2LVJ A;  3L47 A;  3DVE A;  4M2O A;  1NYA A;  3D0Y B;  1GGW A;  3OX6 A;  1OOJ A;  3I5H C;  1BF5 A;  3BUW B;  1UHN A;  2K2F A;  1KSO A;  1V1F A;  2O60 A;  1DMO A;  2K7D A;  1HQV A;  1B7T Y;  1KK7 Z;  3CWG A;  3QRX A;  2JUL A;  1TUZ A;  1UUR A;  3BOW A;  5JJG A;  2L2E A;  3KHE A;  1KWO C;  1KFX L;  3A8R A;  4MZJ A;  1F55 A;  5D3O A;  2K7C A;  1NX1 A;  1F71 A;  4QJ4 B;  3AKB A;  2LCP A;  1UP5 A;  4YI8 A;  3SS4 A;  4YGB B;  3DF0 A;  4I5J A;  2KOT A;  1YUT A;  3GK1 A;  4AOM A;  3BUM B;  4QJ5 B;  2JWW A;  3I5G C;  1SRA A;  1QVI Y;  1OOF A;  2AMI A;  1A2X A;  4TNC A;  2GGM A;  3BOW B;  1IWQ A;  1DVI A;  1QX5 B;  1NP8 A;  2M7N A;  1G33 A;  3I5I C;  4AQI A;  1G8I A;  2L98 A;  2JPO A;  2E6W A;  2ERB A;  4WRI A;  1XFU O;  1KFU L;  3C1V A;  3DF0 B;  3EK8 A;  1OE9 B;  3EK4 A;  1F4O A;  1Y1A A;  1PVA A;  4YGC B;  1YUS A;  1YX8 A;  5K89 A;  5DKN A;  2JXL A;  1WDC C;  2RGI A;  3WXA A;  1TOP A;  3OBV A;  1EJ3 A;  1A75 A;  2M3W A;  3H4S E;  1R6P A;  2KFF A;  4INX A;  1PSB A;  1KCY A;  1JC2 A;  1UUS A;  1SYM A;  1K8U A;  1QAS A;  1KFU S;  1SSE B;  1PRW A;  1XO5 A;  3M0W A;  1GJY A;  1Y6W A;  2NLN A;  1JFJ A;  2KI4 C;  3S0G A;  3PSR A;  2Q91 A;  4HSZ A;  1Z2C B;  1NX0 A;  1J55 A;  2LAP A;  1A75 B;  1SCM C;  2PAL A;  2FOT A;  1S5G Y;  1NIW A;  3LLE A;  3OHM B;  1IJ5 A;  3PN7 C;  1W9Z A;  2COL B;  2MLF C;  2KQ6 A;  2OS8 B;  4OCI A;  3D77 A;  1J1E A;  3RLZ A;  1KK7 Y;  1YX7 A;  5CSF A;  3KO0 A;  3TS5 B;  2LMU A;  4ORC B;  2KGR A;  3BFB A;  1CDM A;  1KK8 B;  3CZ0 A;  1F8H A;  1HT9 A;  1BLQ A;  1QLK A;  3D10 A;  3EVU A;  1ZUZ A;  3I5H B;  1MWN A;  1OOG A;  3SG5 A;  2Y5I A;  3SG7 A;  2HET A;  1J7P A;  1XFR A;  5AFP A;  1WLZ A;  4WQ3 A;  2CBL A;  2ISD A;  1TNX A;  3DY9 A;  4NDB A;  2JT0 A;  1FI6 A;  5AXI A;  1KWO B;  1S6J A;  4GNK B;  2E30 A;  4BY5 A;  3CAB A;  2ZNE A;  3R1V A;  1XFZ O;  2ZRT A;  2P71 A;  2LHI A;  3EKJ A;  3HX4 A;  1QTX A;  2SAS A;  1AHR A;  2A4J A;  5HKY A;  2YGU A;  1M31 A;  1B7T Z;  2PYQ A;  1OW4 A;  1S26 D;  2BKI B;  1LKJ A;  1SPY A;  4GBA A;  3GK4 X;  2LLS A;  2LAN A;  4NDC A;  2JNF A;  1AK8 A;  4GUK A;  2K7O A;  2KLE A;  1C07 A;  2BBM A;  3KF9 A;  2I18 A;  3I5I B;  3VRN A;  1IJ6 A;  1BMO A;  2HQ8 A;  3TDI A;  2WCJ A;  3SG6 A;  4ORB B;  1J7R A;  2PQL A;  1QVI Z;  5I2O A;  1MF8 B;  1AJ5 A;  2WOS A;  2MBX A;  3CGA A;  3PAL A;  1C7W A;  1DJG A;  1WDC B;  3CDN A;  2Y1N A;  4MSP A;  3SJS A;  3BJH A;  2L4I A;  4FQO A;  3CZT X;  5F6T A;  1RWY A;  1DGU A;  1YRU B;  1WRK A;  1MXL C;  4ORA B;  2BCB A;  1NCX A;  2WCE A;  1IQ3 A;  1D1O A;  3O4X A;  2JXC A;  1M63 B;  1E8A A;  1NPQ A;  3OB1 B;  4DCK A;  1C3Y A;  4YGA A;  2IS9 A;  2ZN8 A;  3BUN B;  2LUC A;  2JOJ A;  4MBE A;  2M7L A;  4D1E A;  5KSZ A;  3DD4 A;  4XJK A;  1KSM A;  1SCM B;  2OS8 C;  2LP3 A;  3IVT A;  1ZOT B;  3PN7 B;  3KPX A;  4N1F A;  1DT7 B;  1CLB A;  1XFX O;  1KK8 C;  2F8P A;  2CXJ A;  1K90 D;  1CFP A;  4PHN A;  4P2Y B;  3ICB A;  2FJU B;  4DS7 A;  2KI6 D;  1QV0 A;  3PM8 A;  1S5G Z;  2FCE A;  3NHT A;  1LA3 A;  4XJK B;  1NWD A;  2GGZ A;  1K2H A;  1SL9 A;  1S1E A;  3S0A A;  2NCP A;  1Y1X A;  1K95 A;  1DF0 A;  2KFH A;  3WHU B;  1H4B A;  4C0K A;  1ZAC A;  3DVJ A;  3WHT B;  2HQW A;  2WCL A;  3NGV A;  5CSJ A;  3D74 A;  3B88 A;  3PAT A;  1QX2 A;  2KPH A;  4OR9 B;  3V2L A;  3OX5 A;  2NCO A;  4CPV A;  3E3R A;  1CFF A;  1TNQ A;  1K94 A;  1F54 A;  2M97 A;  5HLO A;  1OSA A;  1UHJ A;  2BCA A;  2LVV A;  2MHH A;  4F0Z B;  2WC8 A;  1CLM A;  1DF0 B;  1YUU A;  2M1K B;  1EH2 A;  3BFH A;  4MEW A;  1L7Z A;  1DTL A;  3CR5 X;  3D78 A;  3DXL A;  3I5F C;  1T14 A;  1PSR A;  3BUO B;  1XA5 A;  3Q8I A;  1TN4 A;  1SR6 C;  2LP2 A;  3NSK A;  2LLU A;  3PM2 A;  3LK1 A;  2MA2 A;  3DYE A;  3FE6 A;  5CSN A;  1SW8 A;  1BR4 B;  2WC6 A;  3AAJ A;  2MRD A;  2ZN9 A;  1OZS A;  3N7H A;  3RM1 A;  2CT9 A;  1F4Q A;  4JD9 A;  5FYX A;  2K61 A;  4IJ7 A;  2AUC A;  1IQ5 A;  4GFT A;  1DJZ A;  2JC2 A;  2JT8 A;  4DIR A;  5FI7 A;  5HKZ A;  3AAK A;  3JTD C;  1OOI X;  1M45 A;  1QAT A;  1B47 A;  2BNX A;  2WND A;  3DZT A;  3FE9 A;  1TCF A;  2M8U A;  2PMY A;  1IRJ A;  1UHH A;  1S6I A;  4CFR A;  4E68 A;  3HCM A;  2MLE C;  2PSR A;  4CID A;  1BOD A;  1DJW A;  5I8N A;  2WC5 A;  2D8N A;  1WRZ A;  3ZNI A;  1PAL A;  2H61 A;  2KBI A;  1JUO A;  2LE9 B;  1M39 A;  2F2O A;  2KAX A;  1JBA A;  1DQE A;  2HF5 A;  2KFG A;  2LUX A;  1EL4 A;  5G08 A;  3CR4 X;  1WLM A;  4MVF A;  1QJT A;  1DEL A;  1MUX A;  2LM5 A;  2WCK A;  3PFV A;  1JF2 A;  1FW4 A;  3FIA A;  1K9U A;  4ICB A;  5GQQ C;  1Y0V H;  2ZND A;  4CFQ A;  1S6C A;  3B87 A;  5KU1 A;  1Q80 A;  2V53 A;  3FWB A;  1ZMZ A;  3BFA A;  3BQ3 A;  1CM1 A;  1AUI B;  2QDI A;  3S0D A;  4ZCU A;  3LK0 A;  2DOQ A;  4JKT A;  4INW A;  1SCV A;  5ER4 X;  2KSP A;  1DGV A;  2K8M B;  5HKW A;  1CDN A;  4PAL A;  1G4Y R;  1AVS A;  2P6B B;  3BYA A;  1TTX A;  2P70 A;  3QME A;  3B6X A;  3EVV A;  1TNP A;  1K93 D;  1N2D A;  3SIA A;  1B8R A;  4N5X A;  4PHM A;  3FS7 A;  3IQO A;  1OMD A;  2F33 A;  1QIV A;  2WCM A;  1WY9 A;  3I5F B;  4GAO A;  4Q04 A;  3WNX B;  1KQM C;  2M1U A;  1SR6 B;  2KHN A;  5I2Q A;  1P28 A;  1NCZ A;  1NX2 A;  3L4A A;  5AAN A;  1YVH A;  5TNC A;  1IKU A;  1AJ4 A;  1IH0 A;  2LVI A;  2F2P A;  1BJF A;  3GK2 A;  3O78 A;  2FCD A;  1REC A;  5B8I B;  3VRP A;  3CLN A;  1QV1 A;  1CFD A;  5KTY A;  1LIN A;  1IIO A;  4ETO A;  1DJH A;  2MJW B;  2EC6 B;  3JTD B;  3TDZ A;  2KNE A;  2VRG A;  3NSL A;  4AQJ A;  2I2R E;  4MZK A;  1TIZ A;  2L5X B;  3D76 A;  4GPL B;  4N1G A;  2FJY A;  2LV7 A;  1WRL A;  1ODB A;  1TUJ A;  3AKA A;  3UO9 A;  3UNW A;  4PHK A;  1CFC A;  2QEV A;  1YVL A;  4JPZ B;  2Y4Q A;  1LVC D;  1J7Q A;  2MAZ A;  1V1G A;  3MSE B;  3S0B A;  1XFY O;  1R2U A;  4I5N B;  5DKR A;  1TCO B;  1XFW O;  3S0F A;  2L0P A;  3DVM A;  1OMV A;  2L51 A;  5IBW A;  4A4B A;  1SBJ A;  2JT3 A;  3B86 A;  1MHO A;  4MLW A;  1DEK A;  1GQM A;  2KGB C;  1A4P A;  1RRO A;  1ALV A;  4PDZ A;  1YUR A;  1B9A A;  2KYF A;  2ZRS A;  5FI6 A;  2H61 C;  1XVJ A;  3D0Y A;  5DKQ A; 
#chains in the Genus database with same CATH homology
 2BE6 A;  1VRK A;  2WOR A;  2LNK A;  1UHI A;  3NXA A;  2KI6 C;  1LA0 A;  1BOC A;  3TDU A;  1CMF A;  2K7B A;  3GOF A;  2F3Y A;  2LMV A;  1K9K A;  1NUB A;  2LC5 A;  4MRY A;  1KQV A;  1CKK A;  2M29 A;  1J7O A;  2BEC A;  4GGF C;  4P5O E;  1S36 A;  2ZFD A;  4FTG A;  4M2P A;  2SCP A;  1ZFS A;  4U8D A;  4IL1 A;  4L9M A;  2JZI A;  1CM4 A;  1SKT A;  2OTG C;  4JWQ A;  5HLV A;  1UHK A;  1L2O C;  1KQM B;  1MQ1 A;  4CLN A;  4NDD A;  1A03 A;  1MR8 A;  2KBM A;  4DRW A;  1FI5 A;  3F45 A;  1DJX A;  2PRU A;  4OKH A;  3JVT B;  5PAL A;  1BG1 A;  1QS7 A;  4ZCV A;  4HRH A;  3SIB A;  4YRU A;  1N0Y A;  4HRE E;  4C0J A;  3EVR A;  2JU0 A;  1B4C A;  2LHL A;  1RK9 A;  2JTZ A;  1DJY A;  2EC6 C;  3NSO A;  4MRX A;  2M49 B;  5AEQ A;  2BL0 C;  3TUY C;  2BCX A;  1CNP A;  1CDP A;  1KFX S;  1XK4 A;  3OP0 A;  4XYN A;  1SNL A;  3SG2 A;  3VRQ A;  4PHJ A;  3VRO A;  2Q4U A;  1B8L A;  1SL7 A;  1F70 A;  1H8B A;  2O5G A;  1U5I A;  1Y1U A;  2M9G A;  5CSI A;  1SL8 A;  5BPJ A;  1K9P A;  1BR1 B;  5I2L A;  1GGZ A;  2I94 A;  4PE0 A;  4DUQ A;  1QXP A;  2WCF A;  2G2B A;  4MN0 A;  4A4C A;  2KYC A;  3EK7 A;  1SK6 D;  4UPG A;  3DVK A;  5HYD A;  1QX7 A;  2QPT A;  3A4U B;  1JSA A;  4USL A;  2AAO A;  3EKH A;  2BKH B;  1U5I B;  1J1D A;  3SG4 A;  4GGF A;  2JTT A;  3VGO A;  1K96 A;  2Y1M A;  1RJV A;  2ZKM X;  4I5L B;  4OVN F;  1NCY A;  3OB2 B;  2R2I A;  3LCP C;  2LMT A;  5D69 A;  1SY9 A;  4YGD B;  2K0J A;  4R1E A;  1BU3 A;  4I5K A;  2LLT A;  2QAC A;  5D7F A;  4MZL A;  1M46 A;  4M2Q A;  3KEV A;  2KQY A;  4PE4 A;  2KAY A;  4OV2 A;  1XFV O;  1TRF A;  2PAS A;  1IGV A;  1N65 A;  1CDL A;  5JOL A;  2B1U A;  1CMG A;  1LXF C;  2CNP A;  3BUX B;  3IQQ A;  1W7J B;  1YTZ C;  2G9B A;  2OTG B;  4QJ3 B;  1L2O B;  1QLS A;  2PVB A;  2I7A A;  1YRT B;  1OMR A;  2KDH A;  1DJI A;  1NX3 A;  1RFJ A;  3JVT C;  2TN4 A;  1B1G A;  3IF7 A;  3O6B A;  2NXQ A;  4C0L A;  3FWC A;  2BE4 A;  2H2K A;  5J3X A;  1B8C A;  2K2A A;  1X02 A;  2F3Z A;  4BY4 A;  1EG3 A;  3CTN A;  5CPV A;  1PK0 D;  3I5G B;  1C7V A;  1TNW A;  3LL8 B;  1JFK A;  3TZ1 A;  1A29 A;  1JF0 A;  1FBV A;  4JQ0 D;  3CS1 A;  4WQ2 A;  2BL0 B;  3TUY B;  1MXE A;  4PE1 A;  4YGE B;  1RTP 1;  1PUL A;  3O2P A;  1IG5 A;  2JQ6 A;  1QIW A;  1FPW A;  3ZWH A;  4PE7 A;  3CR2 A;  3O4Y A;  3PLF B;  1CTR A;  1OZO A;  4NQG A;  1CLL A;  1ALW A;  3NSI A;  1UWO A;  2HPS A;  1NSH A;  1XK4 C;  4HRG A;  2GV5 A;  4PCW A;  1S3P A;  1BT6 A;  1YR5 A;  2JRF A;  1FF1 A;  1SMG A;  5ER5 A;  2EHB A;  2JNX A;  2EGD A;  1W7I B;  3K21 A;  2L50 A;  2JPT A;  4YBH B;  1JWD A;  4YI9 A;  2BBN A;  1PVB A;  2M0R A;  2KI4 B;  1EXR A;  2KAV A;  1XYD A;  2NZ0 A;  3BXK A;  1EG4 A;  1AP4 A;  1CB1 A;  1OQP A;  2LVK A;  2L4H A;  2OPO A;  3VRR A;  5AER A;  2CTN A;  2CCM A;  4GGN A;  2WCB A;  3TS5 C;  3SG3 A;  2LVJ A;  3DVE A;  4M2O A;  1NYA A;  3D0Y B;  1GGW A;  3OX6 A;  1OOJ A;  3I5H C;  1BF5 A;  3BUW B;  1UHN A;  2K2F A;  1KSO A;  1V1F A;  2O60 A;  1DMO A;  2K7D A;  1HQV A;  1B7T Y;  1KK7 Z;  3CWG A;  3QRX A;  2JUL A;  1UUR A;  3BOW A;  5JJG A;  2L2E A;  3KHE A;  1KWO C;  1KFX L;  3A8R A;  4MZJ A;  1F55 A;  2K7C A;  1NX1 A;  1F71 A;  4QJ4 B;  3AKB A;  2LCP A;  1UP5 A;  4YI8 A;  4YGB B;  3DF0 A;  4I5J A;  2KOT A;  1YUT A;  3GK1 A;  4AOM A;  3BUM B;  4QJ5 B;  2JWW A;  3I5G C;  1SRA A;  1QVI Y;  2AMI A;  1A2X A;  4TNC A;  2GGM A;  3BOW B;  1IWQ A;  1DVI A;  1QX5 B;  1NP8 A;  2M7N A;  1G33 A;  3I5I C;  4AQI A;  1G8I A;  2L98 A;  2E6W A;  4WRI A;  1XFU O;  1KFU L;  3C1V A;  3DF0 B;  3EK8 A;  1OE9 B;  3EK4 A;  1F4O A;  1Y1A A;  1PVA A;  4YGC B;  1YUS A;  1YX8 A;  5K89 A;  5DKN A;  2JXL A;  1WDC C;  2RGI A;  3WXA A;  1TOP A;  1EJ3 A;  1A75 A;  2M3W A;  3H4S E;  1R6P A;  2KFF A;  1PSB A;  1KCY A;  1UUS A;  1K8U A;  1QAS A;  1SYM A;  1KFU S;  1PRW A;  1XO5 A;  3M0W A;  1GJY A;  1Y6W A;  2NLN A;  1JFJ A;  2KI4 C;  3PSR A;  2Q91 A;  4HSZ A;  1NX0 A;  1J55 A;  2LAP A;  1A75 B;  1SCM C;  2PAL A;  2FOT A;  1S5G Y;  1NIW A;  3LLE A;  3OHM B;  1IJ5 A;  3PN7 C;  2COL B;  2MLF C;  2KQ6 A;  2OS8 B;  4OCI A;  3RLZ A;  1J1E A;  1KK7 Y;  1YX7 A;  5CSF A;  3KO0 A;  3TS5 B;  2LMU A;  4ORC B;  2KGR A;  1CDM A;  1KK8 B;  1F8H A;  1HT9 A;  1BLQ A;  1QLK A;  3D10 A;  3EVU A;  1ZUZ A;  3I5H B;  1MWN A;  3SG5 A;  2Y5I A;  3SG7 A;  2HET A;  1J7P A;  5AFP A;  1WLZ A;  4WQ3 A;  2CBL A;  2ISD A;  1TNX A;  4NDB A;  2JT0 A;  1FI6 A;  5AXI A;  1KWO B;  1S6J A;  4GNK B;  2E30 A;  4BY5 A;  2ZNE A;  1XFZ O;  2ZRT A;  2LHI A;  3EKJ A;  3HX4 A;  1QTX A;  2SAS A;  1AHR A;  2A4J A;  5HKY A;  1M31 A;  1B7T Z;  1S26 D;  2BKI B;  1LKJ A;  1SPY A;  4GBA A;  3GK4 X;  2LLS A;  2LAN A;  4NDC A;  2JNF A;  1AK8 A;  4GUK A;  2K7O A;  1C07 A;  2BBM A;  3KF9 A;  2I18 A;  3I5I B;  3VRN A;  1IJ6 A;  1BMO A;  2HQ8 A;  3TDI A;  3SG6 A;  4ORB B;  1J7R A;  1QVI Z;  5I2O A;  1MF8 B;  1AJ5 A;  2WOS A;  2MBX A;  3CGA A;  3PAL A;  1C7W A;  1DJG A;  1WDC B;  4MSP A;  2Y1N A;  3SJS A;  2L4I A;  4FQO A;  3CZT X;  5F6T A;  1RWY A;  1DGU A;  1YRU B;  1WRK A;  1MXL C;  4ORA B;  2BCB A;  1NCX A;  2WCE A;  1IQ3 A;  1D1O A;  2JXC A;  1M63 B;  1E8A A;  1NPQ A;  3OB1 B;  4DCK A;  4YGA A;  2IS9 A;  2ZN8 A;  3BUN B;  2LUC A;  2JOJ A;  4MBE A;  2M7L A;  4D1E A;  5KSZ A;  3DD4 A;  4XJK A;  1KSM A;  1SCM B;  2OS8 C;  2LP3 A;  4N1F A;  1ZOT B;  3PN7 B;  3KPX A;  1DT7 B;  1CLB A;  1XFX O;  1KK8 C;  2F8P A;  2CXJ A;  1K90 D;  1CFP A;  4PHN A;  4P2Y B;  3ICB A;  2FJU B;  4DS7 A;  2KI6 D;  1QV0 A;  3PM8 A;  1S5G Z;  2FCE A;  1LA3 A;  4XJK B;  1NWD A;  2GGZ A;  1K2H A;  1SL9 A;  1S1E A;  2NCP A;  1Y1X A;  1K95 A;  1DF0 A;  2KFH A;  3WHU B;  1H4B A;  4C0K A;  1ZAC A;  3DVJ A;  3WHT B;  2HQW A;  5CSJ A;  3PAT A;  1QX2 A;  4OR9 B;  3OX5 A;  2NCO A;  4CPV A;  3E3R A;  1CFF A;  1TNQ A;  1K94 A;  1F54 A;  2M97 A;  5HLO A;  1OSA A;  2BCA A;  1UHJ A;  2LVV A;  2MHH A;  4F0Z B;  2WC8 A;  1CLM A;  1DF0 B;  1YUU A;  2M1K B;  1EH2 A;  4MEW A;  1L7Z A;  1DTL A;  3CR5 X;  1JC2 A;  3I5F C;  1PSR A;  3BUO B;  1XA5 A;  1TN4 A;  1SR6 C;  2LP2 A;  3NSK A;  2LLU A;  3LK1 A;  2MA2 A;  5CSN A;  1SW8 A;  1BR4 B;  3AAJ A;  2MRD A;  2ZN9 A;  1OZS A;  3RM1 A;  2CT9 A;  1F4Q A;  5FYX A;  2K61 A;  2AUC A;  1IQ5 A;  4GFT A;  1DJZ A;  2JC2 A;  2JT8 A;  4DIR A;  5HKZ A;  3AAK A;  3JTD C;  1M45 A;  1QAT A;  1B47 A;  2WND A;  1TCF A;  2M8U A;  2PMY A;  1IRJ A;  1UHH A;  1S6I A;  4CFR A;  4E68 A;  3HCM A;  2MLE C;  2PSR A;  4CID A;  1BOD A;  1DJW A;  5I8N A;  2D8N A;  1WRZ A;  3ZNI A;  1PAL A;  2H61 A;  2KBI A;  1JUO A;  2LE9 B;  1M39 A;  2F2O A;  2KAX A;  1JBA A;  2HF5 A;  2KFG A;  2LUX A;  1EL4 A;  5G08 A;  3CR4 X;  1WLM A;  4MVF A;  1QJT A;  1MUX A;  2LM5 A;  3PFV A;  1JF2 A;  1FW4 A;  3FIA A;  1K9U A;  4ICB A;  5GQQ C;  1Y0V H;  2ZND A;  4CFQ A;  1S6C A;  5KU1 A;  1Q80 A;  2V53 A;  3FWB A;  1ZMZ A;  3BQ3 A;  1CM1 A;  1AUI B;  4ZCU A;  3LK0 A;  2DOQ A;  1SCV A;  5ER4 X;  2KSP A;  1DGV A;  2K8M B;  5HKW A;  1CDN A;  4PAL A;  1G4Y R;  1AVS A;  2P6B B;  3BYA A;  1TTX A;  3EVV A;  1TNP A;  1K93 D;  1N2D A;  3SIA A;  1B8R A;  4N5X A;  4PHM A;  3FS7 A;  3IQO A;  1OMD A;  2F33 A;  1QIV A;  1WY9 A;  3I5F B;  4GAO A;  4Q04 A;  3WNX B;  1KQM C;  2M1U A;  1SR6 B;  2KHN A;  5I2Q A;  1NCZ A;  1NX2 A;  5AAN A;  5TNC A;  1YVH A;  1IKU A;  1AJ4 A;  1IH0 A;  2LVI A;  2F2P A;  1BJF A;  3GK2 A;  3O78 A;  2FCD A;  1REC A;  5B8I B;  3VRP A;  3CLN A;  1QV1 A;  1CFD A;  5KTY A;  1LIN A;  4ETO A;  1DJH A;  2MJW B;  2EC6 B;  3JTD B;  3TDZ A;  2KNE A;  2VRG A;  3NSL A;  4AQJ A;  2I2R E;  4MZK A;  1TIZ A;  2L5X B;  4GPL B;  4N1G A;  2LV7 A;  1WRL A;  1ODB A;  3AKA A;  1CFC A;  4PHK A;  1YVL A;  4JPZ B;  2Y4Q A;  1LVC D;  1J7Q A;  2MAZ A;  1V1G A;  3MSE B;  1XFY O;  1R2U A;  4I5N B;  5DKR A;  1TCO B;  1XFW O;  2L0P A;  3DVM A;  1OMV A;  2L51 A;  5IBW A;  4A4B A;  1SBJ A;  2JT3 A;  4MLW A;  1MHO A;  1GQM A;  2KGB C;  1A4P A;  1RRO A;  1ALV A;  4PDZ A;  1YUR A;  1B9A A;  2KYF A;  2ZRS A;  2H61 C;  1XVJ A;  3D0Y A;  5DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...