2LHNA

Rna-binding zinc finger protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
GPLGSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLPEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear polyadenylated RNA-binding protein NAB2
publication title Structural Basis for Polyadenosine-RNA Binding by Nab2 Zn Fingers and Its Function in mRNA Nuclear Export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Nuclear protein
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lhnA00
2LHNA 3ZJ2A 5L2LA 3ZJ1A
chains in the Genus database with same CATH superfamily
5HYAA 4A5XA 2V7JA 2WMOA 4H63H 4KP3C 5CA0E 3AVSA 3CK6A 2W66A 1JNZA 2ZM8A 2LHRA 4HKAA 2V7IA 4M1PA 4UR9A 2YU2A 4UIGA 2LRLA 5AQPB 4ZI3C 5ABFA 2CBJA 4BA9A 3U78A 3Q9DA 5HEGA 4OFZA 4C90A 4AKHA 4P09A 3AA7B 1NENA 4ILUA 5FP3A 4IDPA 4AKRB 4DV2T 4QHOA 1I6ZA 3ZYLA 4GK0E 3JC6C 4B3MT 4IE5A 2LM9A 2K48A 3ZJ2A 1XDOA 3ZLIA 4Z90A 4ZHQE 4GKJT 2EHOC 5LMUT 4TWHA 4K0UA 5F5WA 2WZHA 4ZI7E 2KSRA 2WQYA 3AEGA 3RRWA 4YY3T 1MNEA 4YTMA 2EHOA 4ASKA 4U3CA 2VQFT 2NW8A 4XBFB 4U31A 1V9DA 2I59A 1T98A 1NEKA 1LKXA 1N36T 4NXMT 5LHHB 1FMWA 3QUJA 4ADZA 4IIJE 2V1DB 1IBMT 3EHZA 5HCMA 2E9XA 3ANWB 5AQIB 4H9NC 3NRXA 5LCYA 2V6XA 2YKSA 4AISA 3ONLC 1FMVA 1HFAA 1YQ3A 4ZZBA 2CLYB 2J1DG 1BR1A 2BBJA 2IUBA 2I6HA 3AE9A 5FKYA 3FBLA 1UX5A 3C98B 2IIUA 2CWOA 3AE7A 3UTKA 2YINA 2WP9A 4HWCA 2X51A 3E08A 4X66T 1WFDA 3K1SA 4PK6A 4CQIA 2LJLA 4UV8B 2V7LA 4IE4A 2B76A 3FZHB 4JI6T 4CI2B 2X68A 3IBPA 4ANJA 3V5SA 2FJEA 3I1AA 2H89A 4ERRA 5L2LA 1UK5A 4TWFA 3P8CD 1FEWA 4LF8T 5FVKA 5AQFB 5AQJB 1W9RA 5ETWA 5JDHA 1KEYA 4JI2T 4DNDA 3O9XA 3DJBA 3R6NA 1XMOT 3BQKA 4XAXB 3OVUA 5LP6E 2IW5B 2BVMA 4LMKA 5LMNT 3EUHA 2VVNA 3K8PC 4YHJA 2MTQA 1WLXA 1D1CA 1DU2A 4KMCA 2BG9B 4IHJE 2LOPA 4O4HE 2B1EA 3WI3A 3M65A 4JEHB 4LF9T 4PFPA 3C50A 1X79A 5HEHA 4ZI2C 3LBXB 3V5UA 2WWUA 3RC8A 3SS1A 3RYFE 2WCAA 2OLTA 2KLQA 2LSYA 2VL8A 2YK0A 2V6YB 5FY7A 4DIDB 2A72A 2L8KA 3LG7A 1JNRA 4JYAT 2H7VC 5CFBA 2BKPA 4MFRA 2V5DA 1OEDE 2KINB 4EYYR 2XAHB 3Q5EA 2IC9A 1E7PA 1J1JA 2KT9A 4L0RA 3PJAJ 4PAGA 4HEAA 5LJMA 2WMNA 2W63A 4IL4A 4LF5T 3HA4A 3MK7C 5LA6E 3P4RA 2V6YA 5LG4A 3T8OA 2SPCA 2WU5A 4PK4A 2JQHA 2AXDS 1G73A 3RPUA 2BZBA 3PE0A 4CN4A 3ZEFB 5C2TA 2WDQA 4L5GA 5JR9B 4OX9T 2QRXA 3RQUA 2F4VT 2BVLA 4I4TE 4H9RC 4X1YE 2BG9E 3ZMTB 4DR1T 2W0GA 1MMGA 2DNXA 3AEBA 3AAIA 3UQ7A 2RP4A 2BS2A 3AXJB 3EVYA 1M7KA 2K3WA 5EZYE 2G0UA 1XZYA 5JR9C 3NZQA 5JDLA 5JVDE 3SFDA 3AE2A 5DQVA 1X9BA 1OWAA 3HKDE 2ACZA 3RIFA 4U74A 2J47A 5J0ZA 4WBOA 3C64A 4DUYT 3SFEA 4DUZT 1KNZA 1HCIA 3CKDA 2VWAA 1WCRA 4O4IE 2X67A 3OYXA 3K3NA 4WYVA 3L8RA 2WS3A 2V5CA 5HXEA 2HPJA 2W61A 4JEUB 3JADA 4B6XA 3CX8B 4NXNT 4CZZB 2CA5A 2XQ3A 4IE0A 3U3IA 3HI2A 4HWFA 4YT0A 5J1GA 4UEMA 3PUXF 4JUYA 3ABVA 5CA1E 1N33T 3MKDA 1HS7A 3UFGA 2CM0A 5F3JA 3O1HA 2UU9T 4JV5T 2JRKA 2DLRA 2J62A 5KXJA 2CMRA 4Z91A 5IUXA 1WYBA 1E1HB 2CWYA 5AQQB 4DV7T 3TLUA 2BS4A 4F6RC 2V26A 3PU3A 5HWXA 5LXTE 5L3GB 5J2UE 4YHHT 2M6IA 1KK7A 4DR7T 2R6GF 5L3FB 3RH3A 4DO0A 4AQGA 5FVLA 3ZYMA 1XNRT 3QB5K 1EZ3A 1UGOA 5LG3A 4TWDA 4I50E 3CX6B 1BR0A 5ABFB 3LDQB 2E8IA 3TLWA 3NBXX 3P7IA 3MJXA 4EB6E 4ISSA 2V7MA 3L09A 4TZ4C 3FZMB 5LGNB 2D2SA 2W4XA 2CEAA 5LBMA 3RYCE 4IDZA 2KMFA 2WZIA 5M4YA 2KNDA 3VU7H 3LSVA 1W0BA 3FZKB 4DV1T 3RYIE 2PFVA 1U4QA 3VRAA 5L3CB 2CRBA 1D1AA 2ES0A 3HKEE 2XPKA 2XQAA 5KMGP 2D0TA 3PURA 5FL0A 2EHOB 3IEEA 3ZCJA 2XSBA 2WSSV 1UCUA 2UUBT 3ETUA 3NVOA 5JDNA 3NKZA 4KHPT 2L9QA 3N9LA 5GONE 4O2AE 4TN7B 3RF1A 4FI5A 5FNVE 1MMDA 5ABEA 2YDQA 1ZP0A 3Q5XA 1E2AA 2E9XB 4QH4A 3H3MA 1LRZA 2Q9QD 5LOVE 5FXZA 2C5KT 4CXXA 4MBQA 3RIUC 5HXSA 3A5XA 3FB2A 1H7CA 4ILBA 4DBRA 2PBIA 3RIUA 1ZOYA 2LKHA 2X66A 2E9XC 2X9HA 4YSXA 2X0HA 4GIWA 2HH7A 2DWGA 3N2KE 1Y01A 4IGUA 2UXCT 3P4WA 4YSZA 2D0UA 3HKCE 4A98A 2DI4A 3AA6B 1S35A 2JIWA 2N9DA 3MA9A 3HL6A 2DCFA 2XAGB 5FMNA 3AB3B 4IE7A 3KV5A 4EAHA 4I0UA 4JI4T 1HG2A 2KWHA 3O4XE 4KBMB 3N2GE 4EOZB 5IYZE 3PDYA 4G63A 2ODVA 2QGSA 2VL0A 1VCSA 1G8XA 4NUUA 2ZM0A 4LFAT 5CB4E 2VKJA 4TX5A 1XNQT 1I94T 5AQNB 4PK5A 3RX6A 3ZN1B 2FJDA 4O4JE 3SRZA 1MIWA 3RKOA 3D0TA 1N32T 4E7ZA 2D9DA 3C51A 1VCTA 4EEDA 3AAAB 3K3OA 4IT4A 4QXCB 4QX7B 4ILCA 3KDSE 2N2NA 2AE9A 2UXNB 1KNRA 1KFYA 2LEHA 1O3XA 4J2CA 2LOSA 3FZLB 5AQMB 2P9BA 4V1Av 4UF0A 4HFDA 3KFWX 4ZS3A 3X1DA 4NUVA 4U2YA 5AQHB 1NAFA 3AE6A 2N1GA 1UURA 4TNWA 2JQKA 4HWDA 3ZMZB 5DABA 2VKDA 4MLKA 1VRBA 4CI1B 5LGTB 3J7Yq 1YXRA 1VOMA 3B57A 1SA0E 3ZC0A 3AE4A 3H3AA 2MPKA 3AE5A 1D0YA 2X9YA 1CHUA 2PTFA 5HXRA 4Z8XA 1D0XA 2XUEA 1ZKEA 3UUMA 3ZT6A 4O4LE 2LM2A 3KBTA 5JH7E 4HFHA 3QC9A 1OEDA 2XQ5A 3P4QA 5LGUB 5L3DB 4MHCA 2I0MA 1IBLT 4UVBB 1T8BA 3AEFA 2JQQA 4N78D 2FBWA 1D1BA 4DMVA 4EZHA 3PTRB 3ZMUB 2GK9A 4YLHA 3CQXC 3ONXA 5TAOA 2X0LB 4A56A 4JLEA 2C5IT 2OV9A 4CN1A 2UXBT 5FY1A 4DBQA 5HCJA 1IJ6A 2BBHA 1R8IA 4HFBA 2Y48B 4HTEA 3RHWA 2Q9QA 2K9AA 3ONJA 4U72A 4DR6T 3R84B 3I0QA 4LMJA 2LSJA 4A97A 3WAJA 5L3EB 1YW0A 1YQ4A 4OYJA 2CBIA 3A8YC 4JBWF 2LSIA 5AQVB 3JAEA 1W0AA 3OBVE 2RA1A 4PJMA 1OXZA 3RLFF 5JTGA 3IA3A 3ZC1A 4JI5T 4ZOLE 3O1JA 4H63V 5L3BB 2CXLA 2MAWA 4ZI3D 5AQKB 4XZCA 3FZFB 3I0OA 1ZHCA 1Y64B 1ZEEA 4X64T 2XQ6A 2MOZA 5JDMA 3RQWA 2WB5A 3PUWF 2IC6A 3Q5DA 4AI6A 1MNDA 2YEVC 4PJNA 2XAFB 4WNKA 3RKGA 3T1HT 4PJJA 2XASB 1XMQT 4HGAA 2W67A 3JC6D 5LB7B 5AQRB 3Q5WA 5LHGB 3UUBA 3HKBE 4WW0A 4QX8B 2CXFA 4YSYA 4HFEA 2ZLYA 3ZPOA 4TV9E 3RGLA 3EABA 2EHOD 5ABHA 2XM1A 5FXWA 3TLSA 4KI0F 4X1KE 2ZM2A 2V7KA 3H37A 4IDNA 4H9PC 3N9OA 1L0VA 2CCQA 2XHEB 2YDSA 1HR0T 5DQWA 3N9NA 4GK5E 5F8PA 2LSKA 5IHYA 4YFSA 3LFMA 5FL1A 3CQGB 2FJAA 4E7SA 4G2AA 2BS3A 4YTNA 3EAMA 3MZKB 5H6RB 4QH1A 2IAKA 2X0YA 4AIUA 1UUSA 4DV6T 2DWKA 4H9SE 3F31A 3ZYKA 3NWIA 3VR8A 5LYJE 3PJAA 5HXHA 1MMNA 3JAFA 1QSDA 5BMVE 2D5UA 3UU6A 4HFCA 2XZEA 2IDOB 4AKLA 2ZMAA 2VK9A 3JCFA 4CI3B 3EDVA 5EK4A 4UVCB 2Y8DA 3AEDA 1HX1B 2YN6A 4GYSA 4LF7T 3OPCA 3PUVF 2XY8B 2XTLA 4X62T 2J4GA 1S94A 2CE7A 4U2ZA 3WAKA 2KXPB 2NW9A 5HAXA 3GN5A 2E2AA 2NTXA 4ISTA 3G06A 3L39A 3HR0A 2KWIB 4EGWA 2VKHA 2QA7A 2XAQB 2OA5A 3P4SA 4BJNA 1SUMB 3OTOT 3FXEB 2LRKA 3RRCA 2H7OA 2PJQA 2NTYA 3J9X1 2UXDT 1WYCA 3KVBA 2IMLA 3N9MA 3UUXB 3PUQA 3MXZA 2WM9A 4PJLA 5DJQC 2XQYA 2A9UA 3GMIA 3I9WA 3RC3A 3ESLA 4DV5T 4MALA 2M67A 1WRDA 1Z0PA 3LJCA 2C0SA 2LT3A 1HNWT 2WWVA 4L9IA 5HXCA 4JI0T 2V8SV 2BKOA 2H3RA 5JRCA 5LHIB 3VHLA 2H88A 5JREA 3FXDB 4QKNA 4KUMB 5KDMC 4K0KT 4H9QC 5EK3A 1J5WA 4ZI2D 4DMWA 1YD8G 3UUNA 1J5ET 1BR4A 2WBLA 4IDQA 3VKGA 2CXDA 1WR0A 2JJ9A 1HF8A 3C4WA 3OJAA 3T1YT 3OYZA 3PUSA 2HN2A 3ZJ1A 3B5MA 3AAEB 5FY0A 2IHR1 2UUAT 3E0ZA 2DHRA 1T72A 3ZSTA 4HE8A 1YKHB 5EK2A 1IJ5A 2NWBA 1QLBA 3N9QA 4QWNB 4GOUA 4JI8T 5AQUB 1HG5A 3PV0F 4B3ST 4IL9A 3PUAA 3RIAA 2WDVA 2XM2A 3TLVA 2VB6A 3LK2B 3CVRA 1D0ZA 1MIVA 2NR4A 1HX8A 2ODUA 4AQFC 5HEOA 4PNIA 2XQ8A 1NWMX 3F2EA 5CJ5A 2YDRA 4LMLA 4LFBT 3DTOA 3KBUA 4AQFA 2WDRA 2E5VA 3PUYF 3KINB 3B13A 5FXVA 4DR5T 3AEAA 4UF0B 1T7SA 3UU3A 1LVFA 3CPZA 3KV4A 2JMKA 4KX6A 3UQ4A 2XAJB 1IBKT 3CQCB 1M62A 4LF4T 2LE8A 3ANWA 4AKIA 3AA1B 3N2OA 3S4UA 2LHNA 4WZXA 4NPPA 2CLYC 3AE3A 4P0AA 2XSAA 3VRBA 3LK3B 3AE8A 3UULA 4CXWA 4FJOA 2K24A 2UUCT 2VVSA 1U5PA 3GA8A 1ZV4X 3AECA 4JI3T 2QVAA 1KF6A 5E0OA 3ZCIA 1OEDB 3SOLA 4EZ4A 2XQ9A 5ABGA 4C91A 3AVRA 3N9PA 4I43B 3UU8A 3DP7A 5JDFA 3UU4A 1Z8UA 4OK0A 2JQ9A 2XQ4A 3FHNA 4I55E 2FUPA 1OEDC 2JMHA 3A7MA 4IDOA 3NRYA 3PUZF 3BK9A 1FIOA 5IWAT 4HWHA 4U7IA 3ZSSA 2LKGA 5JDQA 3I9YA 3UU5A 3N5LA 1YKEB 4UVAB 5J2TE 3MACA 2Q9QB 1MMAA 2CHOA 3IF8B 2PG8A 1XDPA 4PW8A 5FXXA 4EYUA 3UT5E 2WU2A 4IREA 5AQTB 4X65T 2CHNA 4B3TT 4QH5A 4UV9B 1HNXT 4IE6A 1GQEA 2Q9QC 2QYWA 2RPAA 3UFEA 2KZ7B 2BG9C 3VKHA 2LSGA 1FJGT 4O8SA 2W00A 1SE7A 2VQET 4B3RT 3LK42 3CIRA 3CX7B 4HN9A 4COFA 4PFOA 2ZM6T 2BG9A 2VURA 4U7YA 1B7TA 5FYMA 2MBGA 4DV4T 3RYHE 1BR2A 4U33A 3P50A 3QB5A 3BQIA 5LJNA 2NW7A 2HPLA 5C3JA 4OYKA 3NZPA 1US7B 5H6QB 5L47A 3LBXA 1XWMA 3ZT7A 2ACXA 2X9WA 5AQOB 3IHRA 4YJ2E 3CWZB 1CUNA 3PUGA 3AA0B 2UXXB 4JI7T 3C4ZA 4P1NA 1IAPA 4AQYT 5AQGB 5L4HA 4X5TA 4ZZCA 3F57A 4QXHB 4TV8E 4YJ3E 2M6BA 3VR9A 1W09A 1N34T 2VKOA 4Q25A 3RI5A 3OKQA 2A2FX 4H9OC 3AEEA 3ZMVB 2XJ7A 3L3PA 4OHFA 4LF6T 4DR3T 3P4PA 1MIYA 4YXDA 2Z6EA 4X20E 1UX4A 5ADXL 3EDUA 3PU8A 3CMLA 4WBNE 5JQGE 3M3ZB 4JI1T 5JR9A 4CN6A 5BR8T 4DR4T 4DV0T 4GYRA 3EI0A 5L4EA 4CXYA 1SHZC 4AKGA 4BAYB 2CPTA 2E9XD 3FBZA 4HFVA 3GWHA 3TKLB 5HWYA 2HHHT 5HEJA 1AJ3A 2LLYA 2X9XA 4GKKT 3AXJA 4HFIA 2Y6XA 4EV6A 2DL1A 4O2BE 2XQ7A 4EXTA 4F8HA 4DR2T 5AQLB 3QK6A 4X1IE 2YOEA 5HEUA 2W62A 4KHZF 4ZS2A 5CGMA 2YU1A 2NP9A 2E5LT 3QNUA 4EEBA 3SWHA 2A3DA 3O1IA 3KV6A 1LVKA 3ZMSB 1HTJF 5KX5E 5C8YE 3ETVA 2MYSA 2L3LA 3GN5B 3W15B 3ZT5A 5LBQB 4QXBB 1HNZT 3Q2MA 3QOFA 5LNKA 3C4XA 4P0BA 4HWIB 1IZNB 3ZKRA 1WR6A 4EIWA 3AE1A 1QUUA 3KVAA 4YTPA 4DV3T 2VASA 3TLTA 5JDGA 5AQSB 2C5JA 4NIQA 4DVDA 4TNVA 3K3QC 5AFUL 2BDEA 3BQLA 3E22E 4AXPA 4UELA 4BJMA 2WAUA 5A1LA 4ZEYA 2K5BB 2BKNA 4ILAA 2W2UA 2NOXA 2WY2A 2FJBA 3KV9A 4LFCT 1KNPA 3ZN0B 4UXNB 4ZXLA 2JPFA 4TUYE 2HN1A 5JRCB
chains in the Genus database with same CATH topology
5HYAA 4N78D 1D1BA 3KBUA 4DMVA 3PTRB 4AQFA 4EZHA 1KNZA 1HCIA 3ZMUB 2GK9A 2V7JA 2WMOA 3CKDA 4H63H 2VWAA 3CQXC 4YLHA 3ONXA 4O4IE 5TAOA 2X67A 2X0LB 4KP3C 5CA0E 4A56A 3AVSA 4JLEA 3OYXA 2C5IT 3K3NA 3B13A 3KINB 5FXVA 2ZM8A 5FY1A 4UF0B 4DBQA 2LHRA 5HXEA 4HKAA 2HPJA 2V7IA 2W61A 1LVFA 4M1PA 3CPZA 4JEUB 4B6XA 1IJ6A 2YU2A 3CX8B 4UIGA 3KV4A 2JMKA 4CZZB 2CA5A 2XAJB 4ZI3C 2Y48B 3CQCB 4BA9A 4IE0A 2LE8A 3U3IA 3HI2A 3U78A 4HTEA 3ANWA 3Q9DA 4AKIA 3AA1B 2Q9QA 2K9AA 4U72A 3N2OA 3S4UA 4OFZA 4C90A 3R84B 2LHNA 5J1GA 4AKHA 4P09A 4UEMA 3I0QA 2LSJA 4JUYA 5CA1E 3WAJA 3MKDA 5L3EB 1HS7A 2CLYC 3AA7B 1YW0A 4P0AA 2CM0A 4ILUA 5FP3A 5F3JA 3O1HA 4OYJA 4AKRB 2LSIA 4QHOA 3LK3B 2JRKA 3UULA 2DLRA 4CXWA 4FJOA 3ZYLA 2K24A 4GK0E 3JC6C 1U5PA 3GA8A 2CMRA 4IE5A 1ZV4X 2LM9A 2K48A 3ZJ2A 1WYBA 3OBVE 5E0OA 3ZCIA 2RA1A 1E1HB 1OXZA 4PJMA 3ZLIA 2CWYA 3SOLA 4EZ4A 4ZHQE 2EHOC 4C91A 3ZC1A 3AVRA 4ZOLE 3N9PA 4I43B 4F6RC 3O1JA 4K0UA 2V26A 4H63V 5L3BB 3DP7A 5JDFA 2CXLA 4ZI7E 4ZI3D 3RRWA 3PU3A 1MNEA 4XZCA 5HWXA 5LXTE 3I0OA 1ZHCA 1Y64B 2EHOA 5L3GB 1ZEEA 4OK0A 4ASKA 5J2UE 4XBFB 2NW8A 1V9DA 3FHNA 4I55E 1KK7A 2I59A 2MOZA 5JDMA 1T98A 5L3FB 1LKXA 3RH3A 4DO0A 2JMHA 4AQGA 5LHHB 1FMWA 2IC6A 4AI6A 3NRYA 3QUJA 3ZYMA 3BK9A 2YEVC 1EZ3A 1FIOA 1MNDA 2XAFB 4PJNA 4ADZA 4IIJE 4WNKA 5JDQA 2V1DB 4PJJA 2XASB 4I50E 3CX6B 3I9YA 1BR0A 2E8IA 3N5LA 1YKEB 4HGAA 3NBXX 2E9XA 3JC6D 3MJXA 3P7IA 4EB6E 3Q5WA 2V7MA 3ANWB 3L09A 4ISSA 4UVAB 4TZ4C 5J2TE 3MACA 2Q9QB 5LHGB 1MMAA 4H9NC 3HKBE 4WW0A 3IF8B 4QX8B 2CXFA 5LGNB 3NRXA 2PG8A 2D2SA 2ZLYA 4PW8A 5FXXA 2CEAA 5LBMA 4TV9E 5LCYA 3RYCE 3ZPOA 4EYUA 3UT5E 2EHOD 4IDZA 1FMVA 5FXWA 1HFAA 4X1KE 2ZM2A 2V7KA 3H37A 2KMFA 4H9PC 4UV9B 3N9OA 2CLYB 2J1DG 2CCQA 5M4YA 2XHEB 4IE6A 2KNDA 3VU7H 1BR1A 2Q9QC 5DQWA 3UFEA 3N9NA 3RYIE 2PFVA 4GK5E 1U4QA 5F8PA 2KZ7B 2LSKA 5IHYA 3VKHA 3FBLA 2LSGA 1UX5A 4YFSA 4O8SA 5L3CB 3LFMA 3CQGB 1D1AA 3C98B 2W00A 2ES0A 2CWOA 3LK42 4E7SA 4G2AA 3UTKA 3HKEE 2YINA 3CX7B 4HN9A 4PFOA 5KMGP 1B7TA 2D0TA 5FYMA 2X51A 3E08A 3PURA 2MBGA 3RYHE 3MZKB 5H6RB 1BR2A 2EHOB 3IEEA 3ZCJA 3BQIA 5LJNA 4PK6A 2IAKA 2WSSV 1UCUA 2NW7A 2HPLA 2LJLA 4UV8B 2V7LA 4IE4A 4CQIA 3ETUA 4OYKA 5JDNA 4CI2B 3NZPA 1US7B 2X68A 3IBPA 2L9QA 4ANJA 5H6QB 3V5SA 3N9LA 3LBXA 5GONE 2DWKA 3I1AA 4O2AE 4TN7B 2ACXA 2X9WA 4H9SE 3IHRA 3F31A 3ZYKA 4FI5A 5FNVE 4ERRA 1MMDA 5LYJE 3Q5XA 5L2LA 4YJ2E 2E9XB 5HXHA 3CWZB 1CUNA 1LRZA 1MMNA 3P8CD 2Q9QD 1FEWA 3PUGA 1QSDA 5LOVE 5FXZA 5BMVE 2C5KT 2D5UA 3AA0B 4CXXA 2UXXB 4MBQA 3C4ZA 1IAPA 4AKLA 2ZMAA 2VK9A 5HXSA 3A5XA 3FB2A 5ETWA 1H7CA 4CI3B 5JDHA 3EDVA 5EK4A 4DBRA 3F57A 4QXHB 2PBIA 4UVCB 4DNDA 3O9XA 3DJBA 4TV8E 2Y8DA 4YJ3E 3R6NA 4GYSA 2X66A 2E9XC 2X9HA 3BQKA 4GIWA 2VKOA 4XAXB 2HH7A 2DWGA 5LP6E 3N2KE 2XTLA 2IW5B 3OKQA 2BVMA 4IGUA 1S94A 2CE7A 2A2FX 3EUHA 4H9OC 3ZMVB 3K8PC 3L3PA 3WAKA 4YHJA 2KXPB 2D0UA 4OHFA 2NW9A 5HAXA 2MTQA 3HKCE 1WLXA 3GN5A 2NTXA 1D1CA 4ISTA 4KMCA 1MIYA 4IHJE 3HR0A 2Z6EA 2LOPA 4X20E 2KWIB 4O4HE 2VKHA 2B1EA 2DI4A 2QA7A 1UX4A 3AA6B 5ADXL 2XAQB 1S35A 3WI3A 3EDUA 3M65A 2N9DA 3PU8A 3CMLA 2OA5A 4WBNE 3MA9A 5JQGE 4BJNA 4JEHB 3HL6A 2DCFA 4PFPA 3C50A 2XAGB 5JR9A 1X79A 3FXEB 5FMNA 3AB3B 3RRCA 2H7OA 4IE7A 4ZI2C 3KV5A 2PJQA 4EAHA 3LBXB 3V5UA 2NTYA 1HG2A 2KWHA 2WWUA 3O4XE 4KBMB 3J9X1 3RC8A 3N2GE 3SS1A 4GYRA 1WYCA 4EOZB 4CXYA 5IYZE 1SHZC 4AKGA 3KVBA 3PDYA 4BAYB 3RYFE 4G63A 3N9MA 3UUXB 2ODVA 2E9XD 2QGSA 3FBZA 3PUQA 3MXZA 4HFVA 3GWHA 2WM9A 4PJLA 3TKLB 5HWYA 5DJQC 1G8XA 1AJ3A 2X9XA 2KLQA 4NUUA 2LSYA 2VL8A 2XQYA 2ZM0A 5CB4E 2VKJA 3GMIA 3I9WA 3RC3A 3ESLA 2YK0A 4TX5A 2Y6XA 5FY7A 4PK5A 2A72A 2L8KA 4MALA 4O2BE 4EXTA 2M67A 1WRDA 3LG7A 3RX6A 3ZN1B 1Z0PA 3LJCA 2C0SA 2LT3A 4O4JE 3QK6A 4L9IA 4X1IE 3SRZA 2H7VC 5HXCA 1MIWA 3RKOA 4MFRA 2W62A 3D0TA 2KINB 4ZS2A 4EYYR 2XAHB 3C51A 4E7ZA 2YU1A 2NP9A 3AAAB 2H3RA 2IC9A 3K3OA 5JRCA 4QXCB 4QX7B 5LHIB 3VHLA 3KDSE 3SWHA 2A3DA 5JREA 3FXDB 4QKNA 4KUMB 2N2NA 3O1IA 5KDMC 3KV6A 2KT9A 1LVKA 4H9QC 2UXNB 4L0RA 4PAGA 5EK3A 2LEHA 1O3XA 4J2CA 2LOSA 4HEAA 3ZMSB 1HTJF 1YD8G 4DMWA 4ZI2D 3UUNA 5LJMA 2WMNA 5KX5E 2P9BA 4V1Av 2W63A 1BR4A 5C8YE 3ETVA 2MYSA 4UF0A 2WBLA 3KFWX 2CXDA 2L3LA 4ZS3A 3VKGA 3GN5B 3HA4A 3W15B 2JJ9A 4NUVA 1HF8A 1NAFA 3MK7C 5LA6E 2N1GA 5LBQB 3C4WA 3OJAA 4QXBB 3Q2MA 5LG4A 5LNKA 3C4XA 3OYZA 3PUSA 4P0BA 3T8OA 3ZMZB 5DABA 2SPCA 2VKDA 3ZJ1A 1IZNB 3AAEB 5FY0A 4MLKA 1VRBA 4PK4A 4CI1B 1WR6A 4EIWA 5LGTB 3J7Yq 1G73A 3RPUA 2BZBA 3PE0A 3E0ZA 3ZEFB 1QUUA 2DHRA 3KVAA 4L5GA 1VOMA 4HE8A 5JR9B 1YKHB 2VASA 3B57A 5EK2A 1IJ5A 5JDGA 2BVLA 1SA0E 4I4TE 2NWBA 4H9RC 3ZC0A 2C5JA 3N9QA 4QWNB 3H3AA 4X1YE 4DVDA 4GOUA 3ZMTB 2W0GA 1D0YA 2X9YA 3K3QC 1HG5A 5HXRA 5AFUL 2BDEA 3BQLA 4Z8XA 1MMGA 1D0XA 2DNXA 2XUEA 3AAIA 3E22E 4AXPA 1ZKEA 2RP4A 3UUMA 4O4LE 4UELA 3EVYA 3PUAA 4BJMA 2WAUA 5EZYE 5A1LA 2G0UA 5JR9C 3KBTA 3NZQA 2K5BB 5JDLA 5JH7E 5JVDE 2VB6A 3QC9A 3LK2B 5DQVA 3CVRA 2NOXA 1D0ZA 1MIVA 5LGUB 5L3DB 1OWAA 2ODUA 1HX8A 3KV9A 4AQFC 3HKDE 3ZN0B 4UXNB 4MHCA 4PNIA 4U74A 4UVBB 1NWMX 3F2EA 4WBOA 3C64A 2JPFA 4TUYE 5JRCB 2JQQA 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHN A;  3ZJ2 A;  5L2L A;  3ZJ1 A; 
#chains in the Genus database with same CATH topology
 5HYA A;  4A5X A;  2V7J A;  2WMO A;  4H63 H;  4KP3 C;  5CA0 E;  3AVS A;  3CK6 A;  2W66 A;  1JNZ A;  2ZM8 A;  2LHR A;  4HKA A;  2V7I A;  4M1P A;  4UR9 A;  2YU2 A;  4UIG A;  2LRL A;  5AQP B;  4ZI3 C;  5ABF A;  2CBJ A;  4BA9 A;  3U78 A;  3Q9D A;  5HEG A;  4OFZ A;  4C90 A;  4AKH A;  4P09 A;  3AA7 B;  1NEN A;  4ILU A;  5FP3 A;  4IDP A;  4AKR B;  4DV2 T;  4QHO A;  1I6Z A;  3ZYL A;  4GK0 E;  3JC6 C;  4B3M T;  4IE5 A;  2LM9 A;  2K48 A;  3ZJ2 A;  1XDO A;  3ZLI A;  4Z90 A;  4ZHQ E;  4GKJ T;  2EHO C;  5LMU T;  4TWH A;  4K0U A;  5F5W A;  2WZH A;  4ZI7 E;  2KSR A;  2WQY A;  3AEG A;  3RRW A;  4YY3 T;  1MNE A;  4YTM A;  2EHO A;  4ASK A;  4U3C A;  2VQF T;  2NW8 A;  4XBF B;  4U31 A;  1V9D A;  2I59 A;  1T98 A;  1NEK A;  1LKX A;  1N36 T;  4NXM T;  5LHH B;  1FMW A;  3QUJ A;  4ADZ A;  4IIJ E;  2V1D B;  1IBM T;  3EHZ A;  5HCM A;  2E9X A;  3ANW B;  5AQI B;  4H9N C;  3NRX A;  5LCY A;  2V6X A;  2YKS A;  4AIS A;  3ONL C;  1FMV A;  1HFA A;  1YQ3 A;  4ZZB A;  2CLY B;  2J1D G;  1BR1 A;  2BBJ A;  2IUB A;  2I6H A;  3AE9 A;  5FKY A;  3FBL A;  1UX5 A;  3C98 B;  2IIU A;  2CWO A;  3AE7 A;  3UTK A;  2YIN A;  2WP9 A;  4HWC A;  2X51 A;  3E08 A;  4X66 T;  1WFD A;  3K1S A;  4PK6 A;  4CQI A;  2LJL A;  4UV8 B;  2V7L A;  4IE4 A;  2B76 A;  3FZH B;  4JI6 T;  4CI2 B;  2X68 A;  3IBP A;  4ANJ A;  3V5S A;  2FJE A;  3I1A A;  2H89 A;  4ERR A;  5L2L A;  1UK5 A;  4TWF A;  3P8C D;  1FEW A;  4LF8 T;  5FVK A;  5AQF B;  5AQJ B;  1W9R A;  5ETW A;  5JDH A;  1KEY A;  4JI2 T;  4DND A;  3O9X A;  3DJB A;  3R6N A;  1XMO T;  3BQK A;  4XAX B;  3OVU A;  5LP6 E;  2IW5 B;  2BVM A;  4LMK A;  5LMN T;  3EUH A;  2VVN A;  3K8P C;  4YHJ A;  2MTQ A;  1WLX A;  1D1C A;  1DU2 A;  4KMC A;  2BG9 B;  4IHJ E;  2LOP A;  4O4H E;  2B1E A;  3WI3 A;  3M65 A;  4JEH B;  4LF9 T;  4PFP A;  3C50 A;  1X79 A;  5HEH A;  4ZI2 C;  3LBX B;  3V5U A;  2WWU A;  3RC8 A;  3SS1 A;  3RYF E;  2WCA A;  2OLT A;  2KLQ A;  2LSY A;  2VL8 A;  2YK0 A;  2V6Y B;  5FY7 A;  4DID B;  2A72 A;  2L8K A;  3LG7 A;  1JNR A;  4JYA T;  2H7V C;  5CFB A;  2BKP A;  4MFR A;  2V5D A;  1OED E;  2KIN B;  4EYY R;  2XAH B;  3Q5E A;  2IC9 A;  1E7P A;  1J1J A;  2KT9 A;  4L0R A;  3PJA J;  4PAG A;  4HEA A;  5LJM A;  2WMN A;  2W63 A;  4IL4 A;  4LF5 T;  3HA4 A;  3MK7 C;  5LA6 E;  3P4R A;  2V6Y A;  5LG4 A;  3T8O A;  2SPC A;  2WU5 A;  4PK4 A;  2JQH A;  2AXD S;  1G73 A;  3RPU A;  2BZB A;  3PE0 A;  4CN4 A;  3ZEF B;  5C2T A;  2WDQ A;  4L5G A;  5JR9 B;  4OX9 T;  2QRX A;  3RQU A;  2F4V T;  2BVL A;  4I4T E;  4H9R C;  4X1Y E;  2BG9 E;  3ZMT B;  4DR1 T;  2W0G A;  1MMG A;  2DNX A;  3AEB A;  3AAI A;  3UQ7 A;  2RP4 A;  2BS2 A;  3AXJ B;  3EVY A;  1M7K A;  2K3W A;  5EZY E;  2G0U A;  1XZY A;  5JR9 C;  3NZQ A;  5JDL A;  5JVD E;  3SFD A;  3AE2 A;  5DQV A;  1X9B A;  1OWA A;  3HKD E;  2ACZ A;  3RIF A;  4U74 A;  2J47 A;  5J0Z A;  4WBO A;  3C64 A;  4DUY T;  3SFE A;  4DUZ T;  1KNZ A;  1HCI A;  3CKD A;  2VWA A;  1WCR A;  4O4I E;  2X67 A;  3OYX A;  3K3N A;  4WYV A;  3L8R A;  2WS3 A;  2V5C A;  5HXE A;  2HPJ A;  2W61 A;  4JEU B;  3JAD A;  4B6X A;  3CX8 B;  4NXN T;  4CZZ B;  2CA5 A;  2XQ3 A;  4IE0 A;  3U3I A;  3HI2 A;  4HWF A;  4YT0 A;  5J1G A;  4UEM A;  3PUX F;  4JUY A;  3ABV A;  5CA1 E;  1N33 T;  3MKD A;  1HS7 A;  3UFG A;  2CM0 A;  5F3J A;  3O1H A;  2UU9 T;  4JV5 T;  2JRK A;  2DLR A;  2J62 A;  5KXJ A;  2CMR A;  4Z91 A;  5IUX A;  1WYB A;  1E1H B;  2CWY A;  5AQQ B;  4DV7 T;  3TLU A;  2BS4 A;  4F6R C;  2V26 A;  3PU3 A;  5HWX A;  5LXT E;  5L3G B;  5J2U E;  4YHH T;  2M6I A;  1KK7 A;  4DR7 T;  2R6G F;  5L3F B;  3RH3 A;  4DO0 A;  4AQG A;  5FVL A;  3ZYM A;  1XNR T;  3QB5 K;  1EZ3 A;  1UGO A;  5LG3 A;  4TWD A;  4I50 E;  3CX6 B;  1BR0 A;  5ABF B;  3LDQ B;  2E8I A;  3TLW A;  3NBX X;  3P7I A;  3MJX A;  4EB6 E;  4ISS A;  2V7M A;  3L09 A;  4TZ4 C;  3FZM B;  5LGN B;  2D2S A;  2W4X A;  2CEA A;  5LBM A;  3RYC E;  4IDZ A;  2KMF A;  2WZI A;  5M4Y A;  2KND A;  3VU7 H;  3LSV A;  1W0B A;  3FZK B;  4DV1 T;  3RYI E;  2PFV A;  1U4Q A;  3VRA A;  5L3C B;  2CRB A;  1D1A A;  2ES0 A;  3HKE E;  2XPK A;  2XQA A;  5KMG P;  2D0T A;  3PUR A;  5FL0 A;  2EHO B;  3IEE A;  3ZCJ A;  2XSB A;  2WSS V;  1UCU A;  2UUB T;  3ETU A;  3NVO A;  5JDN A;  3NKZ A;  4KHP T;  2L9Q A;  3N9L A;  5GON E;  4O2A E;  4TN7 B;  3RF1 A;  4FI5 A;  5FNV E;  1MMD A;  5ABE A;  2YDQ A;  1ZP0 A;  3Q5X A;  1E2A A;  2E9X B;  4QH4 A;  3H3M A;  1LRZ A;  2Q9Q D;  5LOV E;  5FXZ A;  2C5K T;  4CXX A;  4MBQ A;  3RIU C;  5HXS A;  3A5X A;  3FB2 A;  1H7C A;  4ILB A;  4DBR A;  2PBI A;  3RIU A;  1ZOY A;  2LKH A;  2X66 A;  2E9X C;  2X9H A;  4YSX A;  2X0H A;  4GIW A;  2HH7 A;  2DWG A;  3N2K E;  1Y01 A;  4IGU A;  2UXC T;  3P4W A;  4YSZ A;  2D0U A;  3HKC E;  4A98 A;  2DI4 A;  3AA6 B;  1S35 A;  2JIW A;  2N9D A;  3MA9 A;  3HL6 A;  2DCF A;  2XAG B;  5FMN A;  3AB3 B;  4IE7 A;  3KV5 A;  4EAH A;  4I0U A;  4JI4 T;  1HG2 A;  2KWH A;  3O4X E;  4KBM B;  3N2G E;  4EOZ B;  5IYZ E;  3PDY A;  4G63 A;  2ODV A;  2QGS A;  2VL0 A;  1VCS A;  1G8X A;  4NUU A;  2ZM0 A;  4LFA T;  5CB4 E;  2VKJ A;  4TX5 A;  1XNQ T;  1I94 T;  5AQN B;  4PK5 A;  3RX6 A;  3ZN1 B;  2FJD A;  4O4J E;  3SRZ A;  1MIW A;  3RKO A;  3D0T A;  1N32 T;  4E7Z A;  2D9D A;  3C51 A;  1VCT A;  4EED A;  3AAA B;  3K3O A;  4IT4 A;  4QXC B;  4QX7 B;  4ILC A;  3KDS E;  2N2N A;  2AE9 A;  2UXN B;  1KNR A;  1KFY A;  2LEH A;  1O3X A;  4J2C A;  2LOS A;  3FZL B;  5AQM B;  2P9B A;  4V1A v;  4UF0 A;  4HFD A;  3KFW X;  4ZS3 A;  3X1D A;  4NUV A;  4U2Y A;  5AQH B;  1NAF A;  3AE6 A;  2N1G A;  1UUR A;  4TNW A;  2JQK A;  4HWD A;  3ZMZ B;  5DAB A;  2VKD A;  4MLK A;  1VRB A;  4CI1 B;  5LGT B;  3J7Y q;  1YXR A;  1VOM A;  3B57 A;  1SA0 E;  3ZC0 A;  3AE4 A;  3H3A A;  2MPK A;  3AE5 A;  1D0Y A;  2X9Y A;  1CHU A;  2PTF A;  5HXR A;  4Z8X A;  1D0X A;  2XUE A;  1ZKE A;  3UUM A;  3ZT6 A;  4O4L E;  2LM2 A;  3KBT A;  5JH7 E;  4HFH A;  3QC9 A;  1OED A;  2XQ5 A;  3P4Q A;  5LGU B;  5L3D B;  4MHC A;  2I0M A;  1IBL T;  4UVB B;  1T8B A;  3AEF A;  2JQQ A;  4N78 D;  2FBW A;  1D1B A;  4DMV A;  4EZH A;  3PTR B;  3ZMU B;  2GK9 A;  4YLH A;  3CQX C;  3ONX A;  5TAO A;  2X0L B;  4A56 A;  4JLE A;  2C5I T;  2OV9 A;  4CN1 A;  2UXB T;  5FY1 A;  4DBQ A;  5HCJ A;  1IJ6 A;  2BBH A;  1R8I A;  4HFB A;  2Y48 B;  4HTE A;  3RHW A;  2Q9Q A;  2K9A A;  3ONJ A;  4U72 A;  4DR6 T;  3R84 B;  3I0Q A;  4LMJ A;  2LSJ A;  4A97 A;  3WAJ A;  5L3E B;  1YW0 A;  1YQ4 A;  4OYJ A;  2CBI A;  3A8Y C;  4JBW F;  2LSI A;  5AQV B;  3JAE A;  1W0A A;  3OBV E;  2RA1 A;  4PJM A;  1OXZ A;  3RLF F;  5JTG A;  3IA3 A;  3ZC1 A;  4JI5 T;  4ZOL E;  3O1J A;  4H63 V;  5L3B B;  2CXL A;  2MAW A;  4ZI3 D;  5AQK B;  4XZC A;  3FZF B;  3I0O A;  1ZHC A;  1Y64 B;  1ZEE A;  4X64 T;  2XQ6 A;  2MOZ A;  5JDM A;  3RQW A;  2WB5 A;  3PUW F;  2IC6 A;  3Q5D A;  4AI6 A;  1MND A;  2YEV C;  4PJN A;  2XAF B;  4WNK A;  3RKG A;  3T1H T;  4PJJ A;  2XAS B;  1XMQ T;  4HGA A;  2W67 A;  3JC6 D;  5LB7 B;  5AQR B;  3Q5W A;  5LHG B;  3UUB A;  3HKB E;  4WW0 A;  4QX8 B;  2CXF A;  4YSY A;  4HFE A;  2ZLY A;  3ZPO A;  4TV9 E;  3RGL A;  3EAB A;  2EHO D;  5ABH A;  2XM1 A;  5FXW A;  3TLS A;  4KI0 F;  4X1K E;  2ZM2 A;  2V7K A;  3H37 A;  4IDN A;  4H9P C;  3N9O A;  1L0V A;  2CCQ A;  2XHE B;  2YDS A;  1HR0 T;  5DQW A;  3N9N A;  4GK5 E;  5F8P A;  2LSK A;  5IHY A;  4YFS A;  3LFM A;  5FL1 A;  3CQG B;  2FJA A;  4E7S A;  4G2A A;  2BS3 A;  4YTN A;  3EAM A;  3MZK B;  5H6R B;  4QH1 A;  2IAK A;  2X0Y A;  4AIU A;  1UUS A;  4DV6 T;  2DWK A;  4H9S E;  3F31 A;  3ZYK A;  3NWI A;  3VR8 A;  5LYJ E;  3PJA A;  5HXH A;  1MMN A;  3JAF A;  1QSD A;  5BMV E;  2D5U A;  3UU6 A;  4HFC A;  2XZE A;  2IDO B;  4AKL A;  2ZMA A;  2VK9 A;  3JCF A;  4CI3 B;  3EDV A;  5EK4 A;  4UVC B;  2Y8D A;  3AED A;  1HX1 B;  2YN6 A;  4GYS A;  4LF7 T;  3OPC A;  3PUV F;  2XY8 B;  2XTL A;  4X62 T;  2J4G A;  1S94 A;  2CE7 A;  4U2Z A;  3WAK A;  2KXP B;  2NW9 A;  5HAX A;  3GN5 A;  2E2A A;  2NTX A;  4IST A;  3G06 A;  3L39 A;  3HR0 A;  2KWI B;  4EGW A;  2VKH A;  2QA7 A;  2XAQ B;  2OA5 A;  3P4S A;  4BJN A;  1SUM B;  3OTO T;  3FXE B;  2LRK A;  3RRC A;  2H7O A;  2PJQ A;  2NTY A;  3J9X 1;  2UXD T;  1WYC A;  3KVB A;  2IML A;  3N9M A;  3UUX B;  3PUQ A;  3MXZ A;  2WM9 A;  4PJL A;  5DJQ C;  2XQY A;  2A9U A;  3GMI A;  3I9W A;  3RC3 A;  3ESL A;  4DV5 T;  4MAL A;  2M67 A;  1WRD A;  1Z0P A;  3LJC A;  2C0S A;  2LT3 A;  1HNW T;  2WWV A;  4L9I A;  5HXC A;  4JI0 T;  2V8S V;  2BKO A;  2H3R A;  5JRC A;  5LHI B;  3VHL A;  2H88 A;  5JRE A;  3FXD B;  4QKN A;  4KUM B;  5KDM C;  4K0K T;  4H9Q C;  5EK3 A;  1J5W A;  4ZI2 D;  4DMW A;  1YD8 G;  3UUN A;  1J5E T;  1BR4 A;  2WBL A;  4IDQ A;  3VKG A;  2CXD A;  1WR0 A;  2JJ9 A;  1HF8 A;  3C4W A;  3OJA A;  3T1Y T;  3OYZ A;  3PUS A;  2HN2 A;  3ZJ1 A;  3B5M A;  3AAE B;  5FY0 A;  2IHR 1;  2UUA T;  3E0Z A;  2DHR A;  1T72 A;  3ZST A;  4HE8 A;  1YKH B;  5EK2 A;  1IJ5 A;  2NWB A;  1QLB A;  3N9Q A;  4QWN B;  4GOU A;  4JI8 T;  5AQU B;  1HG5 A;  3PV0 F;  4B3S T;  4IL9 A;  3PUA A;  3RIA A;  2WDV A;  2XM2 A;  3TLV A;  2VB6 A;  3LK2 B;  3CVR A;  1D0Z A;  1MIV A;  2NR4 A;  1HX8 A;  2ODU A;  4AQF C;  5HEO A;  4PNI A;  2XQ8 A;  1NWM X;  3F2E A;  5CJ5 A;  2YDR A;  4LML A;  4LFB T;  3DTO A;  3KBU A;  4AQF A;  2WDR A;  2E5V A;  3PUY F;  3KIN B;  3B13 A;  5FXV A;  4DR5 T;  3AEA A;  4UF0 B;  1T7S A;  3UU3 A;  1LVF A;  3CPZ A;  3KV4 A;  2JMK A;  4KX6 A;  3UQ4 A;  2XAJ B;  1IBK T;  3CQC B;  1M62 A;  4LF4 T;  2LE8 A;  3ANW A;  4AKI A;  3AA1 B;  3N2O A;  3S4U A;  2LHN A;  4WZX A;  4NPP A;  2CLY C;  3AE3 A;  4P0A A;  2XSA A;  3VRB A;  3LK3 B;  3AE8 A;  3UUL A;  4CXW A;  4FJO A;  2K24 A;  2UUC T;  2VVS A;  1U5P A;  3GA8 A;  1ZV4 X;  3AEC A;  4JI3 T;  2QVA A;  1KF6 A;  5E0O A;  3ZCI A;  1OED B;  3SOL A;  4EZ4 A;  2XQ9 A;  5ABG A;  4C91 A;  3AVR A;  3N9P A;  4I43 B;  3UU8 A;  3DP7 A;  5JDF A;  3UU4 A;  1Z8U A;  4OK0 A;  2JQ9 A;  2XQ4 A;  3FHN A;  4I55 E;  2FUP A;  1OED C;  2JMH A;  3A7M A;  4IDO A;  3NRY A;  3PUZ F;  3BK9 A;  1FIO A;  5IWA T;  4HWH A;  4U7I A;  3ZSS A;  2LKG A;  5JDQ A;  3I9Y A;  3UU5 A;  3N5L A;  1YKE B;  4UVA B;  5J2T E;  3MAC A;  2Q9Q B;  1MMA A;  2CHO A;  3IF8 B;  2PG8 A;  1XDP A;  4PW8 A;  5FXX A;  4EYU A;  3UT5 E;  2WU2 A;  4IRE A;  5AQT B;  4X65 T;  2CHN A;  4B3T T;  4QH5 A;  4UV9 B;  1HNX T;  4IE6 A;  1GQE A;  2Q9Q C;  2QYW A;  2RPA A;  3UFE A;  2KZ7 B;  2BG9 C;  3VKH A;  2LSG A;  1FJG T;  4O8S A;  2W00 A;  1SE7 A;  2VQE T;  4B3R T;  3LK4 2;  3CIR A;  3CX7 B;  4HN9 A;  4COF A;  4PFO A;  2ZM6 T;  2BG9 A;  2VUR A;  4U7Y A;  1B7T A;  5FYM A;  2MBG A;  4DV4 T;  3RYH E;  1BR2 A;  4U33 A;  3P50 A;  3QB5 A;  3BQI A;  5LJN A;  2NW7 A;  2HPL A;  5C3J A;  4OYK A;  3NZP A;  1US7 B;  5H6Q B;  5L47 A;  3LBX A;  1XWM A;  3ZT7 A;  2ACX A;  2X9W A;  5AQO B;  3IHR A;  4YJ2 E;  3CWZ B;  1CUN A;  3PUG A;  3AA0 B;  2UXX B;  4JI7 T;  3C4Z A;  4P1N A;  1IAP A;  4AQY T;  5AQG B;  5L4H A;  4X5T A;  4ZZC A;  3F57 A;  4QXH B;  4TV8 E;  4YJ3 E;  2M6B A;  3VR9 A;  1W09 A;  1N34 T;  2VKO A;  4Q25 A;  3RI5 A;  3OKQ A;  2A2F X;  4H9O C;  3AEE A;  3ZMV B;  2XJ7 A;  3L3P A;  4OHF A;  4LF6 T;  4DR3 T;  3P4P A;  1MIY A;  4YXD A;  2Z6E A;  4X20 E;  1UX4 A;  5ADX L;  3EDU A;  3PU8 A;  3CML A;  4WBN E;  5JQG E;  3M3Z B;  4JI1 T;  5JR9 A;  4CN6 A;  5BR8 T;  4DR4 T;  4DV0 T;  4GYR A;  3EI0 A;  5L4E A;  4CXY A;  1SHZ C;  4AKG A;  4BAY B;  2CPT A;  2E9X D;  3FBZ A;  4HFV A;  3GWH A;  3TKL B;  5HWY A;  2HHH T;  5HEJ A;  1AJ3 A;  2LLY A;  2X9X A;  4GKK T;  3AXJ A;  4HFI A;  2Y6X A;  4EV6 A;  2DL1 A;  4O2B E;  2XQ7 A;  4EXT A;  4F8H A;  4DR2 T;  5AQL B;  3QK6 A;  4X1I E;  2YOE A;  5HEU A;  2W62 A;  4KHZ F;  4ZS2 A;  5CGM A;  2YU1 A;  2NP9 A;  2E5L T;  3QNU A;  4EEB A;  3SWH A;  2A3D A;  3O1I A;  3KV6 A;  1LVK A;  3ZMS B;  1HTJ F;  5KX5 E;  5C8Y E;  3ETV A;  2MYS A;  2L3L A;  3GN5 B;  3W15 B;  3ZT5 A;  5LBQ B;  4QXB B;  1HNZ T;  3Q2M A;  3QOF A;  5LNK A;  3C4X A;  4P0B A;  4HWI B;  1IZN B;  3ZKR A;  1WR6 A;  4EIW A;  3AE1 A;  1QUU A;  3KVA A;  4YTP A;  4DV3 T;  2VAS A;  3TLT A;  5JDG A;  5AQS B;  2C5J A;  4NIQ A;  4DVD A;  4TNV A;  3K3Q C;  5AFU L;  2BDE A;  3BQL A;  3E22 E;  4AXP A;  4UEL A;  4BJM A;  2WAU A;  5A1L A;  4ZEY A;  2K5B B;  2BKN A;  4ILA A;  2W2U A;  2NOX A;  2WY2 A;  2FJB A;  3KV9 A;  4LFC T;  1KNP A;  3ZN0 B;  4UXN B;  4ZXL A;  2JPF A;  4TUY E;  2HN1 A;  5JRC B; 
#chains in the Genus database with same CATH homology
 5HYA A;  4N78 D;  1D1B A;  3KBU A;  4DMV A;  3PTR B;  4AQF A;  4EZH A;  1KNZ A;  1HCI A;  3ZMU B;  2GK9 A;  2V7J A;  2WMO A;  3CKD A;  4H63 H;  2VWA A;  3CQX C;  4YLH A;  3ONX A;  4O4I E;  5TAO A;  2X67 A;  2X0L B;  4KP3 C;  5CA0 E;  4A56 A;  3AVS A;  4JLE A;  3OYX A;  2C5I T;  3K3N A;  3B13 A;  3KIN B;  5FXV A;  2ZM8 A;  5FY1 A;  4UF0 B;  4DBQ A;  2LHR A;  5HXE A;  4HKA A;  2HPJ A;  2V7I A;  2W61 A;  1LVF A;  4M1P A;  3CPZ A;  4JEU B;  4B6X A;  1IJ6 A;  2YU2 A;  3CX8 B;  4UIG A;  3KV4 A;  2JMK A;  4CZZ B;  2CA5 A;  2XAJ B;  4ZI3 C;  2Y48 B;  3CQC B;  4BA9 A;  4IE0 A;  2LE8 A;  3U3I A;  3HI2 A;  3U78 A;  4HTE A;  3ANW A;  3Q9D A;  4AKI A;  3AA1 B;  2Q9Q A;  2K9A A;  4U72 A;  3N2O A;  3S4U A;  4OFZ A;  4C90 A;  3R84 B;  2LHN A;  5J1G A;  4AKH A;  4P09 A;  4UEM A;  3I0Q A;  2LSJ A;  4JUY A;  5CA1 E;  3WAJ A;  3MKD A;  5L3E B;  1HS7 A;  2CLY C;  3AA7 B;  1YW0 A;  4P0A A;  2CM0 A;  4ILU A;  5FP3 A;  5F3J A;  3O1H A;  4OYJ A;  4AKR B;  2LSI A;  4QHO A;  3LK3 B;  2JRK A;  3UUL A;  2DLR A;  4CXW A;  4FJO A;  3ZYL A;  2K24 A;  4GK0 E;  3JC6 C;  1U5P A;  3GA8 A;  2CMR A;  4IE5 A;  1ZV4 X;  2LM9 A;  2K48 A;  3ZJ2 A;  1WYB A;  3OBV E;  5E0O A;  3ZCI A;  2RA1 A;  1E1H B;  1OXZ A;  4PJM A;  3ZLI A;  2CWY A;  3SOL A;  4EZ4 A;  4ZHQ E;  2EHO C;  4C91 A;  3ZC1 A;  3AVR A;  4ZOL E;  3N9P A;  4I43 B;  4F6R C;  3O1J A;  4K0U A;  2V26 A;  4H63 V;  5L3B B;  3DP7 A;  5JDF A;  2CXL A;  4ZI7 E;  4ZI3 D;  3RRW A;  3PU3 A;  1MNE A;  4XZC A;  5HWX A;  5LXT E;  3I0O A;  1ZHC A;  1Y64 B;  2EHO A;  5L3G B;  1ZEE A;  4OK0 A;  4ASK A;  5J2U E;  4XBF B;  2NW8 A;  1V9D A;  3FHN A;  4I55 E;  1KK7 A;  2I59 A;  2MOZ A;  5JDM A;  1T98 A;  5L3F B;  1LKX A;  3RH3 A;  4DO0 A;  2JMH A;  4AQG A;  5LHH B;  1FMW A;  2IC6 A;  4AI6 A;  3NRY A;  3QUJ A;  3ZYM A;  3BK9 A;  2YEV C;  1EZ3 A;  1FIO A;  1MND A;  2XAF B;  4PJN A;  4ADZ A;  4IIJ E;  4WNK A;  5JDQ A;  2V1D B;  4PJJ A;  2XAS B;  4I50 E;  3CX6 B;  3I9Y A;  1BR0 A;  2E8I A;  3N5L A;  1YKE B;  4HGA A;  3NBX X;  2E9X A;  3JC6 D;  3MJX A;  3P7I A;  4EB6 E;  3Q5W A;  2V7M A;  3ANW B;  3L09 A;  4ISS A;  4UVA B;  4TZ4 C;  5J2T E;  3MAC A;  2Q9Q B;  5LHG B;  1MMA A;  4H9N C;  3HKB E;  4WW0 A;  3IF8 B;  4QX8 B;  2CXF A;  5LGN B;  3NRX A;  2PG8 A;  2D2S A;  2ZLY A;  4PW8 A;  5FXX A;  2CEA A;  5LBM A;  4TV9 E;  5LCY A;  3RYC E;  3ZPO A;  4EYU A;  3UT5 E;  2EHO D;  4IDZ A;  1FMV A;  5FXW A;  1HFA A;  4X1K E;  2ZM2 A;  2V7K A;  3H37 A;  2KMF A;  4H9P C;  4UV9 B;  3N9O A;  2CLY B;  2J1D G;  2CCQ A;  5M4Y A;  2XHE B;  4IE6 A;  2KND A;  3VU7 H;  1BR1 A;  2Q9Q C;  5DQW A;  3UFE A;  3N9N A;  3RYI E;  2PFV A;  4GK5 E;  1U4Q A;  5F8P A;  2KZ7 B;  2LSK A;  5IHY A;  3VKH A;  3FBL A;  2LSG A;  1UX5 A;  4YFS A;  4O8S A;  5L3C B;  3LFM A;  3CQG B;  1D1A A;  3C98 B;  2W00 A;  2ES0 A;  2CWO A;  3LK4 2;  4E7S A;  4G2A A;  3UTK A;  3HKE E;  2YIN A;  3CX7 B;  4HN9 A;  4PFO A;  5KMG P;  1B7T A;  2D0T A;  5FYM A;  2X51 A;  3E08 A;  3PUR A;  2MBG A;  3RYH E;  3MZK B;  5H6R B;  1BR2 A;  2EHO B;  3IEE A;  3ZCJ A;  3BQI A;  5LJN A;  4PK6 A;  2IAK A;  2WSS V;  1UCU A;  2NW7 A;  2HPL A;  2LJL A;  4UV8 B;  2V7L A;  4IE4 A;  4CQI A;  3ETU A;  4OYK A;  5JDN A;  4CI2 B;  3NZP A;  1US7 B;  2X68 A;  3IBP A;  2L9Q A;  4ANJ A;  5H6Q B;  3V5S A;  3N9L A;  3LBX A;  5GON E;  2DWK A;  3I1A A;  4O2A E;  4TN7 B;  2ACX A;  2X9W A;  4H9S E;  3IHR A;  3F31 A;  3ZYK A;  4FI5 A;  5FNV E;  4ERR A;  1MMD A;  5LYJ E;  3Q5X A;  5L2L A;  4YJ2 E;  2E9X B;  5HXH A;  3CWZ B;  1CUN A;  1LRZ A;  1MMN A;  3P8C D;  2Q9Q D;  1FEW A;  3PUG A;  1QSD A;  5LOV E;  5FXZ A;  5BMV E;  2C5K T;  2D5U A;  3AA0 B;  4CXX A;  2UXX B;  4MBQ A;  3C4Z A;  1IAP A;  4AKL A;  2ZMA A;  2VK9 A;  5HXS A;  3A5X A;  3FB2 A;  5ETW A;  1H7C A;  4CI3 B;  5JDH A;  3EDV A;  5EK4 A;  4DBR A;  3F57 A;  4QXH B;  2PBI A;  4UVC B;  4DND A;  3O9X A;  3DJB A;  4TV8 E;  2Y8D A;  4YJ3 E;  3R6N A;  4GYS A;  2X66 A;  2E9X C;  2X9H A;  3BQK A;  4GIW A;  2VKO A;  4XAX B;  2HH7 A;  2DWG A;  5LP6 E;  3N2K E;  2XTL A;  2IW5 B;  3OKQ A;  2BVM A;  4IGU A;  1S94 A;  2CE7 A;  2A2F X;  3EUH A;  4H9O C;  3ZMV B;  3K8P C;  3L3P A;  3WAK A;  4YHJ A;  2KXP B;  2D0U A;  4OHF A;  2NW9 A;  5HAX A;  2MTQ A;  3HKC E;  1WLX A;  3GN5 A;  2NTX A;  1D1C A;  4IST A;  4KMC A;  1MIY A;  4IHJ E;  3HR0 A;  2Z6E A;  2LOP A;  4X20 E;  2KWI B;  4O4H E;  2VKH A;  2B1E A;  2DI4 A;  2QA7 A;  1UX4 A;  3AA6 B;  5ADX L;  2XAQ B;  1S35 A;  3WI3 A;  3EDU A;  3M65 A;  2N9D A;  3PU8 A;  3CML A;  2OA5 A;  4WBN E;  3MA9 A;  5JQG E;  4BJN A;  4JEH B;  3HL6 A;  2DCF A;  4PFP A;  3C50 A;  2XAG B;  5JR9 A;  1X79 A;  3FXE B;  5FMN A;  3AB3 B;  3RRC A;  2H7O A;  4IE7 A;  4ZI2 C;  3KV5 A;  2PJQ A;  4EAH A;  3LBX B;  3V5U A;  2NTY A;  1HG2 A;  2KWH A;  2WWU A;  3O4X E;  4KBM B;  3J9X 1;  3RC8 A;  3N2G E;  3SS1 A;  4GYR A;  1WYC A;  4EOZ B;  4CXY A;  5IYZ E;  1SHZ C;  4AKG A;  3KVB A;  3PDY A;  4BAY B;  3RYF E;  4G63 A;  3N9M A;  3UUX B;  2ODV A;  2E9X D;  2QGS A;  3FBZ A;  3PUQ A;  3MXZ A;  4HFV A;  3GWH A;  2WM9 A;  4PJL A;  3TKL B;  5HWY A;  5DJQ C;  1G8X A;  1AJ3 A;  2X9X A;  2KLQ A;  4NUU A;  2LSY A;  2VL8 A;  2XQY A;  2ZM0 A;  5CB4 E;  2VKJ A;  3GMI A;  3I9W A;  3RC3 A;  3ESL A;  2YK0 A;  4TX5 A;  2Y6X A;  5FY7 A;  4PK5 A;  2A72 A;  2L8K A;  4MAL A;  4O2B E;  4EXT A;  2M67 A;  1WRD A;  3LG7 A;  3RX6 A;  3ZN1 B;  1Z0P A;  3LJC A;  2C0S A;  2LT3 A;  4O4J E;  3QK6 A;  4L9I A;  4X1I E;  3SRZ A;  2H7V C;  5HXC A;  1MIW A;  3RKO A;  4MFR A;  2W62 A;  3D0T A;  2KIN B;  4ZS2 A;  4EYY R;  2XAH B;  3C51 A;  4E7Z A;  2YU1 A;  2NP9 A;  3AAA B;  2H3R A;  2IC9 A;  3K3O A;  5JRC A;  4QXC B;  4QX7 B;  5LHI B;  3VHL A;  3KDS E;  3SWH A;  2A3D A;  5JRE A;  3FXD B;  4QKN A;  4KUM B;  2N2N A;  3O1I A;  5KDM C;  3KV6 A;  2KT9 A;  1LVK A;  4H9Q C;  2UXN B;  4L0R A;  4PAG A;  5EK3 A;  2LEH A;  1O3X A;  4J2C A;  2LOS A;  4HEA A;  3ZMS B;  1HTJ F;  1YD8 G;  4DMW A;  4ZI2 D;  3UUN A;  5LJM A;  2WMN A;  5KX5 E;  2P9B A;  4V1A v;  2W63 A;  1BR4 A;  5C8Y E;  3ETV A;  2MYS A;  4UF0 A;  2WBL A;  3KFW X;  2CXD A;  2L3L A;  4ZS3 A;  3VKG A;  3GN5 B;  3HA4 A;  3W15 B;  2JJ9 A;  4NUV A;  1HF8 A;  1NAF A;  3MK7 C;  5LA6 E;  2N1G A;  5LBQ B;  3C4W A;  3OJA A;  4QXB B;  3Q2M A;  5LG4 A;  5LNK A;  3C4X A;  3OYZ A;  3PUS A;  4P0B A;  3T8O A;  3ZMZ B;  5DAB A;  2SPC A;  2VKD A;  3ZJ1 A;  1IZN B;  3AAE B;  5FY0 A;  4MLK A;  1VRB A;  4PK4 A;  4CI1 B;  1WR6 A;  4EIW A;  5LGT B;  3J7Y q;  1G73 A;  3RPU A;  2BZB A;  3PE0 A;  3E0Z A;  3ZEF B;  1QUU A;  2DHR A;  3KVA A;  4L5G A;  1VOM A;  4HE8 A;  5JR9 B;  1YKH B;  2VAS A;  3B57 A;  5EK2 A;  1IJ5 A;  5JDG A;  2BVL A;  1SA0 E;  4I4T E;  2NWB A;  4H9R C;  3ZC0 A;  2C5J A;  3N9Q A;  4QWN B;  3H3A A;  4X1Y E;  4DVD A;  4GOU A;  3ZMT B;  2W0G A;  1D0Y A;  2X9Y A;  3K3Q C;  1HG5 A;  5HXR A;  5AFU L;  2BDE A;  3BQL A;  4Z8X A;  1MMG A;  1D0X A;  2DNX A;  2XUE A;  3AAI A;  3E22 E;  4AXP A;  1ZKE A;  2RP4 A;  3UUM A;  4O4L E;  4UEL A;  3EVY A;  3PUA A;  4BJM A;  2WAU A;  5EZY E;  5A1L A;  2G0U A;  5JR9 C;  3KBT A;  3NZQ A;  2K5B B;  5JDL A;  5JH7 E;  5JVD E;  2VB6 A;  3QC9 A;  3LK2 B;  5DQV A;  3CVR A;  2NOX A;  1D0Z A;  1MIV A;  5LGU B;  5L3D B;  1OWA A;  2ODU A;  1HX8 A;  3KV9 A;  4AQF C;  3HKD E;  3ZN0 B;  4UXN B;  4MHC A;  4PNI A;  4U74 A;  4UVB B;  1NWM X;  3F2E A;  4WBO A;  3C64 A;  2JPF A;  4TUY E;  5JRC B;  2JQQ A;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...