2LHNA

Rna-binding zinc finger protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
b'GPLGSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLPEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear polyadenylated RNA-binding protein NAB2
publication title Structural Basis for Polyadenosine-RNA Binding by Nab2 Zn Fingers and Its Function in mRNA Nuclear Export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Nuclear protein
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lhnA00
5L2LA 3ZJ1A 2LHNA 3ZJ2A
chains in the Genus database with same CATH superfamily
4PJLA 5J0ZA 3SS1A 3MXZA 4I43B 2PJQA 4PJMA 2X67A 3C4XA 4PW8A 3NKZA 1T98A 2QGSA 4QX7B 3Q5EA 1UK5A 2XY8B 2D2SA 4I55E 1N36T 3LSVA 3TLUA 5LB7B 4BJMA 2W4XA 5FXZA 3I9YA 2J47A 1KEYA 3UT5E 2YDQA 2M6IA 3K1SA 4WBNE 5FVKA 1YKHB 1HNZT 2QYWA 1UX5A 5AQPB 4HFVA 2IHR1 5IWAT 4G2AA 2KZ7B 2JMHA 3AE4A 1YW0A 2WWVA 4GK0E 5FY0A 3ONXA 3ZCIA 3RX6A 4CN4A 3RKOA 4P0AA 2CCQA 5AQLB 3RF1A 4YSXA 5AQMB 4U33A 5L2LA 4PK4A 5FNVE 3UQ4A 2K5BB 4U74A 4DV7T 1N34T 4I4TE 2JPFA 2GK9A 3P7IA 3TLVA 2X0HA 1ZEEA 3VR8A 1UX4A 5JTGA 3PUYF 3HL6A 2Y8DA 2XQAA 2X0YA 2YKSA 2V6YA 1MMDA 4YHHT 3HKBE 4XZCA 1SE7A 2DWKA 1JNRA 1BR0A 4GIWA 2X0LB 4DUZT 3JADA 5AQSB 5JDNA 3FZFB 4B6XA 2W0GA 2LM2A 3A7MA 1E7PA 2E2AA 1BR4A 5H6RB 4LF8T 4PJJA 4JUYA 2KSRA 3K3OA 1FMWA 4EXTA 2LT3A 2OLTA 4UVAB 4H9PC 3W15B 2IC9A 3QUJA 2LEHA 1BR1A 5AQKB 4ISTA 1L0VA 3TKLB 4A97A 3AEEA 5AQIB 2LLYA 4TWHA 2VURA 3PUZF 3RRCA 4I50E 2WZHA 4TNVA 2JQQA 4EV6A 1HR0T 5JDFA 3UTKA 3SOLA 3ZMZB 4UXNB 1U5PA 4P1NA 2IIUA 2UXBT 4IL4A 2BG9E 3NZPA 4L5GA 2I59A 2C5JA 2IC6A 1IBLT 4PNIA 1YQ4A 2NTXA 4C90A 2QRXA 2JIWA 2X9HA 2YK0A 2C5IT 2XAQB 4KBMB 4JI1T 3I0QA 1HTJF 5LMUT 5TAOA 5HEGA 3FZHB 2XASB 3MK7C 4YTPA 3PU8A 4DV4T 2JJ9A 4DBRA 3OBVE 5LJMA 3AA7B 3AAIA 1T7SA 2W63A 1KF6A 5FXXA 4TWDA 5JQGE 3CX6B 4DR1T 4PAGA 2HPLA 3A5XA 2W2UA 3KV4A 3IF8B 2WP9A 2N1GA 5C2TA 4XAXB 2DNXA 2XZEA 4YT0A 4CXXA 4L9IA 4UV9B 3VKGA 2LOPA 2WY2A 3ETVA 1KNPA 2NW8A 3CQXC 3P8CD 4DR7T 3UULA 2WMNA 3ONJA 2ZM0A 2LOSA 3QK6A 4CXYA 4A5XA 3WAKA 3IHRA 2Y6XA 3KBTA 2BKPA 3LK3B 3KV9A 3AE8A 4U31A 4OX9T 3VR9A 3JAEA 4ILBA 5KDMC 1HNXT 4PFPA 3SRZA 1IZNB 4PK6A 2V6XA 2V7JA 4KHZF 4O2BE 2E9XD 4DV3T 4IDOA 3CKDA 5L3BB 5LBQB 1ZV4X 3AEDA 1J5ET 2Q9QD 2MYSA 3A8YC 4YSYA 4ZS3A 2WWUA 3AECA 3QB5K 1W0BA 5FYMA 4FJOA 4HFDA 2V1DB 3UUNA 4F6RC 3OVUA 3PUAA 5LHHB 5LGUB 5JREA 2FUPA 4DR2T 4CN1A 4H9OC 3ZMTB 4YTMA 4UIGA 4K0UA 3ONLC 5FVLA 5HCJA 5EK3A 3T1YT 4UR9A 5BMVE 4H9QC 1E2AA 3AE1A 3RIFA 2XQ7A 4ZS2A 1YKEB 1XNQT 4HFIA 5C8YE 3EUHA 4YJ3E 1NENA 2BS3A 1HG5A 4AI6A 3F31A 4NUVA 3PURA 1KNZA 1HFAA 3KV6A 1MMAA 2RPAA 3ZMUB 5C3JA 1KNRA 5FP3A 3UUBA 4LMJA 3PJAJ 3PUSA 4GOUA 4YFSA 5FXVA 4X62T 1G73A 2FJDA 3RI5A 1J5WA 2JMKA 4QH4A 3L3PA 3ZSTA 2YU2A 3PJAA 1NAFA 4H9SE 5AQVB 1HF8A 3R6NA 5IHYA 4TN7B 5HEJA 2ACXA 2FBWA 3AE6A 4OHFA 3AA0B 3N9QA 4ZI7E 4E7SA 4IE7A 4WBOA 3DP7A 1OEDC 4DV0T 4IDQA 4OFZA 2HHHT 3NVOA 2CEAA 1MNDA 2MOZA 4UEMA 5HAXA 3FZKB 2A2FX 2KT9A 2ES0A 5IYZE 1R8IA 2WBLA 4EOZB 3C4WA 4AQFA 4DUYT 1OEDB 4DVDA 2XJ7A 5EZYE 5FL1A 2KMFA 5ABFA 1GQEA 2JQHA 5AQTB 5LCYA 1WCRA 4Z8XA 2K48A 4LF9T 4TWFA 3PUQA 3Q5XA 3C64A 1BR2A 1LVFA 3NWIA 3RYHE 2YINA 3OPCA 3AXJA 4AQYT 1D1CA 2KINB 5AQUB 2EHOD 3ZN0B 2K24A 5JDHA 2UUBT 2CXFA 3ZMVB 3EDVA 3IBPA 4GYRA 5HEHA 5GONE 5DJQC 4HWCA 4ILUA 5HXSA 3CX8B 4IE6A 4JI4T 2D5UA 4DV2T 2HN1A 1HG2A 5CA0E 2A72A 3PUGA 4MALA 2VQFT 4I0UA 3ZT7A 4IE0A 2C5KT 5LYJE 2OV9A 3C51A 3D0TA 2E9XA 4COFA 4IDNA 3J9X1 4KP3C 4AQFC 3AAAB 4HWDA 5JVDE 3LFMA 2BG9A 1N32T 1X79A 5H6QB 2XSBA 4OK0A 3ZSSA 2BBHA 3RGLA 1M7KA 5FMNA 3ZYKA 3SFEA 2M67A 4KX6A 3QC9A 5ABFB 2VL8A 3PE0A 4N78D 5BR8T 1VCSA 4JI3T 3VKHA 2X9XA 3LG7A 5FL0A 2X66A 3H37A 1O3XA 2MPKA 5CFBA 3AE2A 2JQKA 4EEDA 3S4UA 1Z8UA 4KMCA 3PV0F 2VL0A 4NXNT 5HXCA 4CN6A 1SA0E 5ABHA 5JH7E 3N5LA 3LBXA 5EK2A 4O4JE 3UU5A 1SHZC 2XUEA 2XSAA 1I94T 2PTFA 3CIRA 3QB5A 5AQQB 2MBGA 3RYFE 5FKYA 2BDEA 5DQWA 3PDYA 1FEWA 4ZI2D 4AQGA 5LP6E 2YN6A 2BG9C 5DQVA 2I6HA 5AQJB 2L9QA 1NEKA 2KXPB 2B1EA 4H63V 1WR6A 3BK9A 3ZT6A 4B3ST 4B3MT 3PU3A 2IAKA 3PUXF 4HKAA 4AXPA 1D0ZA 4X1IE 1CHUA 2BG9B 4HWIB 4OYKA 2XAFB 1UURA 2RP4A 2VQET 2WDRA 5AFUL 1WLXA 2V26A 1HX8A 3EAMA 4AKHA 2P9BA 1QLBA 4PFOA 2LSYA 4UVBB 2J4GA 2XPKA 3HI2A 4WZXA 3MA9A 3MKDA 2JRKA 5JRCA 1MIWA 4O2AE 1W9RA 3TLWA 5HWXA 4JYAT 3JC6C 2NP9A 2AXDS 2BKOA 3LK2B 3FB2A 2WMOA 3CX7B 2LSGA 2HH7A 4QXBB 1D1AA 2V6YB 3PUVF 4DR5T 5LGNB 4ERRA 2I0MA 4EIWA 5ADXL 3BQIA 5DABA 5JDLA 4MFRA 2VASA 3FXDB 3ANWA 3NZQA 4YXDA 1M62A 3LBXB 3EDUA 4U2YA 2NTYA 4O8SA 2J62A 2WDVA 1LKXA 3EI0A 4HE8A 4AISA 4TV8E 2DI4A 5L4EA 2NR4A 2LKHA 1HS7A 2XM1A 4GYSA 1MIVA 1VRBA 2XAGB 4G63A 3RRWA 1XMQT 1JNZA 3NRXA 4CI1B 5AQFB 3AEAA 3CPZA 5LXTE 3LDQB 1SUMB 4HEAA 3I0OA 4IREA 3ZKRA 2ZM8A 3GA8A 4WNKA 1IBMT 2DHRA 3HKDE 3AE5A 5E0OA 4LF7T 2N9DA 5JDQA 5M4YA 1CUNA 4X1YE 2YDSA 4U3CA 3T8OA 3LJCA 4TZ4C 3ZT5A 3ABVA 1FIOA 3P50A 3I1AA 1ZKEA 1H7CA 2QA7A 2BBJA 4EAHA 2V5DA 4JEUB 2W67A 3E0ZA 3AEFA 5KMGP 2NWBA 2BS4A 5L3CB 2BS2A 3Q5WA 3J7Yq 2ZMAA 2LSJA 3DTOA 2L8KA 2CHNA 3ANWB 2VK9A 1XMOT 5KXJA 2QVAA 4H9RC 1FJGT 2XQ8A 3DJBA 4X64T 2IMLA 2UXXB 3N9PA 5HCMA 3P4RA 4QWNB 1NWMX 1HCIA 2D0TA 2CBIA 5ABEA 2UU9T 4MBQA 5A1LA 3RKGA 1D0YA 3N2OA 3O1JA 2E8IA 2WB5A 4U72A 1Y64B 4U2ZA 1D0XA 4ANJA 2YDRA 4QXHB 1LRZA 3EABA 4O4IE 3T1HT 1ZP0A 3OYXA 4JI7T 4QKNA 1WYBA 2MAWA 3OYZA 3ESLA 1XZYA 2AE9A 2L3LA 4C91A 3I9WA 2XHEB 5HEUA 4LF5T 3RIUA 2NOXA 3CWZB 4DR6T 2ODUA 3AA6B 1X9BA 1LVKA 1QSDA 3P4WA 1IBKT 4AKGA 1V9DA 3FZLB 1HNWT 2JQ9A 2UXCT 3AA1B 1G8XA 5LMNT 2H88A 3LK42 2VKJA 1VOMA 2X51A 2W62A 2X68A 2XAHB 4UVCB 3MJXA 4DR3T 1KK7A 2WS3A 3H3MA 3RIAA 3V5UA 2HPJA 2CXLA 2DL1A 2LRKA 4DIDB 2VB6A 2XQ3A 5FXWA 4YY3T 3K3NA 1YQ3A 3BQLA 3RHWA 2V7MA 2D9DA 5AQHB 4DR4T 4ZHQE 4EGWA 4BAYB 1N33T 4ZI2C 2WZIA 3SFDA 5KX5E 1Z0PA 3AVRA 3VRBA 4LMLA 4U7YA 4LMKA 3RPUA 2FJEA 2OA5A 4TV9E 4UV8B 3KVAA 2R6GF 4DNDA 4GKJT 3Q2MA 1KFYA 3EHZA 5HEOA 4IE5A 4O4HE 2LSKA 2PG8A 4JI2T 1S94A 3FBLA 1MIYA 4Z91A 4HN9A 1OEDE 3JAFA 5LG3A 2WDQA 4GK5E 4LFCT 2Z6EA 4IDZA 3N9LA 5CJ5A 4NUUA 4HWHA 3OJAA 2XQ9A 4KUMB 2WAUA 3C98B 3OTOT 3AEBA 3Q9DA 2G0UA 3MZKB 5AQRB 1Y01A 3GMIA 2LM9A 1UGOA 3E08A 3ZMSB 2DWGA 2MTQA 4YJ2E 3IA3A 4B3RT 5L3GB 2PBIA 3G06A 2SPCA 1UUSA 2H3RA 4DV1T 5F8PA 2X9WA 4PJNA 4TUYE 4UF0A 3P4PA 2Q9QA 1DU2A 3ZJ2A 2BVMA 3ZYMA 3AE3A 4JLEA 2KNDA 2V5CA 3K8PC 4UELA 4FI5A 4YTNA 2ZLYA 3N9MA 3WAJA 3KINB 1UCUA 2BKNA 5HYAA 2CLYC 3UFGA 3UUMA 3AB3B 4DMWA 3C4ZA 2XAJB 2UXDT 4DV5T 2CPTA 4ASKA 4ZI3D 2LHRA 3AE9A 3H3AA 1B7TA 3ZC1A 2W66A 2FJBA 2XQ5A 4X20E 3AXJB 2ODVA 4Z90A 3M65A 2CLYB 3ZEFB 5LG4A 5LGTB 2Y48B 2KWHA 3CQGB 1MMNA 2CBJA 4KHPT 2XM2A 3ETUA 4HFCA 2E9XC 3NBXX 3FZMB 1WR0A 2XTLA 3UU8A 3ZN1B 4EZHA 1XDPA 3O9XA 3RYCE 1T72A 5LJNA 4WYVA 1E1HB 2Q9QC 4LFBT 3HKEE 4HFHA 2W61A 3SWHA 4HGAA 2PFVA 4CXWA 4LFAT 1QUUA 3B13A 2CA5A 3O1IA 2E9XB 3ZLIA 5L3FB 2UUCT 3P4SA 3O4XE 4HWFA 5J2UE 3CMLA 5HXRA 3RH3A 3L8RA 4H63H 2VWAA 4NXMT 4UF0B 2Q9QB 3ZC0A 5HXHA 4EB6E 2DCFA 4QX8B 4LF6T 4ZZBA 4QHOA 2M6BA 4MLKA 3FHNA 2YEVC 3UQ7A 2LJLA 1VCTA 1XNRT 4X5TA 2A3DA 3EVYA 2ZM6T 4X1KE 4AKRB 4O4LE 4HFEA 5L3DB 4EYYR 3RC3A 4ISSA 3KVBA 5JR9A 5J2TE 3HA4A 2N2NA 4QH5A 1IJ6A 2CMRA 1HX1B 3VU7H 3UUXB 1YD8G 3WI3A 3ZYLA 2KLQA 5LHIB 4DBQA 5AQOB 4K0KT 1EZ3A 3E22E 3JCFA 4ZXLA 2H7OA 2IUBA 1I6ZA 3F2EA 4NPPA 3V5SA 4XBFB 4HFBA 1U4QA 5HXEA 4JI5T 2BVLA 1OWAA 2E5LT 5CGMA 3X1DA 5L47A 4L0RA 3FBZA 3N9NA 3U78A 3RLFF 4YLHA 2E5VA 2LRLA 3VHLA 4P0BA 2EHOA 2UXNB 4BJNA 4EZ4A 3N9OA 4E7ZA 4ILAA 2YU1A 3UU4A 5F3JA 5JR9C 3N2KE 3CQCB 4IGUA 4AKIA 3HKCE 5ABGA 4Q25A 2CM0A 4IE4A 5JRCB 2LE8A 4CZZB 2LHNA 3R84B 5CA1E 1WRDA 3N2GE 4AIUA 5JR9B 3AVSA 2CXDA 2CHOA 1XWMA 4JI0T 1W09A 3RC8A 4IDPA 4ILCA 4GKKT 4ZZCA 3AEGA 1WYCA 4AKLA 4ZOLE 3RQUA 2CWOA 2W00A 3RYIE 2VVSA 2V7LA 2CWYA 5FY7A 3UU6A 2RA1A 4JV5T 3KBUA 4ZEYA 2WU2A 2A9UA 3GN5A 5AQNB 1WFDA 2LKGA 3VRAA 2XQ6A 4TX5A 4LF4T 3HR0A 4M1PA 3BQKA 5LNKA 1IAPA 3PUWF 2ZM2A 4A98A 4JEHB 2EHOC 4CI2B 3QNUA 5IUXA 2F4VT 3UU3A 3KV5A 4F8HA 2XQ4A 3U3IA 1MNEA 3O1HA 4OYJA 2H7VC 3GWHA 5LHGB 1XDOA 3C50A 4EYUA 2HN2A 2J1DG 3ZJ1A 3K3QC 2XQYA 4TNWA 1W0AA 1US7B 4J2CA 2EHOB 3JC6D 1YXRA 5CB4E 2V7IA 1OEDA 4H9NC 4DMVA 2BZBA 2D0UA 2H89A 4MHCA 5LOVE 2VKOA 5AQGB 2KWIB 1S35A 3UFEA 4ADZA 1IJ5A 1FMVA 5LBMA 4IIJE 3L39A 4EEBA 4DV6T 3TLTA 3QOFA 3B57A 2WCAA 2DLRA 4BA9A 2K9AA 2V7KA 5FY1A 2IW5B 5F5WA 2VKDA 4B3TT 3KFWX 4X65T 4JI6T 5LA6E 3L09A 3PTRB 3IEEA 2NW9A 5L3EB 2WQYA 3NRYA 4WW0A 3RQWA 3P4QA 4YHJA 4JI8T 2FJAA 4X66T 4ZI3C 5JDMA 3M3ZB 3GN5B 3F57A 4QXCB 4P09A 1MMGA 2C0SA 3AAEB 2UUAT 2CRBA 3CVRA 4CI3B 2B76A 4NIQA 3Q5DA 2WSSV 3AE7A 5HWYA 5ETWA 2V8SV 2VVNA 4DO0A 3FXEB 3TLSA 4IT4A 3B5MA 2LSIA 3CK6A 1ZOYA 2WU5A 3RIUC 2NW7A 3MACA 2CE7A 2VKHA 4HTEA 1J1JA 2YOEA 1ZHCA 1OXZA 4IHJE 3ZPOA 4U7IA 2X9YA 2WM9A 3KDSE 4CQIA 2ACZA 1D1BA 4IL9A 5EK4A 1T8BA 2IDOB 4QH1A 5J1GA 4A56A 4PK5A 3OKQA 4JBWF 1AJ3A 3ZCJA 5JDGA 4YSZA 4V1Av 4KI0F 2K3WA 5L4HA
chains in the Genus database with same CATH topology
4PJLA 4HEAA 3ZMUB 2W61A 3I0OA 5FP3A 3SWHA 3SS1A 4HGAA 2PFVA 3MXZA 4CXWA 2ZM8A 1QUUA 3B13A 3GA8A 4I43B 2CA5A 3O1IA 4WNKA 2E9XB 3ZLIA 5L3FB 2DHRA 3O4XE 2PJQA 5J2UE 3HKDE 4PJMA 3CMLA 2X67A 3C4XA 4PW8A 5E0OA 5HXRA 2N9DA 3RH3A 5JDQA 4H63H 1T98A 2QGSA 2VWAA 4QX7B 4UF0B 5M4YA 2Q9QB 1CUNA 3PUSA 4X1YE 4GOUA 3T8OA 4YFSA 3LJCA 5FXVA 5HXHA 3ZC0A 4TZ4C 4EB6E 2DCFA 1G73A 2D2SA 4I55E 4QX8B 1FIOA 2JMKA 3I1AA 4QHOA 3L3PA 2YU2A 4BJMA 1ZKEA 1H7CA 2QA7A 4MLKA 3FHNA 1NAFA 2YEVC 2LJLA 3I9YA 5FXZA 4EAHA 3UT5E 4H9SE 4WBNE 1HF8A 2A3DA 4JEUB 3R6NA 3EVYA 1YKHB 5IHYA 1UX5A 4TN7B 4X1KE 3E0ZA 4AKRB 4O4LE 5KMGP 2NWBA 4HFVA 5L3DB 4EYYR 2ACXA 3RC3A 4G2AA 4OHFA 5L3CB 2KZ7B 2JMHA 4ISSA 3KVBA 5JR9A 1YW0A 3AA0B 3N9QA 5J2TE 3HA4A 4ZI7E 4GK0E 5FY0A 4E7SA 3ONXA 3ZCIA 3Q5WA 4IE7A 3RX6A 3J7Yq 4WBOA 2N2NA 1IJ6A 2CMRA 2ZMAA 3RKOA 4P0AA 2CCQA 3VU7H 3DP7A 2LSJA 3UUXB 1YD8G 3DTOA 4OFZA 2L8KA 3ANWB 2VK9A 5L2LA 4PK4A 2CEAA 5FNVE 1MNDA 2K5BB 4H9RC 3WI3A 2KLQA 3ZYLA 4U74A 2MOZA 4I4TE 4UEMA 5HAXA 2JPFA 3DJBA 2GK9A 2A2FX 3P7IA 2KT9A 5LHIB 2UXXB 3N9PA 2ES0A 4DBQA 5IYZE 2WBLA 1ZEEA 4QWNB 1NWMX 3C4WA 4EOZB 1HCIA 2D0TA 4AQFA 1EZ3A 4DVDA 1UX4A 3E22E 3HL6A 3ZJ1A 2Y8DA 5EZYE 2KMFA 4MBQA 5A1LA 1D0YA 3N2OA 3O1JA 2H7OA 1MMDA 5LCYA 3HKBE 3F2EA 3V5SA 2E8IA 4XZCA 4Z8XA 4XBFB 2DWKA 4U72A 2K48A 1BR0A 4GIWA 1Y64B 2X0LB 1D0XA 1U4QA 5HXEA 4ANJA 5JDNA 4QXHB 4B6XA 1LRZA 2W0GA 3PUQA 2BVLA 1OWAA 3Q5XA 3C64A 4O4IE 4L0RA 3FBZA 1BR4A 3N9NA 1BR2A 1LVFA 3U78A 5H6RB 3OYXA 4PJJA 4YLHA 4QKNA 1WYBA 4JUYA 3RYHE 3K3OA 3OYZA 3ESLA 1FMWA 3VHLA 4EXTA 2YINA 2LT3A 2L3LA 4P0BA 4C91A 2EHOA 1D1CA 2UXNB 3I9WA 2XHEB 4UVAB 3N9OA 4BJNA 4EZ4A 4H9PC 3W15B 2IC9A 3QUJA 2LEHA 1BR1A 2NOXA 3CWZB 4E7ZA 2ODUA 2KINB 2YU1A 2EHOD 5F3JA 3ZN0B 5JR9C 3N2KE 4ISTA 3CQCB 2K24A 5JDHA 3AA6B 2CXFA 4IGUA 4AKIA 3TKLB 3ZMVB 1LVKA 3EDVA 3IBPA 1QSDA 4GYRA 3HKCE 5GONE 5DJQC 4ILUA 5HXSA 2CM0A 4IE4A 4AKGA 3RRCA 1V9DA 5JRCB 2LE8A 3CX8B 4IE6A 4CZZB 2LHNA 3R84B 2D5UA 5CA1E 3AA1B 1HG2A 4I50E 1G8XA 5CA0E 2A72A 3PUGA 4MALA 2JQQA 4IE0A 1WRDA 3N2GE 3LK42 2C5KT 5JR9B 5LYJE 3C51A 3D0TA 2VKJA 2E9XA 5JDFA 3AVSA 2CXDA 3UTKA 3SOLA 3ZMZB 4UXNB 1VOMA 2X51A 3J9X1 4KP3C 4AQFC 3AAAB 2W62A 2X68A 2XAHB 1U5PA 4UVCB 5JVDE 3RC8A 3MJXA 3LFMA 1KK7A 1X79A 5H6QB 1WYCA 4OK0A 3NZPA 4AKLA 3V5UA 2HPJA 2CXLA 4L5GA 4ZOLE 2I59A 2C5JA 2IC6A 2CWOA 2W00A 4PNIA 3RYIE 2V7LA 2CWYA 5FY7A 2RA1A 2NTXA 3KBUA 4C90A 5FMNA 2VB6A 3GN5A 3ZYKA 5FXWA 2M67A 2X9HA 2YK0A 2C5IT 3K3NA 3QC9A 3BQLA 2V7MA 2XAQB 2VL8A 4TX5A 4KBMB 3I0QA 1HTJF 5TAOA 3HR0A 3PE0A 4M1PA 4N78D 4ZHQE 3BQKA 5LNKA 1IAPA 4BAYB 4ZI2C 2ZM2A 2XASB 3MK7C 4JEHB 2EHOC 3PU8A 4CI2B 5KX5E 3VKHA 1Z0PA 2X9XA 3LG7A 3AVRA 2JJ9A 4DBRA 3KV5A 3OBVE 3RPUA 5LJMA 3U3IA 3AA7B 1MNEA 2X66A 3AAIA 2W63A 3H37A 3O1HA 2OA5A 4OYJA 5FXXA 4TV9E 1O3XA 2H7VC 3CX6B 5JQGE 4UV8B 3KVAA 3GWHA 5LHGB 3C50A 4DNDA 4EYUA 4PAGA 3Q2MA 2J1DG 2HPLA 3A5XA 3K3QC 4IE5A 4O4HE 2XQYA 2LSKA 3IF8B 3KV4A 4KMCA 3S4UA 2PG8A 1US7B 4J2CA 1S94A 2N1GA 3FBLA 5HXCA 1MIYA 2EHOB 3JC6D 1SA0E 5CB4E 5JH7E 3N5LA 3LBXA 4XAXB 5EK2A 2DNXA 4O4JE 2V7IA 4CXXA 4L9IA 4H9NC 4HN9A 4DMVA 2BZBA 1SHZC 2XUEA 2D0UA 4MHCA 5LOVE 2MBGA 4UV9B 3RYFE 2VKOA 2BDEA 4GK5E 3VKGA 5DQWA 2Z6EA 3PDYA 2LOPA 1FEWA 4IDZA 3ETVA 4ZI2D 2NW8A 3CQXC 3P8CD 4AQGA 2KWIB 5LP6E 1S35A 3UFEA 4ADZA 3N9LA 3UULA 4NUUA 1IJ5A 5DQVA 1FMVA 2WMNA 2ZM0A 2LOSA 5LBMA 3QK6A 3OJAA 4CXYA 2L9QA 4IIJE 4KUMB 2KXPB 3C98B 2WAUA 2B1EA 3WAKA 3Q9DA 4H63V 3IHRA 2Y6XA 1WR6A 2G0UA 3KBTA 3LK3B 3MZKB 3B57A 3BK9A 2DLRA 3GMIA 3KV9A 2LM9A 4BA9A 2K9AA 3E08A 3PU3A 2IAKA 2V7KA 3ZMSB 2DWGA 2MTQA 5FY1A 2IW5B 2VKDA 4HKAA 4YJ2E 4AXPA 1D0ZA 3KFWX 4X1IE 5L3GB 5LA6E 2PBIA 4OYKA 2XAFB 3L09A 5KDMC 2RP4A 3PTRB 3IEEA 2SPCA 2NW9A 2H3RA 5L3EB 4PFPA 3SRZA 3NRYA 4WW0A 1IZNB 4PK6A 5AFUL 1WLXA 4YHJA 2V26A 5F8PA 1HX8A 2X9WA 2V7JA 4PJNA 4TUYE 4O2BE 4AKHA 2E9XD 2P9BA 4UF0A 2Q9QA 4ZI3C 5JDMA 4PFOA 3CKDA 5L3BB 2LSYA 4UVBB 3ZJ2A 5LBQB 3HI2A 1ZV4X 3GN5B 2BVMA 3ZYMA 3F57A 3MA9A 3MKDA 4QXCB 4JLEA 2JRKA 4P09A 1MIWA 5JRCA 2KNDA 4O2AE 5HWXA 2Q9QD 1MMGA 2MYSA 3JC6C 2C0SA 2NP9A 3AAEB 3K8PC 4UELA 3CVRA 4CI3B 3LK2B 4ZS3A 2WWUA 4FI5A 2ZLYA 3FB2A 2WSSV 5HWYA 2WMOA 3CX7B 5ETWA 2LSGA 3N9MA 3WAJA 2HH7A 4QXBB 5FYMA 4FJOA 1D1AA 2V1DB 3UUNA 4DO0A 4F6RC 3FXEB 3KINB 5LGNB 4ERRA 3PUAA 4EIWA 5ADXL 5LGUB 5LHHB 5JREA 1UCUA 2LSIA 3BQIA 5HYAA 2CLYC 3UUMA 4H9OC 3ZMTB 5DABA 3AB3B 4UIGA 5JDLA 4DMWA 3C4ZA 4MFRA 2NW7A 2XAJB 4K0UA 2VASA 3MACA 3FXDB 5EK3A 3ANWA 3NZQA 2CE7A 4ASKA 2VKHA 4ZI3D 2LHRA 3LBXB 3EDUA 4HTEA 3H3AA 1B7TA 3ZC1A 5BMVE 2NTYA 4O8SA 1ZHCA 1OXZA 4H9QC 4IHJE 4X20E 3ZPOA 2ODVA 2X9YA 3M65A 2WM9A 1LKXA 2CLYB 4ZS2A 3KDSE 3ZEFB 5LG4A 1YKEB 4CQIA 5LGTB 4HE8A 2Y48B 2KWHA 4TV8E 2DI4A 3CQGB 1D1BA 1MMNA 5C8YE 3ETUA 5EK4A 3EUHA 1HS7A 2E9XC 4GYSA 4YJ3E 3NBXX 1MIVA 2XTLA 1VRBA 1HG5A 2XAGB 4G63A 5J1GA 4A56A 3ZN1B 3RRWA 4EZHA 4PK5A 4AI6A 3OKQA 3NRXA 4CI1B 1AJ3A 3CPZA 3F31A 4NUVA 3O9XA 3RYCE 3ZCJA 5JDGA 5LXTE 3PURA 1KNZA 4V1Av 5LJNA 1HFAA 1E1HB 3KV6A 2Q9QC 1MMAA 3HKEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L2L A;  3ZJ1 A;  2LHN A;  3ZJ2 A; 
#chains in the Genus database with same CATH topology
 4PJL A;  5J0Z A;  3SS1 A;  3MXZ A;  4I43 B;  2PJQ A;  4PJM A;  2X67 A;  3C4X A;  4PW8 A;  3NKZ A;  1T98 A;  2QGS A;  4QX7 B;  3Q5E A;  1UK5 A;  2XY8 B;  2D2S A;  4I55 E;  1N36 T;  3LSV A;  3TLU A;  5LB7 B;  4BJM A;  2W4X A;  5FXZ A;  3I9Y A;  2J47 A;  1KEY A;  3UT5 E;  2YDQ A;  2M6I A;  3K1S A;  4WBN E;  5FVK A;  1YKH B;  1HNZ T;  2QYW A;  1UX5 A;  5AQP B;  4HFV A;  2IHR 1;  5IWA T;  4G2A A;  2KZ7 B;  2JMH A;  3AE4 A;  1YW0 A;  2WWV A;  4GK0 E;  5FY0 A;  3ONX A;  3ZCI A;  3RX6 A;  4CN4 A;  3RKO A;  4P0A A;  2CCQ A;  5AQL B;  3RF1 A;  4YSX A;  5AQM B;  4U33 A;  5L2L A;  4PK4 A;  5FNV E;  3UQ4 A;  2K5B B;  4U74 A;  4DV7 T;  1N34 T;  4I4T E;  2JPF A;  2GK9 A;  3P7I A;  3TLV A;  2X0H A;  1ZEE A;  3VR8 A;  1UX4 A;  5JTG A;  3PUY F;  3HL6 A;  2Y8D A;  2XQA A;  2X0Y A;  2YKS A;  2V6Y A;  1MMD A;  4YHH T;  3HKB E;  4XZC A;  1SE7 A;  2DWK A;  1JNR A;  1BR0 A;  4GIW A;  2X0L B;  4DUZ T;  3JAD A;  5AQS B;  5JDN A;  3FZF B;  4B6X A;  2W0G A;  2LM2 A;  3A7M A;  1E7P A;  2E2A A;  1BR4 A;  5H6R B;  4LF8 T;  4PJJ A;  4JUY A;  2KSR A;  3K3O A;  1FMW A;  4EXT A;  2LT3 A;  2OLT A;  4UVA B;  4H9P C;  3W15 B;  2IC9 A;  3QUJ A;  2LEH A;  1BR1 A;  5AQK B;  4IST A;  1L0V A;  3TKL B;  4A97 A;  3AEE A;  5AQI B;  2LLY A;  4TWH A;  2VUR A;  3PUZ F;  3RRC A;  4I50 E;  2WZH A;  4TNV A;  2JQQ A;  4EV6 A;  1HR0 T;  5JDF A;  3UTK A;  3SOL A;  3ZMZ B;  4UXN B;  1U5P A;  4P1N A;  2IIU A;  2UXB T;  4IL4 A;  2BG9 E;  3NZP A;  4L5G A;  2I59 A;  2C5J A;  2IC6 A;  1IBL T;  4PNI A;  1YQ4 A;  2NTX A;  4C90 A;  2QRX A;  2JIW A;  2X9H A;  2YK0 A;  2C5I T;  2XAQ B;  4KBM B;  4JI1 T;  3I0Q A;  1HTJ F;  5LMU T;  5TAO A;  5HEG A;  3FZH B;  2XAS B;  3MK7 C;  4YTP A;  3PU8 A;  4DV4 T;  2JJ9 A;  4DBR A;  3OBV E;  5LJM A;  3AA7 B;  3AAI A;  1T7S A;  2W63 A;  1KF6 A;  5FXX A;  4TWD A;  5JQG E;  3CX6 B;  4DR1 T;  4PAG A;  2HPL A;  3A5X A;  2W2U A;  3KV4 A;  3IF8 B;  2WP9 A;  2N1G A;  5C2T A;  4XAX B;  2DNX A;  2XZE A;  4YT0 A;  4CXX A;  4L9I A;  4UV9 B;  3VKG A;  2LOP A;  2WY2 A;  3ETV A;  1KNP A;  2NW8 A;  3CQX C;  3P8C D;  4DR7 T;  3UUL A;  2WMN A;  3ONJ A;  2ZM0 A;  2LOS A;  3QK6 A;  4CXY A;  4A5X A;  3WAK A;  3IHR A;  2Y6X A;  3KBT A;  2BKP A;  3LK3 B;  3KV9 A;  3AE8 A;  4U31 A;  4OX9 T;  3VR9 A;  3JAE A;  4ILB A;  5KDM C;  1HNX T;  4PFP A;  3SRZ A;  1IZN B;  4PK6 A;  2V6X A;  2V7J A;  4KHZ F;  4O2B E;  2E9X D;  4DV3 T;  4IDO A;  3CKD A;  5L3B B;  5LBQ B;  1ZV4 X;  3AED A;  1J5E T;  2Q9Q D;  2MYS A;  3A8Y C;  4YSY A;  4ZS3 A;  2WWU A;  3AEC A;  3QB5 K;  1W0B A;  5FYM A;  4FJO A;  4HFD A;  2V1D B;  3UUN A;  4F6R C;  3OVU A;  3PUA A;  5LHH B;  5LGU B;  5JRE A;  2FUP A;  4DR2 T;  4CN1 A;  4H9O C;  3ZMT B;  4YTM A;  4UIG A;  4K0U A;  3ONL C;  5FVL A;  5HCJ A;  5EK3 A;  3T1Y T;  4UR9 A;  5BMV E;  4H9Q C;  1E2A A;  3AE1 A;  3RIF A;  2XQ7 A;  4ZS2 A;  1YKE B;  1XNQ T;  4HFI A;  5C8Y E;  3EUH A;  4YJ3 E;  1NEN A;  2BS3 A;  1HG5 A;  4AI6 A;  3F31 A;  4NUV A;  3PUR A;  1KNZ A;  1HFA A;  3KV6 A;  1MMA A;  2RPA A;  3ZMU B;  5C3J A;  1KNR A;  5FP3 A;  3UUB A;  4LMJ A;  3PJA J;  3PUS A;  4GOU A;  4YFS A;  5FXV A;  4X62 T;  1G73 A;  2FJD A;  3RI5 A;  1J5W A;  2JMK A;  4QH4 A;  3L3P A;  3ZST A;  2YU2 A;  3PJA A;  1NAF A;  4H9S E;  5AQV B;  1HF8 A;  3R6N A;  5IHY A;  4TN7 B;  5HEJ A;  2ACX A;  2FBW A;  3AE6 A;  4OHF A;  3AA0 B;  3N9Q A;  4ZI7 E;  4E7S A;  4IE7 A;  4WBO A;  3DP7 A;  1OED C;  4DV0 T;  4IDQ A;  4OFZ A;  2HHH T;  3NVO A;  2CEA A;  1MND A;  2MOZ A;  4UEM A;  5HAX A;  3FZK B;  2A2F X;  2KT9 A;  2ES0 A;  5IYZ E;  1R8I A;  2WBL A;  4EOZ B;  3C4W A;  4AQF A;  4DUY T;  1OED B;  4DVD A;  2XJ7 A;  5EZY E;  5FL1 A;  2KMF A;  5ABF A;  1GQE A;  2JQH A;  5AQT B;  5LCY A;  1WCR A;  4Z8X A;  2K48 A;  4LF9 T;  4TWF A;  3PUQ A;  3Q5X A;  3C64 A;  1BR2 A;  1LVF A;  3NWI A;  3RYH E;  2YIN A;  3OPC A;  3AXJ A;  4AQY T;  1D1C A;  2KIN B;  5AQU B;  2EHO D;  3ZN0 B;  2K24 A;  5JDH A;  2UUB T;  2CXF A;  3ZMV B;  3EDV A;  3IBP A;  4GYR A;  5HEH A;  5GON E;  5DJQ C;  4HWC A;  4ILU A;  5HXS A;  3CX8 B;  4IE6 A;  4JI4 T;  2D5U A;  4DV2 T;  2HN1 A;  1HG2 A;  5CA0 E;  2A72 A;  3PUG A;  4MAL A;  2VQF T;  4I0U A;  3ZT7 A;  4IE0 A;  2C5K T;  5LYJ E;  2OV9 A;  3C51 A;  3D0T A;  2E9X A;  4COF A;  4IDN A;  3J9X 1;  4KP3 C;  4AQF C;  3AAA B;  4HWD A;  5JVD E;  3LFM A;  2BG9 A;  1N32 T;  1X79 A;  5H6Q B;  2XSB A;  4OK0 A;  3ZSS A;  2BBH A;  3RGL A;  1M7K A;  5FMN A;  3ZYK A;  3SFE A;  2M67 A;  4KX6 A;  3QC9 A;  5ABF B;  2VL8 A;  3PE0 A;  4N78 D;  5BR8 T;  1VCS A;  4JI3 T;  3VKH A;  2X9X A;  3LG7 A;  5FL0 A;  2X66 A;  3H37 A;  1O3X A;  2MPK A;  5CFB A;  3AE2 A;  2JQK A;  4EED A;  3S4U A;  1Z8U A;  4KMC A;  3PV0 F;  2VL0 A;  4NXN T;  5HXC A;  4CN6 A;  1SA0 E;  5ABH A;  5JH7 E;  3N5L A;  3LBX A;  5EK2 A;  4O4J E;  3UU5 A;  1SHZ C;  2XUE A;  2XSA A;  1I94 T;  2PTF A;  3CIR A;  3QB5 A;  5AQQ B;  2MBG A;  3RYF E;  5FKY A;  2BDE A;  5DQW A;  3PDY A;  1FEW A;  4ZI2 D;  4AQG A;  5LP6 E;  2YN6 A;  2BG9 C;  5DQV A;  2I6H A;  5AQJ B;  2L9Q A;  1NEK A;  2KXP B;  2B1E A;  4H63 V;  1WR6 A;  3BK9 A;  3ZT6 A;  4B3S T;  4B3M T;  3PU3 A;  2IAK A;  3PUX F;  4HKA A;  4AXP A;  1D0Z A;  4X1I E;  1CHU A;  2BG9 B;  4HWI B;  4OYK A;  2XAF B;  1UUR A;  2RP4 A;  2VQE T;  2WDR A;  5AFU L;  1WLX A;  2V26 A;  1HX8 A;  3EAM A;  4AKH A;  2P9B A;  1QLB A;  4PFO A;  2LSY A;  4UVB B;  2J4G A;  2XPK A;  3HI2 A;  4WZX A;  3MA9 A;  3MKD A;  2JRK A;  5JRC A;  1MIW A;  4O2A E;  1W9R A;  3TLW A;  5HWX A;  4JYA T;  3JC6 C;  2NP9 A;  2AXD S;  2BKO A;  3LK2 B;  3FB2 A;  2WMO A;  3CX7 B;  2LSG A;  2HH7 A;  4QXB B;  1D1A A;  2V6Y B;  3PUV F;  4DR5 T;  5LGN B;  4ERR A;  2I0M A;  4EIW A;  5ADX L;  3BQI A;  5DAB A;  5JDL A;  4MFR A;  2VAS A;  3FXD B;  3ANW A;  3NZQ A;  4YXD A;  1M62 A;  3LBX B;  3EDU A;  4U2Y A;  2NTY A;  4O8S A;  2J62 A;  2WDV A;  1LKX A;  3EI0 A;  4HE8 A;  4AIS A;  4TV8 E;  2DI4 A;  5L4E A;  2NR4 A;  2LKH A;  1HS7 A;  2XM1 A;  4GYS A;  1MIV A;  1VRB A;  2XAG B;  4G63 A;  3RRW A;  1XMQ T;  1JNZ A;  3NRX A;  4CI1 B;  5AQF B;  3AEA A;  3CPZ A;  5LXT E;  3LDQ B;  1SUM B;  4HEA A;  3I0O A;  4IRE A;  3ZKR A;  2ZM8 A;  3GA8 A;  4WNK A;  1IBM T;  2DHR A;  3HKD E;  3AE5 A;  5E0O A;  4LF7 T;  2N9D A;  5JDQ A;  5M4Y A;  1CUN A;  4X1Y E;  2YDS A;  4U3C A;  3T8O A;  3LJC A;  4TZ4 C;  3ZT5 A;  3ABV A;  1FIO A;  3P50 A;  3I1A A;  1ZKE A;  1H7C A;  2QA7 A;  2BBJ A;  4EAH A;  2V5D A;  4JEU B;  2W67 A;  3E0Z A;  3AEF A;  5KMG P;  2NWB A;  2BS4 A;  5L3C B;  2BS2 A;  3Q5W A;  3J7Y q;  2ZMA A;  2LSJ A;  3DTO A;  2L8K A;  2CHN A;  3ANW B;  2VK9 A;  1XMO T;  5KXJ A;  2QVA A;  4H9R C;  1FJG T;  2XQ8 A;  3DJB A;  4X64 T;  2IML A;  2UXX B;  3N9P A;  5HCM A;  3P4R A;  4QWN B;  1NWM X;  1HCI A;  2D0T A;  2CBI A;  5ABE A;  2UU9 T;  4MBQ A;  5A1L A;  3RKG A;  1D0Y A;  3N2O A;  3O1J A;  2E8I A;  2WB5 A;  4U72 A;  1Y64 B;  4U2Z A;  1D0X A;  4ANJ A;  2YDR A;  4QXH B;  1LRZ A;  3EAB A;  4O4I E;  3T1H T;  1ZP0 A;  3OYX A;  4JI7 T;  4QKN A;  1WYB A;  2MAW A;  3OYZ A;  3ESL A;  1XZY A;  2AE9 A;  2L3L A;  4C91 A;  3I9W A;  2XHE B;  5HEU A;  4LF5 T;  3RIU A;  2NOX A;  3CWZ B;  4DR6 T;  2ODU A;  3AA6 B;  1X9B A;  1LVK A;  1QSD A;  3P4W A;  1IBK T;  4AKG A;  1V9D A;  3FZL B;  1HNW T;  2JQ9 A;  2UXC T;  3AA1 B;  1G8X A;  5LMN T;  2H88 A;  3LK4 2;  2VKJ A;  1VOM A;  2X51 A;  2W62 A;  2X68 A;  2XAH B;  4UVC B;  3MJX A;  4DR3 T;  1KK7 A;  2WS3 A;  3H3M A;  3RIA A;  3V5U A;  2HPJ A;  2CXL A;  2DL1 A;  2LRK A;  4DID B;  2VB6 A;  2XQ3 A;  5FXW A;  4YY3 T;  3K3N A;  1YQ3 A;  3BQL A;  3RHW A;  2V7M A;  2D9D A;  5AQH B;  4DR4 T;  4ZHQ E;  4EGW A;  4BAY B;  1N33 T;  4ZI2 C;  2WZI A;  3SFD A;  5KX5 E;  1Z0P A;  3AVR A;  3VRB A;  4LML A;  4U7Y A;  4LMK A;  3RPU A;  2FJE A;  2OA5 A;  4TV9 E;  4UV8 B;  3KVA A;  2R6G F;  4DND A;  4GKJ T;  3Q2M A;  1KFY A;  3EHZ A;  5HEO A;  4IE5 A;  4O4H E;  2LSK A;  2PG8 A;  4JI2 T;  1S94 A;  3FBL A;  1MIY A;  4Z91 A;  4HN9 A;  1OED E;  3JAF A;  5LG3 A;  2WDQ A;  4GK5 E;  4LFC T;  2Z6E A;  4IDZ A;  3N9L A;  5CJ5 A;  4NUU A;  4HWH A;  3OJA A;  2XQ9 A;  4KUM B;  2WAU A;  3C98 B;  3OTO T;  3AEB A;  3Q9D A;  2G0U A;  3MZK B;  5AQR B;  1Y01 A;  3GMI A;  2LM9 A;  1UGO A;  3E08 A;  3ZMS B;  2DWG A;  2MTQ A;  4YJ2 E;  3IA3 A;  4B3R T;  5L3G B;  2PBI A;  3G06 A;  2SPC A;  1UUS A;  2H3R A;  4DV1 T;  5F8P A;  2X9W A;  4PJN A;  4TUY E;  4UF0 A;  3P4P A;  2Q9Q A;  1DU2 A;  3ZJ2 A;  2BVM A;  3ZYM A;  3AE3 A;  4JLE A;  2KND A;  2V5C A;  3K8P C;  4UEL A;  4FI5 A;  4YTN A;  2ZLY A;  3N9M A;  3WAJ A;  3KIN B;  1UCU A;  2BKN A;  5HYA A;  2CLY C;  3UFG A;  3UUM A;  3AB3 B;  4DMW A;  3C4Z A;  2XAJ B;  2UXD T;  4DV5 T;  2CPT A;  4ASK A;  4ZI3 D;  2LHR A;  3AE9 A;  3H3A A;  1B7T A;  3ZC1 A;  2W66 A;  2FJB A;  2XQ5 A;  4X20 E;  3AXJ B;  2ODV A;  4Z90 A;  3M65 A;  2CLY B;  3ZEF B;  5LG4 A;  5LGT B;  2Y48 B;  2KWH A;  3CQG B;  1MMN A;  2CBJ A;  4KHP T;  2XM2 A;  3ETU A;  4HFC A;  2E9X C;  3NBX X;  3FZM B;  1WR0 A;  2XTL A;  3UU8 A;  3ZN1 B;  4EZH A;  1XDP A;  3O9X A;  3RYC E;  1T72 A;  5LJN A;  4WYV A;  1E1H B;  2Q9Q C;  4LFB T;  3HKE E;  4HFH A;  2W61 A;  3SWH A;  4HGA A;  2PFV A;  4CXW A;  4LFA T;  1QUU A;  3B13 A;  2CA5 A;  3O1I A;  2E9X B;  3ZLI A;  5L3F B;  2UUC T;  3P4S A;  3O4X E;  4HWF A;  5J2U E;  3CML A;  5HXR A;  3RH3 A;  3L8R A;  4H63 H;  2VWA A;  4NXM T;  4UF0 B;  2Q9Q B;  3ZC0 A;  5HXH A;  4EB6 E;  2DCF A;  4QX8 B;  4LF6 T;  4ZZB A;  4QHO A;  2M6B A;  4MLK A;  3FHN A;  2YEV C;  3UQ7 A;  2LJL A;  1VCT A;  1XNR T;  4X5T A;  2A3D A;  3EVY A;  2ZM6 T;  4X1K E;  4AKR B;  4O4L E;  4HFE A;  5L3D B;  4EYY R;  3RC3 A;  4ISS A;  3KVB A;  5JR9 A;  5J2T E;  3HA4 A;  2N2N A;  4QH5 A;  1IJ6 A;  2CMR A;  1HX1 B;  3VU7 H;  3UUX B;  1YD8 G;  3WI3 A;  3ZYL A;  2KLQ A;  5LHI B;  4DBQ A;  5AQO B;  4K0K T;  1EZ3 A;  3E22 E;  3JCF A;  4ZXL A;  2H7O A;  2IUB A;  1I6Z A;  3F2E A;  4NPP A;  3V5S A;  4XBF B;  4HFB A;  1U4Q A;  5HXE A;  4JI5 T;  2BVL A;  1OWA A;  2E5L T;  5CGM A;  3X1D A;  5L47 A;  4L0R A;  3FBZ A;  3N9N A;  3U78 A;  3RLF F;  4YLH A;  2E5V A;  2LRL A;  3VHL A;  4P0B A;  2EHO A;  2UXN B;  4BJN A;  4EZ4 A;  3N9O A;  4E7Z A;  4ILA A;  2YU1 A;  3UU4 A;  5F3J A;  5JR9 C;  3N2K E;  3CQC B;  4IGU A;  4AKI A;  3HKC E;  5ABG A;  4Q25 A;  2CM0 A;  4IE4 A;  5JRC B;  2LE8 A;  4CZZ B;  2LHN A;  3R84 B;  5CA1 E;  1WRD A;  3N2G E;  4AIU A;  5JR9 B;  3AVS A;  2CXD A;  2CHO A;  1XWM A;  4JI0 T;  1W09 A;  3RC8 A;  4IDP A;  4ILC A;  4GKK T;  4ZZC A;  3AEG A;  1WYC A;  4AKL A;  4ZOL E;  3RQU A;  2CWO A;  2W00 A;  3RYI E;  2VVS A;  2V7L A;  2CWY A;  5FY7 A;  3UU6 A;  2RA1 A;  4JV5 T;  3KBU A;  4ZEY A;  2WU2 A;  2A9U A;  3GN5 A;  5AQN B;  1WFD A;  2LKG A;  3VRA A;  2XQ6 A;  4TX5 A;  4LF4 T;  3HR0 A;  4M1P A;  3BQK A;  5LNK A;  1IAP A;  3PUW F;  2ZM2 A;  4A98 A;  4JEH B;  2EHO C;  4CI2 B;  3QNU A;  5IUX A;  2F4V T;  3UU3 A;  3KV5 A;  4F8H A;  2XQ4 A;  3U3I A;  1MNE A;  3O1H A;  4OYJ A;  2H7V C;  3GWH A;  5LHG B;  1XDO A;  3C50 A;  4EYU A;  2HN2 A;  2J1D G;  3ZJ1 A;  3K3Q C;  2XQY A;  4TNW A;  1W0A A;  1US7 B;  4J2C A;  2EHO B;  3JC6 D;  1YXR A;  5CB4 E;  2V7I A;  1OED A;  4H9N C;  4DMV A;  2BZB A;  2D0U A;  2H89 A;  4MHC A;  5LOV E;  2VKO A;  5AQG B;  2KWI B;  1S35 A;  3UFE A;  4ADZ A;  1IJ5 A;  1FMV A;  5LBM A;  4IIJ E;  3L39 A;  4EEB A;  4DV6 T;  3TLT A;  3QOF A;  3B57 A;  2WCA A;  2DLR A;  4BA9 A;  2K9A A;  2V7K A;  5FY1 A;  2IW5 B;  5F5W A;  2VKD A;  4B3T T;  3KFW X;  4X65 T;  4JI6 T;  5LA6 E;  3L09 A;  3PTR B;  3IEE A;  2NW9 A;  5L3E B;  2WQY A;  3NRY A;  4WW0 A;  3RQW A;  3P4Q A;  4YHJ A;  4JI8 T;  2FJA A;  4X66 T;  4ZI3 C;  5JDM A;  3M3Z B;  3GN5 B;  3F57 A;  4QXC B;  4P09 A;  1MMG A;  2C0S A;  3AAE B;  2UUA T;  2CRB A;  3CVR A;  4CI3 B;  2B76 A;  4NIQ A;  3Q5D A;  2WSS V;  3AE7 A;  5HWY A;  5ETW A;  2V8S V;  2VVN A;  4DO0 A;  3FXE B;  3TLS A;  4IT4 A;  3B5M A;  2LSI A;  3CK6 A;  1ZOY A;  2WU5 A;  3RIU C;  2NW7 A;  3MAC A;  2CE7 A;  2VKH A;  4HTE A;  1J1J A;  2YOE A;  1ZHC A;  1OXZ A;  4IHJ E;  3ZPO A;  4U7I A;  2X9Y A;  2WM9 A;  3KDS E;  4CQI A;  2ACZ A;  1D1B A;  4IL9 A;  5EK4 A;  1T8B A;  2IDO B;  4QH1 A;  5J1G A;  4A56 A;  4PK5 A;  3OKQ A;  4JBW F;  1AJ3 A;  3ZCJ A;  5JDG A;  4YSZ A;  4V1A v;  4KI0 F;  2K3W A;  5L4H A; 
#chains in the Genus database with same CATH homology
 4PJL A;  4HEA A;  3ZMU B;  2W61 A;  3I0O A;  5FP3 A;  3SWH A;  3SS1 A;  4HGA A;  2PFV A;  3MXZ A;  4CXW A;  2ZM8 A;  1QUU A;  3B13 A;  3GA8 A;  4I43 B;  2CA5 A;  3O1I A;  4WNK A;  2E9X B;  3ZLI A;  5L3F B;  2DHR A;  3O4X E;  2PJQ A;  5J2U E;  3HKD E;  4PJM A;  3CML A;  2X67 A;  3C4X A;  4PW8 A;  5E0O A;  5HXR A;  2N9D A;  3RH3 A;  5JDQ A;  4H63 H;  1T98 A;  2QGS A;  2VWA A;  4QX7 B;  4UF0 B;  5M4Y A;  2Q9Q B;  1CUN A;  3PUS A;  4X1Y E;  4GOU A;  3T8O A;  4YFS A;  3LJC A;  5FXV A;  5HXH A;  3ZC0 A;  4TZ4 C;  4EB6 E;  2DCF A;  1G73 A;  2D2S A;  4I55 E;  4QX8 B;  1FIO A;  2JMK A;  3I1A A;  4QHO A;  3L3P A;  2YU2 A;  4BJM A;  1ZKE A;  1H7C A;  2QA7 A;  4MLK A;  3FHN A;  1NAF A;  2YEV C;  2LJL A;  3I9Y A;  5FXZ A;  4EAH A;  3UT5 E;  4H9S E;  4WBN E;  1HF8 A;  2A3D A;  4JEU B;  3R6N A;  3EVY A;  1YKH B;  5IHY A;  1UX5 A;  4TN7 B;  4X1K E;  3E0Z A;  4AKR B;  4O4L E;  5KMG P;  2NWB A;  4HFV A;  5L3D B;  4EYY R;  2ACX A;  3RC3 A;  4G2A A;  4OHF A;  5L3C B;  2KZ7 B;  2JMH A;  4ISS A;  3KVB A;  5JR9 A;  1YW0 A;  3AA0 B;  3N9Q A;  5J2T E;  3HA4 A;  4ZI7 E;  4GK0 E;  5FY0 A;  4E7S A;  3ONX A;  3ZCI A;  3Q5W A;  4IE7 A;  3RX6 A;  3J7Y q;  4WBO A;  2N2N A;  1IJ6 A;  2CMR A;  2ZMA A;  3RKO A;  4P0A A;  2CCQ A;  3VU7 H;  3DP7 A;  2LSJ A;  3UUX B;  1YD8 G;  3DTO A;  4OFZ A;  2L8K A;  3ANW B;  2VK9 A;  5L2L A;  4PK4 A;  2CEA A;  5FNV E;  1MND A;  2K5B B;  4H9R C;  3WI3 A;  2KLQ A;  3ZYL A;  4U74 A;  2MOZ A;  4I4T E;  4UEM A;  5HAX A;  2JPF A;  3DJB A;  2GK9 A;  2A2F X;  3P7I A;  2KT9 A;  5LHI B;  2UXX B;  3N9P A;  2ES0 A;  4DBQ A;  5IYZ E;  2WBL A;  1ZEE A;  4QWN B;  1NWM X;  3C4W A;  4EOZ B;  1HCI A;  2D0T A;  4AQF A;  1EZ3 A;  4DVD A;  1UX4 A;  3E22 E;  3HL6 A;  3ZJ1 A;  2Y8D A;  5EZY E;  2KMF A;  4MBQ A;  5A1L A;  1D0Y A;  3N2O A;  3O1J A;  2H7O A;  1MMD A;  5LCY A;  3HKB E;  3F2E A;  3V5S A;  2E8I A;  4XZC A;  4Z8X A;  4XBF B;  2DWK A;  4U72 A;  2K48 A;  1BR0 A;  4GIW A;  1Y64 B;  2X0L B;  1D0X A;  1U4Q A;  5HXE A;  4ANJ A;  5JDN A;  4QXH B;  4B6X A;  1LRZ A;  2W0G A;  3PUQ A;  2BVL A;  1OWA A;  3Q5X A;  3C64 A;  4O4I E;  4L0R A;  3FBZ A;  1BR4 A;  3N9N A;  1BR2 A;  1LVF A;  3U78 A;  5H6R B;  3OYX A;  4PJJ A;  4YLH A;  4QKN A;  1WYB A;  4JUY A;  3RYH E;  3K3O A;  3OYZ A;  3ESL A;  1FMW A;  3VHL A;  4EXT A;  2YIN A;  2LT3 A;  2L3L A;  4P0B A;  4C91 A;  2EHO A;  1D1C A;  2UXN B;  3I9W A;  2XHE B;  4UVA B;  3N9O A;  4BJN A;  4EZ4 A;  4H9P C;  3W15 B;  2IC9 A;  3QUJ A;  2LEH A;  1BR1 A;  2NOX A;  3CWZ B;  4E7Z A;  2ODU A;  2KIN B;  2YU1 A;  2EHO D;  5F3J A;  3ZN0 B;  5JR9 C;  3N2K E;  4IST A;  3CQC B;  2K24 A;  5JDH A;  3AA6 B;  2CXF A;  4IGU A;  4AKI A;  3TKL B;  3ZMV B;  1LVK A;  3EDV A;  3IBP A;  1QSD A;  4GYR A;  3HKC E;  5GON E;  5DJQ C;  4ILU A;  5HXS A;  2CM0 A;  4IE4 A;  4AKG A;  3RRC A;  1V9D A;  5JRC B;  2LE8 A;  3CX8 B;  4IE6 A;  4CZZ B;  2LHN A;  3R84 B;  2D5U A;  5CA1 E;  3AA1 B;  1HG2 A;  4I50 E;  1G8X A;  5CA0 E;  2A72 A;  3PUG A;  4MAL A;  2JQQ A;  4IE0 A;  1WRD A;  3N2G E;  3LK4 2;  2C5K T;  5JR9 B;  5LYJ E;  3C51 A;  3D0T A;  2VKJ A;  2E9X A;  5JDF A;  3AVS A;  2CXD A;  3UTK A;  3SOL A;  3ZMZ B;  4UXN B;  1VOM A;  2X51 A;  3J9X 1;  4KP3 C;  4AQF C;  3AAA B;  2W62 A;  2X68 A;  2XAH B;  1U5P A;  4UVC B;  5JVD E;  3RC8 A;  3MJX A;  3LFM A;  1KK7 A;  1X79 A;  5H6Q B;  1WYC A;  4OK0 A;  3NZP A;  4AKL A;  3V5U A;  2HPJ A;  2CXL A;  4L5G A;  4ZOL E;  2I59 A;  2C5J A;  2IC6 A;  2CWO A;  2W00 A;  4PNI A;  3RYI E;  2V7L A;  2CWY A;  5FY7 A;  2RA1 A;  2NTX A;  3KBU A;  4C90 A;  5FMN A;  2VB6 A;  3GN5 A;  3ZYK A;  5FXW A;  2M67 A;  2X9H A;  2YK0 A;  2C5I T;  3K3N A;  3QC9 A;  3BQL A;  2V7M A;  2XAQ B;  2VL8 A;  4TX5 A;  4KBM B;  3I0Q A;  1HTJ F;  5TAO A;  3HR0 A;  3PE0 A;  4M1P A;  4N78 D;  4ZHQ E;  3BQK A;  5LNK A;  1IAP A;  4BAY B;  4ZI2 C;  2ZM2 A;  2XAS B;  3MK7 C;  4JEH B;  2EHO C;  3PU8 A;  4CI2 B;  5KX5 E;  3VKH A;  1Z0P A;  2X9X A;  3LG7 A;  3AVR A;  2JJ9 A;  4DBR A;  3KV5 A;  3OBV E;  3RPU A;  5LJM A;  3U3I A;  3AA7 B;  1MNE A;  2X66 A;  3AAI A;  2W63 A;  3H37 A;  3O1H A;  2OA5 A;  4OYJ A;  5FXX A;  4TV9 E;  1O3X A;  2H7V C;  3CX6 B;  5JQG E;  4UV8 B;  3KVA A;  3GWH A;  5LHG B;  3C50 A;  4DND A;  4EYU A;  4PAG A;  3Q2M A;  2J1D G;  2HPL A;  3A5X A;  3K3Q C;  4IE5 A;  4O4H E;  2XQY A;  2LSK A;  3IF8 B;  3KV4 A;  4KMC A;  3S4U A;  2PG8 A;  1US7 B;  4J2C A;  1S94 A;  2N1G A;  3FBL A;  5HXC A;  1MIY A;  2EHO B;  3JC6 D;  1SA0 E;  5CB4 E;  5JH7 E;  3N5L A;  3LBX A;  4XAX B;  5EK2 A;  2DNX A;  4O4J E;  2V7I A;  4CXX A;  4L9I A;  4H9N C;  4HN9 A;  4DMV A;  2BZB A;  1SHZ C;  2XUE A;  2D0U A;  4MHC A;  5LOV E;  2MBG A;  4UV9 B;  3RYF E;  2VKO A;  2BDE A;  4GK5 E;  3VKG A;  5DQW A;  2Z6E A;  3PDY A;  2LOP A;  1FEW A;  4IDZ A;  3ETV A;  4ZI2 D;  2NW8 A;  3CQX C;  3P8C D;  4AQG A;  2KWI B;  5LP6 E;  1S35 A;  3UFE A;  4ADZ A;  3N9L A;  3UUL A;  4NUU A;  1IJ5 A;  5DQV A;  1FMV A;  2WMN A;  2ZM0 A;  2LOS A;  5LBM A;  3QK6 A;  3OJA A;  4CXY A;  2L9Q A;  4IIJ E;  4KUM B;  2KXP B;  3C98 B;  2WAU A;  2B1E A;  3WAK A;  3Q9D A;  4H63 V;  3IHR A;  2Y6X A;  1WR6 A;  2G0U A;  3KBT A;  3LK3 B;  3MZK B;  3B57 A;  3BK9 A;  2DLR A;  3GMI A;  3KV9 A;  2LM9 A;  4BA9 A;  2K9A A;  3E08 A;  3PU3 A;  2IAK A;  2V7K A;  3ZMS B;  2DWG A;  2MTQ A;  5FY1 A;  2IW5 B;  2VKD A;  4HKA A;  4YJ2 E;  4AXP A;  1D0Z A;  3KFW X;  4X1I E;  5L3G B;  5LA6 E;  2PBI A;  4OYK A;  2XAF B;  3L09 A;  5KDM C;  2RP4 A;  3PTR B;  3IEE A;  2SPC A;  2NW9 A;  2H3R A;  5L3E B;  4PFP A;  3SRZ A;  3NRY A;  4WW0 A;  1IZN B;  4PK6 A;  5AFU L;  1WLX A;  4YHJ A;  2V26 A;  5F8P A;  1HX8 A;  2X9W A;  2V7J A;  4PJN A;  4TUY E;  4O2B E;  4AKH A;  2E9X D;  2P9B A;  4UF0 A;  2Q9Q A;  4ZI3 C;  5JDM A;  4PFO A;  3CKD A;  5L3B B;  2LSY A;  4UVB B;  3ZJ2 A;  5LBQ B;  3HI2 A;  1ZV4 X;  3GN5 B;  2BVM A;  3ZYM A;  3F57 A;  3MA9 A;  3MKD A;  4QXC B;  4JLE A;  2JRK A;  4P09 A;  1MIW A;  5JRC A;  2KND A;  4O2A E;  5HWX A;  2Q9Q D;  1MMG A;  2MYS A;  3JC6 C;  2C0S A;  2NP9 A;  3AAE B;  3K8P C;  4UEL A;  3CVR A;  4CI3 B;  3LK2 B;  4ZS3 A;  2WWU A;  4FI5 A;  2ZLY A;  3FB2 A;  2WSS V;  5HWY A;  2WMO A;  3CX7 B;  5ETW A;  2LSG A;  3N9M A;  3WAJ A;  2HH7 A;  4QXB B;  5FYM A;  4FJO A;  1D1A A;  2V1D B;  3UUN A;  4DO0 A;  4F6R C;  3FXE B;  3KIN B;  5LGN B;  4ERR A;  3PUA A;  4EIW A;  5ADX L;  5LGU B;  5LHH B;  5JRE A;  1UCU A;  2LSI A;  3BQI A;  5HYA A;  2CLY C;  3UUM A;  4H9O C;  3ZMT B;  5DAB A;  3AB3 B;  4UIG A;  5JDL A;  4DMW A;  3C4Z A;  4MFR A;  2NW7 A;  2XAJ B;  4K0U A;  2VAS A;  3MAC A;  3FXD B;  5EK3 A;  3ANW A;  3NZQ A;  2CE7 A;  4ASK A;  2VKH A;  4ZI3 D;  2LHR A;  3LBX B;  3EDU A;  4HTE A;  3H3A A;  1B7T A;  3ZC1 A;  5BMV E;  2NTY A;  4O8S A;  1ZHC A;  1OXZ A;  4H9Q C;  4IHJ E;  4X20 E;  3ZPO A;  2ODV A;  2X9Y A;  3M65 A;  2WM9 A;  1LKX A;  2CLY B;  4ZS2 A;  3KDS E;  3ZEF B;  5LG4 A;  1YKE B;  4CQI A;  5LGT B;  4HE8 A;  2Y48 B;  2KWH A;  4TV8 E;  2DI4 A;  3CQG B;  1D1B A;  1MMN A;  5C8Y E;  3ETU A;  5EK4 A;  3EUH A;  1HS7 A;  2E9X C;  4GYS A;  4YJ3 E;  3NBX X;  1MIV A;  2XTL A;  1VRB A;  1HG5 A;  2XAG B;  4G63 A;  5J1G A;  4A56 A;  3ZN1 B;  3RRW A;  4EZH A;  4PK5 A;  4AI6 A;  3OKQ A;  3NRX A;  4CI1 B;  1AJ3 A;  3CPZ A;  3F31 A;  4NUV A;  3O9X A;  3RYC E;  3ZCJ A;  5JDG A;  5LXT E;  3PUR A;  1KNZ A;  4V1A v;  5LJN A;  1HFA A;  1E1H B;  3KV6 A;  2Q9Q C;  1MMA A;  3HKE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...