2LHTA

Solution structure of venturia inaequalis cellophane-induced 1 protein (vicin1) domains 1 and 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
122
structure length
122
Chain Sequence
ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYESDKCLNAIKEKYKPVVDPNPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellophane-induced protein 1
publication title Structure, dynamics and domain organization of the repeat protein Cin1 from the apple scab fungus.
pubmed doi rcsb
source organism Venturia inaequalis
molecule tags Cell adhesion
total genus 26
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2011-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.600 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lhtA01
1.10.150.600 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lhtA02
2LHTA
chains in the Genus database with same CATH superfamily
3ALRA 3DEEA 1XSNA 5J2AA 4Y2JA 3C2LA 4ECRA 2AXTU 2A3VA 3Q8LA 3O0FA 2E5SA 5KL8B 5J0YA 1S9FA 3QUQA 4XUSA 1NJYA 4QWCA 2LM1A 1F5SA 4U6PA 3JPRA 4RQ7A 3CRXA 1TVAA 5AKIA 2EZZA 3SAFA 2DUYA 1MA7A 4I2JA 4O5KA 4UB8U 3MFIA 2W9BA 5ALDA 4ECYA 4IRDA 4NWIA 2V4RA 4QWBA 4DSJA 3WKCA 8ICQA 3BS7A 1IG6A 1QSSA 5ALLA 5KT3A 1UA1A 1ZD4A 4BXOB 3OGUA 5KFJA 3GIJA 1S10A 2H3FA 4IR9A 2KSOA 1IV8A 5KG6A 4B9LA 2H3ZA 2BZFA 4ICAA 4O3QA 3NRWA 5J0PA 2BCUA 4DFMA 2DF4B 2ZTDA 1JXLA 1KW4A 4M9LA 2JXJA 4CGZA 2QLTA 3MR5A 2P6UA 2G07A 2OEHA 2LYAA 2KIWA 4DL6A 4HAIA 5KFZA 4Y2XA 3MGIA 4Z6DA 3SEIA 4YXJA 4YMNA 2YQEA 1WYGA 1CRXA 2R8JA 1TAUA 1SV4A 8ICZA 1ZOLA 3H4BA 4B9MA 3ISDA 4YG2A 5DKWA 1ZQEA 4DLEA 4M9JA 4QZIA 1ZQLA 5L1LA 4MEXA 8ICCA 1UT5A 4QW9A 3KZXA 1HUZA 3OHAA 4RQ2A 4NLNA 4RQ6A 2HHXA 4F8RA 1F0MA 8ICVA 1S0VA 5C0YA 3RF9A 2K8BB 1ZQXA 1MQ2A 8ICMA 3RJEA 4M04A 5EE1A 3AU2A 3ETRA 1QQ5A 5BOMA 2Y1IA 1L3UA 2AQ0A 4GFJA 4G9BA 1B0XA 2W04A 3LDAA 4U7CA 3AEVA 2K4EA 1NJZA 3K75D 9ICLA 1ZQYA 2H3VA 3E0FA 2ATLA 4DS5A 1BVSA 4KITB 4I2CA 4ECQA 5IIJA 4IQTA 3NVZA 1RXVA 4F5QA 2DPJA 4R65A 4MFAA 3EZ5A 4I2HA 3QZ8A 4UBCA 4TUSA 2HBKA 4PGYA 4P4OA 4UB2A 4KLFA 2NRVA 3OJUA 3RTVA 1NJXA 1ZETA 3ONNA 4F4ZA 5DDYA 2IA6A 4UB4A 4NL9C 3LVVA 9ICWA 1K1SA 5ALGA 3TACB 2E8OA 1OXJA 1UPHA 3V6JA 9ICCA 5AM3A 2QARA 1COOA 2A1AA 5HMMA 4F3OA 3KHLA 1HUOA 2VJ4A 2KE7A 5ALNA 2F1JA 4KN7A 3UQ2A 1T4GA 2NRXA 4E0DA 5DB8A 2E1EA 1HJPA 4P0QA 2ZIUB 4I29A 1YT3A 5IILA 4KLTA 2G06A 8ICJA 1WWVA 4PGQA 1B43A 4US8A 3GV7B 3Q8RB 4Q45A 5EE3A 4DSFA 4IQWA 2JH1A 4AYBC 4NM2A 3SD7A 1ZQCA 1Z4OA 3M9OB 3SR6A 2PFPA 2D3DA 3C21A 4ELUA 3E58A 5KG1A 2WHEA 4NV0A 5AI9A 9ICVA 1QSYA 5KFKA 3C28A 3L5KA 4LZGA 2HHQA 1O08A 3CYMA 2JZBA 4ECSA 4KLEA 4P0PA 3NASA 1WCLA 3FAHA 2EZXA 4M6WA 3V7JA 2KTQA 7ICQA 5BPCA 5AKHA 4C7ZA 2Y1JA 3RBDA 4F91B 3RFAA 2R8KA 5ALFA 5AK6A 5ALYA 5JRTA 3DDHA 4C4RA 3KTQA 5AM4A 2YB1A 1IIPA 1ZRMA 3LYSA 2XO7A 1ZQRA 1X9SA 1KKXA 2UVUA 2RQ5A 5ALHA 5KG2A 2DPIA 3T79A 4ACOA 4DFKA 2RDJA 2BR0A 1ZD2P 3EW9A 3GQCA 1SV0A 3LK9A 3R9KA 4K4GA 3V6KA 3N4MB 2FJ6A 1ZQUA 4QIWC 1SL2A 8ICSA 5AI8A 1RDFA 2FPKA 3FC4A 3GV8B 3RJKA 5DB7A 2G09A 4IC9A 4PJ0U 1YZ6A 5AHXA 4J9QA 1QQ7A 4PL2A 4DCCA 1L7NA 1SKSA 1LKYA 2G0AA 4PZNA 4GXKA 4IR1A 5L1JA 4UAZA 2EZYA 4C80A 3AN1A 5KFCA 1PVQA 1Z00B 3PY8A 1ZQIA 1ZQTA 3H7IA 5EE9A 5HR7A 4IRCA 2DWQA 5E79U 1NZPA 2BQ3A 4F4KA 3IRUA 3V72A 3QUTA 2XGQA 2W8KA 3MFHA 5CHGA 4F4YA 5ALSA 4BDPA 4DSLA 2KHQA 4G3IA 2CPRA 2LM4A 2YB4A 4KLOA 3PO5A 9ICHA 1U48A 2PXIA 1CUKA 4GC7A 3PW0A 1KN5A 5AKXA 2MAXA 5J8YA 4DL3A 3EYZA 4Z6EA 2PMZF 5D49A 9ICSA 2D6FC 1KFDA 2ZXHA 4C4TA 2OHFA 2O6KA 1N56A 2DKZA 3BZKA 3BQ7A 1N60A 3G6VA 5ALZA 1FO4A 3RB4A 1N2XA 4QNLA 1S0OA 4DO9A 9ICOA 4TQSA 3LWMA 4ECTA 4FBUA 4C4SA 4NLBA 1T3NA 4RQNA 1FIQA 4JV1A 3RH4A 3H0LB 1SL1A 3GZFA 3RJHA 4NLKA 3M6ZA 1YZ7A 1PUZA 4CF5A 4J9OA 3H8MA 1S76D 4R8UB 3JPSA 3KHHA 3WK8A 1XWLA 3QU4A 3NVWA 1PK1A 1VDVA 1DRGA 2DL0A 2WF9A 5KNIA 2P6RA 3D2NA 9ICUA 3EUB2 4JWNA 2XGPA 2Q0ZX 1WCNA 4DFJA 2I1QA 4KX5A 3OSNA 1CI4A 3ZDAA 1KFTA 3PSIA 1T94A 4F4XA 2WF6A 1KBUA 7ICMA 3BDPA 1ZD3A 3GU3A 3OJSA 4I2IA 3KHRA 4PL1A 4B9NA 1X40A 1ZQSA 5CA7A 2C22A 2IHMA 1BPYA 4I2FA 4TQRA 3WK6A 4FBTA 5AK5A 4J9LA 3I28A 1JXEA 5AKYA 1UHUA 5KFLA 2WFAA 3RAXA 3C23A 3SENA 4Y2SA 1NOMA 4DEZA 2HMXA 2ZTEA 4UAVA 5AKEA 3C29A 2R8GA 7ICGA 1ZXIA 2W9AA 1PZNA 3HRDD 3S6JA 3FYHA 4C7YA 5J2EA 3EWAA 2XIDA 7ICOA 2K4PA 8ICYA 3RJJA 8ICUA 1L3VA 3I76A 4EZ9A 3D6JA 3HX0A 5AK3A 2BHNA 4MFCA 2H5XA 3Q8MA 5CRXA 3RH6A 5DLFA 5J0OA 4M9HA 8ICLA 2HBLA 2KV2A 3PZPA 1SXEA 1TV9A 1A6SA 5B66U 2RDIA 2XI9A 5CWRA 1ZQNA 2ISOA 1OW5A 3ZD9A 4Q44A 1JROA 3SV4A 5KFUA 1D8BA 3SV3A 4EBCA 1ZQWA 9ICNA 4Q8FA 2YY6A 3TAPA 4JB3A 1ZD5A 4JUZA 2Y9TA 3H8SA 7ICHA 4DOCA 9ICJA 3OPXA 5G5GA 5J2KA 4JK1A 1AROP 4J9NA 4UASA 5J2JA 3V7LA 2ZXIA 4CDGA 4OJPA 5EWEA 2MA1A 3AU6A 3BQ1A 5KT7A 4ED6A 1BNPA 4K4IA 5DGAA 4OO1J 5AM5A 1X9MA 4QZDA 5DQHA 3VC8A 1Z19A 1S5LU 4M2YA 5AI5A 1NNLA 4FS1A 1NKEA 3Q8PB 4BWJA 3WKDA 3PMNA 2LBOA 1HIWA 2KNJA 3C1ZA 5KT5A 2ZIWA 5EOZA 3GIMA 2F2AB 4UARA 2FPMA 2W9MA 2J6UA 3IG8A 4YN4A 4RU9A 2C2EA 4BUGA 2Y9UA 5DQIA 3ZDDA 5J2IA 3NVVA 2XY6A 3JPTA 4FS2A 1Q46A 3TI0A 1MN8A 4CF3A 3JPNA 4QZFA 1UCVA 3F2BA 3D2QA 3NVYA 4QIWF 4RQ0A 1XO1A 2LHTA 4EBDA 2E8NA 3IN5A 2JRZA 5KT4A 1L3SA 2W43A 3TQ1A 2C2RA 4ELVA 5IIKA 2M0NA 2FPLA 3RR8A 4JV2A 1QSLA 5L1KA 4O0IA 1D9DA 5TZVA 3RB6A 1A77A 3ED5A 3FDSA 1BPBA 5DLGA 3V7KA 2XY7A 4EEKA 1NK6A 2ZIXB 1J2NA 4PHAA 3RJFA 4GXJA 3MR3A 2IOHA 3WKAA 1ZQKA 1DGSA 8ICHA 2PFOA 1IM4A 3WKBA 4C0ZA 5AKKA 5KAIU 2EAOA 4JV0A 2JZBB 4P0PB 5AIBA 1ZQ1C 1DGJA 2ZUDA 1XO0A 4O5EA 3IV6A 4M6WB 1LV5A 5HHIA 3UXPA 3KFUF 4QWEA 4KLSA 7ICJA 5H2FU 3M8RA 4P2HA 3C1YA 4O5CA 4IL6U 3C2KA 2BQRA 2M9NA 3QYPA 2HHWA 3IM1A 5KFNA 2HI0A 4O3PA 4QZAA 1MC8A 9ICAA 1MQ3A 3RH5A 5J0QA 1KQQA 3FM9A 2ASJA 3TFSA 3F2DA 1RXWA 3UPQA 5J2FA 1U9LA 2RLTA 1KDHA 4DL7A 2YMMA 4CCHA 5DDMA 4TUQA 4O3SA 5KG3A 1L7OA 3ZI4A 2WAQC 2E8PA 5A0LA 4QZ8A 4IQUA 5DBCA 3T5HA 2HCFA 2F1IA 5AKLA 4UB1A 3MDAA 4YMOA 1QTMA 1NI3A 3QX7A 5G5HA 4ECXA 9ICXA 1TAQA 5ALIA 2CXYA 1F44A 5KFRA 5ALOA 3Q8SB 2MUTA 4FO6A 2Q4TA 2J6TA 3HKZC 4GLXA 1ZQQA 4NXZA 3ZD8A 4O3RA 5J2GA 4WJ3B 1TFRA 3M6KA 1LB2B 4ED8A 2KN7A 4GIBA 4B6JA 2Y0SC 5CEHA 1SZPA 2H3IA 5F9LA 4F2RA 2G5HB 4RNOA 3QZ7A 8ICXA 3RAQA 4FZLA 2HVIA 4QWDA 3PVXA 1Q3VA 2W7PA 3RB0A 1BPDA 3SAGA 2QB1A 2ZUBA 5KFPA 2LYBA 3VCBA 3L3FX 1ZJMA 2WB1C 4P4MA 4QJFB 2BCVA 1RQNA 2OXOA 3PR4A 2OWOA 1RG6A 2K60A 2KFZA 3HWTA 3DV9A 4RUCA 1ZQBA 1SB3C 3BQ2A 9ICFA 7ICSA 4UAYA 3RR7A 2ZJ8A 3GDXA 4JWMA 1V38A 4EELA 2A1JB 1L5UA 3T5LA 2MU2A 3BS5B 5FP0A 1J97A 2AGOA 3QU7A 3IG5A 4EYHB 1T8EA 4K4HA 1WWUA 4EENA 3WK7A 1DK2A 2KZ3A 4X5VA 4EBEA 5AIAA 2PI5A 4LJXA 3F5AA 1WUDA 3U26A 3B9JA 3MBYA 3K4GA 4RQ5A 5IIMA 2BQUA 2AJQA 5KFVA 2NRZA 2RHFA 1BGXT 4ED2A 1TK0A 7ICVA 5AK4A 3K1ZA 3Q8KA 5JTIA 4CNQA 2WF5A 3TKAA 4I2EA 2AQ4A 4QWAA 1RQLA 3ZDEA 5IINA 1SIJA 4UAUA 4YQWA 3TAQA 3QU5A 2G08A 1HEKA 3PW5A 4YR3A 3QEBZ 4J9MA 4IQVA 1Q3UA 3QU9A 9ICPA 4KLHA 2F44A 4Y2PA 3TFRA 4YR2A 3D2SA 4RQ8A 3OTQA 8ICKA 1QQ6A 2JH7A 3MGVA 9ICRA 2HOFA 3CW2C 5ALQA 4PZOA 2W9CB 5CJ7A 3PW7A 3JPQA 3QUBA 4FFDA 4YD1A 5L1IA 2EAPA 4ECUA 7ICRA 1K5OA 1SZHA 1UT8A 4XA5A 1KSPA 5KFWA 1D8LA 2HSZA 5J0WA 4KLMA 1ZQHA 7ICUA 1D9FA 3WK5A 3GIKA 2GH1A 2JEJA 4R66A 3KKAA 4B9UA 2LMRA 4RNNA 2DFLA 3T3FA 5KG4A 3H8WA 1ZQAA 1X66A 3HP6A 2FLLA 4I2BA 2W03A 1SWVA 4US9A 5KL1B 1SKWA 1X6JA 4F5PA 2W3RA 4KMOB 4DL5A 2HW3A 1QCKA 3HW8A 4DSIA 2JHDA 4J9PA 5C5JA 4DQSA 3PV8A 3C5FA 3H40A 1L8LA 1V9PA 1V85A 2EH9A 1Y88A 4CE6A 1VJ5A 8ICNA 3TARA 2AHOB 3ISCA 2YN4A 1DOQA 5AM1A 2R8HA 2E1FA 2JV3A 2KEYA 4FE3A 1X9WA 4USAA 4RPYA 2KIVA 4UATA 2PFNA 5J0RA 2QKQA 1X42A 1PVRA 2ODGA 4UQGA 4Y2UA 2XCPA 1NK7A 3RRHA 1URJA 2KOBA 2F76X 5DG8A 2YMPA 3QNMA 4LZDA 1ZYQA 1TE2A 2JEGA 2BCSA 2IMWP 5J8YC 4O3MA 2F77X 2OYYA 4Y2RA 4NLGA 2ZIUA 5AKGA 2HOIA 1U45A 1RYUA 2IBKA 3KZIU 2ESEA 3H0MB 4ZH4A 3B0XA 2NV3A 3N28A 2F8LA 4NM1A 4UB3A 2AGPA 2W9BB 5KFXA 2BCQA 3UMGA 2KMDA 4F93B 4YMMA 5T14A 4QZHA 1Z1BA 2NRTA 3HT3A 5AKJA 4FZNA 5ALJA 3CNHA 4XRHA 2KSOB 5HNKA 5J0XA 1L7PA 2A19A 3GILA 4RQMA 4EX7A 4B9TA 1ZQGA 2R8IA 3PX6A 5KAFU 2BPGA 4KLIA 1RYRA 5IIOA 2I5HA 4KX3A 1PK3A 4F5RA 1MSWD 2D8CA 3HKZF 1A76A 4C8LA 5KT6A 1BPXA 4RUAA 7ICLA 3MC1A 4MEYA 4YVZA 2LI6A 1A0PA 2UVRA 4B9SA 1JIHA 1ZQFA 2NO4A 1RZTA 3C5GA 2W8LA 2ES6A 4RT3A 4RQ1A 4UB5A 2YTUA 3TADA 4B9VA 1BPEA 4YP3A 3PSTA 4UW9A 5DB6A 1OUQA 4EZ6A 3H4DA 4OJ6A 4QW8A 4I28A 4ED3A 3ZDCA 5KG0A 3SMVA 5CB1A 4C8KA 2BDPA 1X2IA 2IOFK 5F9NA 2CN1A 3JPPA 9ICKA 1ZQVA 3QU2A 2L5YA 1ZQMA 4CF4A 3PMLA 4Y2YA 1ZRNA 3V6HA 1XSPA 1TAMA 4O9MA 2ZJAA 4I2AA 5ALWA 4PGXA 2ZJ5A 1N5XA 5EWFA 2HBJA 4EX6A 4AYBF 5K4LA 3BZCA 4MF2A 1SGGA 7ICKA 4BX9C 1ZJNA 5J2HA 3HPOA 2ZIVA 4UBBA 2J6SA 3AQFA 1N48A 2AH5A 3CP8A 3E2EA 3UMCA 3SQIA 5DG7A 1EXNA 3THVA 2WTFA 2KZMA 9ICIA 2KK0A 3PW4A 1Q8KA 4KLLA 2V4QA 2VA8A 2XVTA 3IHQB 1T3QA 2QARB 3B0YA 4I2DA 5ALPA 3M9NB 4ED0A 1PVPA 4RPZA 4DWIA 1RM6C 4M0AA 2VJ5A 5CP2A 2ISPA 4MF8A 2EAMA 3K1RB 1KLNA 3IP4B 3BQTA 2K4HA 3WU2U 4P0QB 2F8KA 4IS7A 4RNMA 1L7MA 5KT2A 9ICGA 5ALUA 4ED7A 4ED1A 4I2GA 4NJ8A 4R8UA 8ICIA 2F1HA 2KKPA 4R64A 5AICA 5AKZA 4FZMA 1X6IA 5J29A 5HMLA 2VA2A 2QB0A 2KG5A 3QE9Y 4RQ3A 4J9SA 3PO4A 5JUMA 2B6GA 2IOFA 4RPXA 2B0CA 2GOLA 1ECWA 4MFFA 1DK3A 2UVWA 4Q43A 2C2DA 1D8YA 1FFVA 4DQRA 2PMZC 1KL9A 4QZ9A 1CEZA 1RYSA 3L4PA 3HJEA 3T5KA 2KICA 3MABA 5J0SA 5IIIA 3Q8QB 3J81j 4QZGA 2FLNA 3M1YA 1N61A 4J03A 2ALZA 2JEIA 3RBEA 4DL2A 2IHNA 2K89A 2VKQA 3KHGA 1BPZA 4P4PA 4M9NA 4R63A 4J9KA 4NLCA 2KVCA 3PSFA 1FFUA 4F4WA 1L6NA 4LVSA 4DS4A 2XC9A 2W7OA 1DXSA 1SXDA 5KTQA 4DQIA 2KFNA 1ZQPA 2H3QA 2W54A 5JU5A 9ICMA 3F53A 3F2CA 5ALMA 3NTUA 5KFGA 2NRWA 3RJGA 2P66A 3BJYA 2VA3A 2FE9A 2OCEA 2AGQA 3NS1A 4NLZA 2HDOA 1LKYB 4TURA 5J2DA 1TK8A 4A8EA 3UMBA 4O3OA 3OHBA 2VIXA 4OJOA 1C7YA 2EANA 1RPLA 4AP9A 4KLDA 1BNOA 2ZTCA 2KD1A 1B22A 4NL9A 3BQ0A 1ED1A 2PI4A 3AMZA 1B4FA 3GFKB 2AU0A 1TK5A 2FMSA 1JN3A 3AUOA 1ZQJA 4KMUA 5ALKA 4C8MA 3NRZA 1UA0A 4F71A 7ICEA 1U49A 2DGZA 3MR2A 3PW2A 5CR0A 1K1QA 2B21A 5ALVA 2EQYA 4XQ8A 2F3NA 2OM6A 3H8JA 8ICAA 2KJ5A 2N1RA 2XY5A 4OD0A 3QUCA 1U4BA 8ICBA 3SI8A 4DF4A 5GTIU 1O03A 5L9XA 3ETLA 3ISBA 7ICPA 3PNCA 3N7RC 4F5OA 2WF7A 3LVWA 2LPEA 5KFAA 4J9RA 1XS9D 3I1YA 1ZQOA 4IRKA 5DBBA 5ALRA 4PHEA 3G6YA 4ECWA 4BXOA 5KFFA 1M6YA 2I6XA 1JX4A 2FMPA 2NO5A 4DSEA 1PK1B 2ZG6A 5BOLA 4F2SA 3M9MB 1UQVA 2KKVA 9ICBA 3NUQA 5EE0A 5KFHA 8ICFA 2NYVA 2ZIXA 3M8SA 8ICEA 2OH2A 2JR5A 5J0TA 1JMSA 3NGDA 4DFPA 5F3XB 3RRGA 5KFTA 2MRLA 1JUDA 4KLGA 4MHVA 3SAHA 1NJWA 3RJIA 4Q8EA 4OJLA 1N5WA 4QZCA 1XNSA 1S0MA 4OJ5A 2W11A 3WKEA 2E8MA 4NY8A 3ORYA 8ICGA 5D4BA 2KJ8A 8ICRA 3JPOA 3PR5B 4F5NA 1NK9A 9ICQA 4BWMA 5J2BA 4C8OA 4Y2TA 2XCAA 2HHUA 2W3SA 3MDCA 1SV0C 5DGBA 1GO3F 4YR0A 1ZQDA 3LWLA 2YMQA 5DG9A 3KBBA 4I27A 2K8CB 9ICTA 5ALTA 1KTQA 2HOQA 2C28A 1AQ6A 7ICIA 2CRXA 3AL0B 2G5IB 4QZBA 1NKCA 3KD3A 1TKDA 4DFDA 4RT2A 2KVSA 5DBAA 3M7DA 3MGHA 4Z6CA 2KJ9A 3KKAC 2RRDA 1FEZA 2VANA 9ICEA 5KFBA 3MR6A 5KFQA 1U47A 3C2MA 2KZZA 1JRPA 3QEAZ 4KLUA 1LVHA 2MSNA 2BCRA 3F5EA 2PFQA 8ICPA 3WK9A 1JI7A 5AI0A 1QH9A 1C20A 2KP7A 1NZBA 5KFMA 5HR6A 2V9WA 4BJQA 1XC9A 5D46A 4DQQA 4KTQA 5ALEA 3KOOA 4O3NA 1L8OA 3IDWA 5KFIA 1S0NA 4BGDA 4Z6FA 3AQEA 4GXIA 2ZIVB 5GTHU 3UM9A 2EDUA 5DB9A 1Z1VA 2E3TA 3PSPA 1N62A 2K8AA 3ICXA 2HHVA 1COKA 2BGWA 4DQPA 4QZEA 3WK4A 3QXGA 2FMQA 3UXOA 5AI4A 4PH5A 5J2CA 3GIIA 1S97A 1P7DA 3TANA 2ZIWB 5B5EU 3ZDBA 4OCZA 2A1JA 4DOBA 2GWSA 4Y2QA 5ALXA 2K4IA 3BS5A 5AM0A 8ICWA 3PX0A 1SWWA 4PHDA 4YXMA 2KHVA 2WF8A 3T5JA 2Z7JA 2PKEA 1L3TA 2FI1A 4EYIB 2WAQF 4CRXA 4RQ4A 3G6XA 7ICTA 1KFSA 1SKRA 2XICA 1J2MA 4F72A 2LYHA 3A0HU 2I9GA 1Z3EB 2QB0B 3H0RB 2LKYA 1KRPA 5KG5A 1S8OA 5KFSA 3SYZA 5HP4A 4DL4A 3UQ0A 2BPFA 2YMLA 2RP5A 1V97A 5AI6A 4UAWA 3OSPA 4KLQA 2JMGA 8ICOA 4YFKA 1NK4A 5DQGA 4Y2VA 2R18A 1N63A 1QLNA 7ICNA 2HVHA 2Y0SF 4F92B 5KFOA 4ECZA 1H38A 2P35A 1WG8A 2ZUCA 4EEYA 3N7SC 3N7PD 3RB3A 2JGAA 4GC6A 1T7PA 1NK0A 2W9CA 3A0BU 2HHTA 1VLBA 5KFEA 1S77D 2DBYA 2FLPA 3TADC 2JEFA 4DF8A 5HHHA 4ELTA 2WB1F 4DOAA 4DSKA 5KFYA 3AM9A 1JALA 4KLJA 4HYKA 4UB6U 5EWGA 2ASDA 5J0UA 4PPXA 3GV5B 5AM2A 7ICFA 1NK5A 2UVVA 3N97B 4M47A 2BPCA 1XSLA 3PX4A 2HHSA 5KFDA 2FDRA 2BDUA 3SZ2A 1Z00A 2BKEA 4YCXA 4PHPA 5L1MA 2MUTB 3EPIA 3UXNA 4C8NA 4YD2A 4TUPA 2GLEA 1X9XA 2HBMA 5KG7A 3EPGA 1XU4A 2ASLA 4ECVA 4ZOHC 2W55A 4JMUA 4DLGA 4RZRA 8ICTA 1IXRA 4F50A 1SL0A 5TISU 2GO7A 1KEJA 1NK8A 1Z4NA 1ZQZA 2DQNB 3HILA 2YX8A 1NKBA 4M9GA 2DKXA 4KN4A
chains in the Genus database with same CATH topology
4P0QA 4PL2A 2ZIUB 3OPXA 3D2NA 3ALRA 3SAGA 4O3MA 2KKPA 3DEEA 1YT3A 4C0ZA 2ZIXA 2F77X 5C0YA 3N7SC 3N7PD 3RF9A 2VIXA 2OYYA 2JGAA 2K8BB 2G0AA 2CN1A 2LYBA 4OJOA 3VCBA 2OH2A 4P0PB 3L3FX 1ZQ1C 2WB1C 4FZMA 2G06A 4KX5A 4QJFB 1XO0A 2OXOA 2A3VA 2ZIUA 2ZXIA 3AQEA 1DRGA 2ZIVB 3O0FA 2E5SA 5KL8B 4CDGA 3AL0B 4OJPA 2MRLA 3PSIA 2HOIA 3KFUF 1T94A 2MA1A 1KBUA 1PVQA 3GU3A 3PSPA 2JH1A 4AYBC 1SZHA 3H0MB 3SAHA 2NV3A 2F8LA 2K8AA 3ICXA 2KD1A 4U6PA 2WB1F 4GFJA 2W04A 5HR7A 1TAMA 4PL1A 4U7CA 4OJLA 1XNSA 3CRXA 2K4EA 4OO1J 4OJ5A 5T14A 2GH1A 2GOLA 1ECWA 3SAFA 1ED1A 2H3VA 3E0FA 4NV0A 1MA7A 3VC8A 1Z19A 2HBJA 1Z1BA 4AYBF 4NWIA 1P7DA 2KJ8A 3C28A 2ZIWB 2LBOA 1HIWA 2KNJA 2W03A 4FZNA 4BX9C 5KL1B 3CYMA 3F2DA 3IG5A 2ZIWA 4P0PA 4KMOB 2HMXA 2PMZC 2F2AB 2KHQA 2CPRA 3C29A 2K4IA 2KICA 2ZIVA 3IG8A 2DGZA 2YB4A 1GO3F 2JHDA 2H3FA 2BDUA 2WAQC 5A0LA 3RFAA 3AQFA 2OM6A 3F5AA 1WUDA 2KJ5A 2N1RA 4BUGA 4KX3A 2YB1A 2XIDA 2H3ZA 1IIPA 2K8CB 2KHVA 2PMZF 3CP8A 3HKZF 2HBKA 3LYSA 2Z7JA 2ZXHA 2RHFA 4ICAA 2D6FC 2K89A 3NRWA 2HOQA 3SQIA 2VKQA 2WAQF 3K1ZA 3N7RC 2CRXA 2G5IB 3LVWA 1A0PA 2E1FA 2KEYA 2DF4B 1F44A 4CRXA 4FE3A 4NLCA 2KVCA 3PSFA 3M7DA 3T79A 2XICA 2Q4TA 3ONNA 4ACOA 5CRXA 1L6NA 2HBMA 3HKZC 4CGZA 2XVTA 2KJ9A 3LVVA 2G07A 2W7OA 2LYAA 4QNLA 3F2BA 2KIWA 2HBLA 2RRDA 1PVPA 3D2QA 2KV2A 4QIWF 5HR6A 3PZPA 2LHTA 4WJ3B 3H0RB 2H3QA 3M6KA 1A6SA 2VJ5A 3IN5A 1UPHA 2LKYA 1CRXA 1PVRA 3F53A 2G08A 4NLBA 3PSTA 1HEKA 2XI9A 4JMUA 3F2CA 1OUQA 2Y0SC 2H3IA 1URJA 2M0NA 2KOBA 2F76X 3F5EA 4A8EA 3IP4B 1Q3UA 2G5HB 2VJ4A 3H0LB 3GZFA 4QIWC 1D8BA 2K4HA 2RP5A 3M6ZA 2ZG6A 4OJ6A 2JMGA 1NZBA 4P0QB 4FZLA 3D2SA 2R18A 2ZIXB 2KKVA 2G09A 3KZXA 2DQNB 2JH7A 2YX8A 4IC9A 2Y0SF 2E1EA 4BJQA 3MGVA 1Q3VA 2HOFA 2W7PA 3NUQA 3SMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHT A; 
#chains in the Genus database with same CATH topology
 3ALR A;  3DEE A;  1XSN A;  5J2A A;  4Y2J A;  3C2L A;  4ECR A;  2AXT U;  2A3V A;  3Q8L A;  3O0F A;  2E5S A;  5KL8 B;  5J0Y A;  1S9F A;  3QUQ A;  4XUS A;  1NJY A;  4QWC A;  2LM1 A;  1F5S A;  4U6P A;  3JPR A;  4RQ7 A;  3CRX A;  1TVA A;  5AKI A;  2EZZ A;  3SAF A;  2DUY A;  1MA7 A;  4I2J A;  4O5K A;  4UB8 U;  3MFI A;  2W9B A;  5ALD A;  4ECY A;  4IRD A;  4NWI A;  2V4R A;  4QWB A;  4DSJ A;  3WKC A;  8ICQ A;  3BS7 A;  1IG6 A;  1QSS A;  5ALL A;  5KT3 A;  1UA1 A;  1ZD4 A;  4BXO B;  3OGU A;  5KFJ A;  3GIJ A;  1S10 A;  2H3F A;  4IR9 A;  2KSO A;  1IV8 A;  5KG6 A;  4B9L A;  2H3Z A;  2BZF A;  4ICA A;  4O3Q A;  3NRW A;  5J0P A;  2BCU A;  4DFM A;  2DF4 B;  2ZTD A;  1JXL A;  1KW4 A;  4M9L A;  2JXJ A;  4CGZ A;  2QLT A;  3MR5 A;  2P6U A;  2G07 A;  2OEH A;  2LYA A;  2KIW A;  4DL6 A;  4HAI A;  5KFZ A;  4Y2X A;  3MGI A;  4Z6D A;  3SEI A;  4YXJ A;  4YMN A;  2YQE A;  1WYG A;  1CRX A;  2R8J A;  1TAU A;  1SV4 A;  8ICZ A;  1ZOL A;  3H4B A;  4B9M A;  3ISD A;  4YG2 A;  5DKW A;  1ZQE A;  4DLE A;  4M9J A;  4QZI A;  1ZQL A;  5L1L A;  4MEX A;  8ICC A;  1UT5 A;  4QW9 A;  3KZX A;  1HUZ A;  3OHA A;  4RQ2 A;  4NLN A;  4RQ6 A;  2HHX A;  4F8R A;  1F0M A;  8ICV A;  1S0V A;  5C0Y A;  3RF9 A;  2K8B B;  1ZQX A;  1MQ2 A;  8ICM A;  3RJE A;  4M04 A;  5EE1 A;  3AU2 A;  3ETR A;  1QQ5 A;  5BOM A;  2Y1I A;  1L3U A;  2AQ0 A;  4GFJ A;  4G9B A;  1B0X A;  2W04 A;  3LDA A;  4U7C A;  3AEV A;  2K4E A;  1NJZ A;  3K75 D;  9ICL A;  1ZQY A;  2H3V A;  3E0F A;  2ATL A;  4DS5 A;  1BVS A;  4KIT B;  4I2C A;  4ECQ A;  5IIJ A;  4IQT A;  3NVZ A;  1RXV A;  4F5Q A;  2DPJ A;  4R65 A;  4MFA A;  3EZ5 A;  4I2H A;  3QZ8 A;  4UBC A;  4TUS A;  2HBK A;  4PGY A;  4P4O A;  4UB2 A;  4KLF A;  2NRV A;  3OJU A;  3RTV A;  1NJX A;  1ZET A;  3ONN A;  4F4Z A;  5DDY A;  2IA6 A;  4UB4 A;  4NL9 C;  3LVV A;  9ICW A;  1K1S A;  5ALG A;  3TAC B;  2E8O A;  1OXJ A;  1UPH A;  3V6J A;  9ICC A;  5AM3 A;  2QAR A;  1COO A;  2A1A A;  5HMM A;  4F3O A;  3KHL A;  1HUO A;  2VJ4 A;  2KE7 A;  5ALN A;  2F1J A;  4KN7 A;  3UQ2 A;  1T4G A;  2NRX A;  4E0D A;  5DB8 A;  2E1E A;  1HJP A;  4P0Q A;  2ZIU B;  4I29 A;  1YT3 A;  5IIL A;  4KLT A;  2G06 A;  8ICJ A;  1WWV A;  4PGQ A;  1B43 A;  4US8 A;  3GV7 B;  3Q8R B;  4Q45 A;  5EE3 A;  4DSF A;  4IQW A;  2JH1 A;  4AYB C;  4NM2 A;  3SD7 A;  1ZQC A;  1Z4O A;  3M9O B;  3SR6 A;  2PFP A;  2D3D A;  3C21 A;  4ELU A;  3E58 A;  5KG1 A;  2WHE A;  4NV0 A;  5AI9 A;  9ICV A;  1QSY A;  5KFK A;  3C28 A;  3L5K A;  4LZG A;  2HHQ A;  1O08 A;  3CYM A;  2JZB A;  4ECS A;  4KLE A;  4P0P A;  3NAS A;  1WCL A;  3FAH A;  2EZX A;  4M6W A;  3V7J A;  2KTQ A;  7ICQ A;  5BPC A;  5AKH A;  4C7Z A;  2Y1J A;  3RBD A;  4F91 B;  3RFA A;  2R8K A;  5ALF A;  5AK6 A;  5ALY A;  5JRT A;  3DDH A;  4C4R A;  3KTQ A;  5AM4 A;  2YB1 A;  1IIP A;  1ZRM A;  3LYS A;  2XO7 A;  1ZQR A;  1X9S A;  1KKX A;  2UVU A;  2RQ5 A;  5ALH A;  5KG2 A;  2DPI A;  3T79 A;  4ACO A;  4DFK A;  2RDJ A;  2BR0 A;  1ZD2 P;  3EW9 A;  3GQC A;  1SV0 A;  3LK9 A;  3R9K A;  4K4G A;  3V6K A;  3N4M B;  2FJ6 A;  1ZQU A;  4QIW C;  1SL2 A;  8ICS A;  5AI8 A;  1RDF A;  2FPK A;  3FC4 A;  3GV8 B;  3RJK A;  5DB7 A;  2G09 A;  4IC9 A;  4PJ0 U;  1YZ6 A;  5AHX A;  4J9Q A;  1QQ7 A;  4PL2 A;  4DCC A;  1L7N A;  1SKS A;  1LKY A;  2G0A A;  4PZN A;  4GXK A;  4IR1 A;  5L1J A;  4UAZ A;  2EZY A;  4C80 A;  3AN1 A;  5KFC A;  1PVQ A;  1Z00 B;  3PY8 A;  1ZQI A;  1ZQT A;  3H7I A;  5EE9 A;  5HR7 A;  4IRC A;  2DWQ A;  5E79 U;  1NZP A;  2BQ3 A;  4F4K A;  3IRU A;  3V72 A;  3QUT A;  2XGQ A;  2W8K A;  3MFH A;  5CHG A;  4F4Y A;  5ALS A;  4BDP A;  4DSL A;  2KHQ A;  4G3I A;  2CPR A;  2LM4 A;  2YB4 A;  4KLO A;  3PO5 A;  9ICH A;  1U48 A;  2PXI A;  1CUK A;  4GC7 A;  3PW0 A;  1KN5 A;  5AKX A;  2MAX A;  5J8Y A;  4DL3 A;  3EYZ A;  4Z6E A;  2PMZ F;  5D49 A;  9ICS A;  2D6F C;  1KFD A;  2ZXH A;  4C4T A;  2OHF A;  2O6K A;  1N56 A;  2DKZ A;  3BZK A;  3BQ7 A;  1N60 A;  3G6V A;  5ALZ A;  1FO4 A;  3RB4 A;  1N2X A;  4QNL A;  1S0O A;  4DO9 A;  9ICO A;  4TQS A;  3LWM A;  4ECT A;  4FBU A;  4C4S A;  4NLB A;  1T3N A;  4RQN A;  1FIQ A;  4JV1 A;  3RH4 A;  3H0L B;  1SL1 A;  3GZF A;  3RJH A;  4NLK A;  3M6Z A;  1YZ7 A;  1PUZ A;  4CF5 A;  4J9O A;  3H8M A;  1S76 D;  4R8U B;  3JPS A;  3KHH A;  3WK8 A;  1XWL A;  3QU4 A;  3NVW A;  1PK1 A;  1VDV A;  1DRG A;  2DL0 A;  2WF9 A;  5KNI A;  2P6R A;  3D2N A;  9ICU A;  3EUB 2;  4JWN A;  2XGP A;  2Q0Z X;  1WCN A;  4DFJ A;  2I1Q A;  4KX5 A;  3OSN A;  1CI4 A;  3ZDA A;  1KFT A;  3PSI A;  1T94 A;  4F4X A;  2WF6 A;  1KBU A;  7ICM A;  3BDP A;  1ZD3 A;  3GU3 A;  3OJS A;  4I2I A;  3KHR A;  4PL1 A;  4B9N A;  1X40 A;  1ZQS A;  5CA7 A;  2C22 A;  2IHM A;  1BPY A;  4I2F A;  4TQR A;  3WK6 A;  4FBT A;  5AK5 A;  4J9L A;  3I28 A;  1JXE A;  5AKY A;  1UHU A;  5KFL A;  2WFA A;  3RAX A;  3C23 A;  3SEN A;  4Y2S A;  1NOM A;  4DEZ A;  2HMX A;  2ZTE A;  4UAV A;  5AKE A;  3C29 A;  2R8G A;  7ICG A;  1ZXI A;  2W9A A;  1PZN A;  3HRD D;  3S6J A;  3FYH A;  4C7Y A;  5J2E A;  3EWA A;  2XID A;  7ICO A;  2K4P A;  8ICY A;  3RJJ A;  8ICU A;  1L3V A;  3I76 A;  4EZ9 A;  3D6J A;  3HX0 A;  5AK3 A;  2BHN A;  4MFC A;  2H5X A;  3Q8M A;  5CRX A;  3RH6 A;  5DLF A;  5J0O A;  4M9H A;  8ICL A;  2HBL A;  2KV2 A;  3PZP A;  1SXE A;  1TV9 A;  1A6S A;  5B66 U;  2RDI A;  2XI9 A;  5CWR A;  1ZQN A;  2ISO A;  1OW5 A;  3ZD9 A;  4Q44 A;  1JRO A;  3SV4 A;  5KFU A;  1D8B A;  3SV3 A;  4EBC A;  1ZQW A;  9ICN A;  4Q8F A;  2YY6 A;  3TAP A;  4JB3 A;  1ZD5 A;  4JUZ A;  2Y9T A;  3H8S A;  7ICH A;  4DOC A;  9ICJ A;  3OPX A;  5G5G A;  5J2K A;  4JK1 A;  1ARO P;  4J9N A;  4UAS A;  5J2J A;  3V7L A;  2ZXI A;  4CDG A;  4OJP A;  5EWE A;  2MA1 A;  3AU6 A;  3BQ1 A;  5KT7 A;  4ED6 A;  1BNP A;  4K4I A;  5DGA A;  4OO1 J;  5AM5 A;  1X9M A;  4QZD A;  5DQH A;  3VC8 A;  1Z19 A;  1S5L U;  4M2Y A;  5AI5 A;  1NNL A;  4FS1 A;  1NKE A;  3Q8P B;  4BWJ A;  3WKD A;  3PMN A;  2LBO A;  1HIW A;  2KNJ A;  3C1Z A;  5KT5 A;  2ZIW A;  5EOZ A;  3GIM A;  2F2A B;  4UAR A;  2FPM A;  2W9M A;  2J6U A;  3IG8 A;  4YN4 A;  4RU9 A;  2C2E A;  4BUG A;  2Y9U A;  5DQI A;  3ZDD A;  5J2I A;  3NVV A;  2XY6 A;  3JPT A;  4FS2 A;  1Q46 A;  3TI0 A;  1MN8 A;  4CF3 A;  3JPN A;  4QZF A;  1UCV A;  3F2B A;  3D2Q A;  3NVY A;  4QIW F;  4RQ0 A;  1XO1 A;  2LHT A;  4EBD A;  2E8N A;  3IN5 A;  2JRZ A;  5KT4 A;  1L3S A;  2W43 A;  3TQ1 A;  2C2R A;  4ELV A;  5IIK A;  2M0N A;  2FPL A;  3RR8 A;  4JV2 A;  1QSL A;  5L1K A;  4O0I A;  1D9D A;  5TZV A;  3RB6 A;  1A77 A;  3ED5 A;  3FDS A;  1BPB A;  5DLG A;  3V7K A;  2XY7 A;  4EEK A;  1NK6 A;  2ZIX B;  1J2N A;  4PHA A;  3RJF A;  4GXJ A;  3MR3 A;  2IOH A;  3WKA A;  1ZQK A;  1DGS A;  8ICH A;  2PFO A;  1IM4 A;  3WKB A;  4C0Z A;  5AKK A;  5KAI U;  2EAO A;  4JV0 A;  2JZB B;  4P0P B;  5AIB A;  1ZQ1 C;  1DGJ A;  2ZUD A;  1XO0 A;  4O5E A;  3IV6 A;  4M6W B;  1LV5 A;  5HHI A;  3UXP A;  3KFU F;  4QWE A;  4KLS A;  7ICJ A;  5H2F U;  3M8R A;  4P2H A;  3C1Y A;  4O5C A;  4IL6 U;  3C2K A;  2BQR A;  2M9N A;  3QYP A;  2HHW A;  3IM1 A;  5KFN A;  2HI0 A;  4O3P A;  4QZA A;  1MC8 A;  9ICA A;  1MQ3 A;  3RH5 A;  5J0Q A;  1KQQ A;  3FM9 A;  2ASJ A;  3TFS A;  3F2D A;  1RXW A;  3UPQ A;  5J2F A;  1U9L A;  2RLT A;  1KDH A;  4DL7 A;  2YMM A;  4CCH A;  5DDM A;  4TUQ A;  4O3S A;  5KG3 A;  1L7O A;  3ZI4 A;  2WAQ C;  2E8P A;  5A0L A;  4QZ8 A;  4IQU A;  5DBC A;  3T5H A;  2HCF A;  2F1I A;  5AKL A;  4UB1 A;  3MDA A;  4YMO A;  1QTM A;  1NI3 A;  3QX7 A;  5G5H A;  4ECX A;  9ICX A;  1TAQ A;  5ALI A;  2CXY A;  1F44 A;  5KFR A;  5ALO A;  3Q8S B;  2MUT A;  4FO6 A;  2Q4T A;  2J6T A;  3HKZ C;  4GLX A;  1ZQQ A;  4NXZ A;  3ZD8 A;  4O3R A;  5J2G A;  4WJ3 B;  1TFR A;  3M6K A;  1LB2 B;  4ED8 A;  2KN7 A;  4GIB A;  4B6J A;  2Y0S C;  5CEH A;  1SZP A;  2H3I A;  5F9L A;  4F2R A;  2G5H B;  4RNO A;  3QZ7 A;  8ICX A;  3RAQ A;  4FZL A;  2HVI A;  4QWD A;  3PVX A;  1Q3V A;  2W7P A;  3RB0 A;  1BPD A;  3SAG A;  2QB1 A;  2ZUB A;  5KFP A;  2LYB A;  3VCB A;  3L3F X;  1ZJM A;  2WB1 C;  4P4M A;  4QJF B;  2BCV A;  1RQN A;  2OXO A;  3PR4 A;  2OWO A;  1RG6 A;  2K60 A;  2KFZ A;  3HWT A;  3DV9 A;  4RUC A;  1ZQB A;  1SB3 C;  3BQ2 A;  9ICF A;  7ICS A;  4UAY A;  3RR7 A;  2ZJ8 A;  3GDX A;  4JWM A;  1V38 A;  4EEL A;  2A1J B;  1L5U A;  3T5L A;  2MU2 A;  3BS5 B;  5FP0 A;  1J97 A;  2AGO A;  3QU7 A;  3IG5 A;  4EYH B;  1T8E A;  4K4H A;  1WWU A;  4EEN A;  3WK7 A;  1DK2 A;  2KZ3 A;  4X5V A;  4EBE A;  5AIA A;  2PI5 A;  4LJX A;  3F5A A;  1WUD A;  3U26 A;  3B9J A;  3MBY A;  3K4G A;  4RQ5 A;  5IIM A;  2BQU A;  2AJQ A;  5KFV A;  2NRZ A;  2RHF A;  1BGX T;  4ED2 A;  1TK0 A;  7ICV A;  5AK4 A;  3K1Z A;  3Q8K A;  5JTI A;  4CNQ A;  2WF5 A;  3TKA A;  4I2E A;  2AQ4 A;  4QWA A;  1RQL A;  3ZDE A;  5IIN A;  1SIJ A;  4UAU A;  4YQW A;  3TAQ A;  3QU5 A;  2G08 A;  1HEK A;  3PW5 A;  4YR3 A;  3QEB Z;  4J9M A;  4IQV A;  1Q3U A;  3QU9 A;  9ICP A;  4KLH A;  2F44 A;  4Y2P A;  3TFR A;  4YR2 A;  3D2S A;  4RQ8 A;  3OTQ A;  8ICK A;  1QQ6 A;  2JH7 A;  3MGV A;  9ICR A;  2HOF A;  3CW2 C;  5ALQ A;  4PZO A;  2W9C B;  5CJ7 A;  3PW7 A;  3JPQ A;  3QUB A;  4FFD A;  4YD1 A;  5L1I A;  2EAP A;  4ECU A;  7ICR A;  1K5O A;  1SZH A;  1UT8 A;  4XA5 A;  1KSP A;  5KFW A;  1D8L A;  2HSZ A;  5J0W A;  4KLM A;  1ZQH A;  7ICU A;  1D9F A;  3WK5 A;  3GIK A;  2GH1 A;  2JEJ A;  4R66 A;  3KKA A;  4B9U A;  2LMR A;  4RNN A;  2DFL A;  3T3F A;  5KG4 A;  3H8W A;  1ZQA A;  1X66 A;  3HP6 A;  2FLL A;  4I2B A;  2W03 A;  1SWV A;  4US9 A;  5KL1 B;  1SKW A;  1X6J A;  4F5P A;  2W3R A;  4KMO B;  4DL5 A;  2HW3 A;  1QCK A;  3HW8 A;  4DSI A;  2JHD A;  4J9P A;  5C5J A;  4DQS A;  3PV8 A;  3C5F A;  3H40 A;  1L8L A;  1V9P A;  1V85 A;  2EH9 A;  1Y88 A;  4CE6 A;  1VJ5 A;  8ICN A;  3TAR A;  2AHO B;  3ISC A;  2YN4 A;  1DOQ A;  5AM1 A;  2R8H A;  2E1F A;  2JV3 A;  2KEY A;  4FE3 A;  1X9W A;  4USA A;  4RPY A;  2KIV A;  4UAT A;  2PFN A;  5J0R A;  2QKQ A;  1X42 A;  1PVR A;  2ODG A;  4UQG A;  4Y2U A;  2XCP A;  1NK7 A;  3RRH A;  1URJ A;  2KOB A;  2F76 X;  5DG8 A;  2YMP A;  3QNM A;  4LZD A;  1ZYQ A;  1TE2 A;  2JEG A;  2BCS A;  2IMW P;  5J8Y C;  4O3M A;  2F77 X;  2OYY A;  4Y2R A;  4NLG A;  2ZIU A;  5AKG A;  2HOI A;  1U45 A;  1RYU A;  2IBK A;  3KZI U;  2ESE A;  3H0M B;  4ZH4 A;  3B0X A;  2NV3 A;  3N28 A;  2F8L A;  4NM1 A;  4UB3 A;  2AGP A;  2W9B B;  5KFX A;  2BCQ A;  3UMG A;  2KMD A;  4F93 B;  4YMM A;  5T14 A;  4QZH A;  1Z1B A;  2NRT A;  3HT3 A;  5AKJ A;  4FZN A;  5ALJ A;  3CNH A;  4XRH A;  2KSO B;  5HNK A;  5J0X A;  1L7P A;  2A19 A;  3GIL A;  4RQM A;  4EX7 A;  4B9T A;  1ZQG A;  2R8I A;  3PX6 A;  5KAF U;  2BPG A;  4KLI A;  1RYR A;  5IIO A;  2I5H A;  4KX3 A;  1PK3 A;  4F5R A;  1MSW D;  2D8C A;  3HKZ F;  1A76 A;  4C8L A;  5KT6 A;  1BPX A;  4RUA A;  7ICL A;  3MC1 A;  4MEY A;  4YVZ A;  2LI6 A;  1A0P A;  2UVR A;  4B9S A;  1JIH A;  1ZQF A;  2NO4 A;  1RZT A;  3C5G A;  2W8L A;  2ES6 A;  4RT3 A;  4RQ1 A;  4UB5 A;  2YTU A;  3TAD A;  4B9V A;  1BPE A;  4YP3 A;  3PST A;  4UW9 A;  5DB6 A;  1OUQ A;  4EZ6 A;  3H4D A;  4OJ6 A;  4QW8 A;  4I28 A;  4ED3 A;  3ZDC A;  5KG0 A;  3SMV A;  5CB1 A;  4C8K A;  2BDP A;  1X2I A;  2IOF K;  5F9N A;  2CN1 A;  3JPP A;  9ICK A;  1ZQV A;  3QU2 A;  2L5Y A;  1ZQM A;  4CF4 A;  3PML A;  4Y2Y A;  1ZRN A;  3V6H A;  1XSP A;  1TAM A;  4O9M A;  2ZJA A;  4I2A A;  5ALW A;  4PGX A;  2ZJ5 A;  1N5X A;  5EWF A;  2HBJ A;  4EX6 A;  4AYB F;  5K4L A;  3BZC A;  4MF2 A;  1SGG A;  7ICK A;  4BX9 C;  1ZJN A;  5J2H A;  3HPO A;  2ZIV A;  4UBB A;  2J6S A;  3AQF A;  1N48 A;  2AH5 A;  3CP8 A;  3E2E A;  3UMC A;  3SQI A;  5DG7 A;  1EXN A;  3THV A;  2WTF A;  2KZM A;  9ICI A;  2KK0 A;  3PW4 A;  1Q8K A;  4KLL A;  2V4Q A;  2VA8 A;  2XVT A;  3IHQ B;  1T3Q A;  2QAR B;  3B0Y A;  4I2D A;  5ALP A;  3M9N B;  4ED0 A;  1PVP A;  4RPZ A;  4DWI A;  1RM6 C;  4M0A A;  2VJ5 A;  5CP2 A;  2ISP A;  4MF8 A;  2EAM A;  3K1R B;  1KLN A;  3IP4 B;  3BQT A;  2K4H A;  3WU2 U;  4P0Q B;  2F8K A;  4IS7 A;  4RNM A;  1L7M A;  5KT2 A;  9ICG A;  5ALU A;  4ED7 A;  4ED1 A;  4I2G A;  4NJ8 A;  4R8U A;  8ICI A;  2F1H A;  2KKP A;  4R64 A;  5AIC A;  5AKZ A;  4FZM A;  1X6I A;  5J29 A;  5HML A;  2VA2 A;  2QB0 A;  2KG5 A;  3QE9 Y;  4RQ3 A;  4J9S A;  3PO4 A;  5JUM A;  2B6G A;  2IOF A;  4RPX A;  2B0C A;  2GOL A;  1ECW A;  4MFF A;  1DK3 A;  2UVW A;  4Q43 A;  2C2D A;  1D8Y A;  1FFV A;  4DQR A;  2PMZ C;  1KL9 A;  4QZ9 A;  1CEZ A;  1RYS A;  3L4P A;  3HJE A;  3T5K A;  2KIC A;  3MAB A;  5J0S A;  5III A;  3Q8Q B;  3J81 j;  4QZG A;  2FLN A;  3M1Y A;  1N61 A;  4J03 A;  2ALZ A;  2JEI A;  3RBE A;  4DL2 A;  2IHN A;  2K89 A;  2VKQ A;  3KHG A;  1BPZ A;  4P4P A;  4M9N A;  4R63 A;  4J9K A;  4NLC A;  2KVC A;  3PSF A;  1FFU A;  4F4W A;  1L6N A;  4LVS A;  4DS4 A;  2XC9 A;  2W7O A;  1DXS A;  1SXD A;  5KTQ A;  4DQI A;  2KFN A;  1ZQP A;  2H3Q A;  2W54 A;  5JU5 A;  9ICM A;  3F53 A;  3F2C A;  5ALM A;  3NTU A;  5KFG A;  2NRW A;  3RJG A;  2P66 A;  3BJY A;  2VA3 A;  2FE9 A;  2OCE A;  2AGQ A;  3NS1 A;  4NLZ A;  2HDO A;  1LKY B;  4TUR A;  5J2D A;  1TK8 A;  4A8E A;  3UMB A;  4O3O A;  3OHB A;  2VIX A;  4OJO A;  1C7Y A;  2EAN A;  1RPL A;  4AP9 A;  4KLD A;  1BNO A;  2ZTC A;  2KD1 A;  1B22 A;  4NL9 A;  3BQ0 A;  1ED1 A;  2PI4 A;  3AMZ A;  1B4F A;  3GFK B;  2AU0 A;  1TK5 A;  2FMS A;  1JN3 A;  3AUO A;  1ZQJ A;  4KMU A;  5ALK A;  4C8M A;  3NRZ A;  1UA0 A;  4F71 A;  7ICE A;  1U49 A;  2DGZ A;  3MR2 A;  3PW2 A;  5CR0 A;  1K1Q A;  2B21 A;  5ALV A;  2EQY A;  4XQ8 A;  2F3N A;  2OM6 A;  3H8J A;  8ICA A;  2KJ5 A;  2N1R A;  2XY5 A;  4OD0 A;  3QUC A;  1U4B A;  8ICB A;  3SI8 A;  4DF4 A;  5GTI U;  1O03 A;  5L9X A;  3ETL A;  3ISB A;  7ICP A;  3PNC A;  3N7R C;  4F5O A;  2WF7 A;  3LVW A;  2LPE A;  5KFA A;  4J9R A;  1XS9 D;  3I1Y A;  1ZQO A;  4IRK A;  5DBB A;  5ALR A;  4PHE A;  3G6Y A;  4ECW A;  4BXO A;  5KFF A;  1M6Y A;  2I6X A;  1JX4 A;  2FMP A;  2NO5 A;  4DSE A;  1PK1 B;  2ZG6 A;  5BOL A;  4F2S A;  3M9M B;  1UQV A;  2KKV A;  9ICB A;  3NUQ A;  5EE0 A;  5KFH A;  8ICF A;  2NYV A;  2ZIX A;  3M8S A;  8ICE A;  2OH2 A;  2JR5 A;  5J0T A;  1JMS A;  3NGD A;  4DFP A;  5F3X B;  3RRG A;  5KFT A;  2MRL A;  1JUD A;  4KLG A;  4MHV A;  3SAH A;  1NJW A;  3RJI A;  4Q8E A;  4OJL A;  1N5W A;  4QZC A;  1XNS A;  1S0M A;  4OJ5 A;  2W11 A;  3WKE A;  2E8M A;  4NY8 A;  3ORY A;  8ICG A;  5D4B A;  2KJ8 A;  8ICR A;  3JPO A;  3PR5 B;  4F5N A;  1NK9 A;  9ICQ A;  4BWM A;  5J2B A;  4C8O A;  4Y2T A;  2XCA A;  2HHU A;  2W3S A;  3MDC A;  1SV0 C;  5DGB A;  1GO3 F;  4YR0 A;  1ZQD A;  3LWL A;  2YMQ A;  5DG9 A;  3KBB A;  4I27 A;  2K8C B;  9ICT A;  5ALT A;  1KTQ A;  2HOQ A;  2C28 A;  1AQ6 A;  7ICI A;  2CRX A;  3AL0 B;  2G5I B;  4QZB A;  1NKC A;  3KD3 A;  1TKD A;  4DFD A;  4RT2 A;  2KVS A;  5DBA A;  3M7D A;  3MGH A;  4Z6C A;  2KJ9 A;  3KKA C;  2RRD A;  1FEZ A;  2VAN A;  9ICE A;  5KFB A;  3MR6 A;  5KFQ A;  1U47 A;  3C2M A;  2KZZ A;  1JRP A;  3QEA Z;  4KLU A;  1LVH A;  2MSN A;  2BCR A;  3F5E A;  2PFQ A;  8ICP A;  3WK9 A;  1JI7 A;  5AI0 A;  1QH9 A;  1C20 A;  2KP7 A;  1NZB A;  5KFM A;  5HR6 A;  2V9W A;  4BJQ A;  1XC9 A;  5D46 A;  4DQQ A;  4KTQ A;  5ALE A;  3KOO A;  4O3N A;  1L8O A;  3IDW A;  5KFI A;  1S0N A;  4BGD A;  4Z6F A;  3AQE A;  4GXI A;  2ZIV B;  5GTH U;  3UM9 A;  2EDU A;  5DB9 A;  1Z1V A;  2E3T A;  3PSP A;  1N62 A;  2K8A A;  3ICX A;  2HHV A;  1COK A;  2BGW A;  4DQP A;  4QZE A;  3WK4 A;  3QXG A;  2FMQ A;  3UXO A;  5AI4 A;  4PH5 A;  5J2C A;  3GII A;  1S97 A;  1P7D A;  3TAN A;  2ZIW B;  5B5E U;  3ZDB A;  4OCZ A;  2A1J A;  4DOB A;  2GWS A;  4Y2Q A;  5ALX A;  2K4I A;  3BS5 A;  5AM0 A;  8ICW A;  3PX0 A;  1SWW A;  4PHD A;  4YXM A;  2KHV A;  2WF8 A;  3T5J A;  2Z7J A;  2PKE A;  1L3T A;  2FI1 A;  4EYI B;  2WAQ F;  4CRX A;  4RQ4 A;  3G6X A;  7ICT A;  1KFS A;  1SKR A;  2XIC A;  1J2M A;  4F72 A;  2LYH A;  3A0H U;  2I9G A;  1Z3E B;  2QB0 B;  3H0R B;  2LKY A;  1KRP A;  5KG5 A;  1S8O A;  5KFS A;  3SYZ A;  5HP4 A;  4DL4 A;  3UQ0 A;  2BPF A;  2YML A;  2RP5 A;  1V97 A;  5AI6 A;  4UAW A;  3OSP A;  4KLQ A;  2JMG A;  8ICO A;  4YFK A;  1NK4 A;  5DQG A;  4Y2V A;  2R18 A;  1N63 A;  1QLN A;  7ICN A;  2HVH A;  2Y0S F;  4F92 B;  5KFO A;  4ECZ A;  1H38 A;  2P35 A;  1WG8 A;  2ZUC A;  4EEY A;  3N7S C;  3N7P D;  3RB3 A;  2JGA A;  4GC6 A;  1T7P A;  1NK0 A;  2W9C A;  3A0B U;  2HHT A;  1VLB A;  5KFE A;  1S77 D;  2DBY A;  2FLP A;  3TAD C;  2JEF A;  4DF8 A;  5HHH A;  4ELT A;  2WB1 F;  4DOA A;  4DSK A;  5KFY A;  3AM9 A;  1JAL A;  4KLJ A;  4HYK A;  4UB6 U;  5EWG A;  2ASD A;  5J0U A;  4PPX A;  3GV5 B;  5AM2 A;  7ICF A;  1NK5 A;  2UVV A;  3N97 B;  4M47 A;  2BPC A;  1XSL A;  3PX4 A;  2HHS A;  5KFD A;  2FDR A;  2BDU A;  3SZ2 A;  1Z00 A;  2BKE A;  4YCX A;  4PHP A;  5L1M A;  2MUT B;  3EPI A;  3UXN A;  4C8N A;  4YD2 A;  4TUP A;  2GLE A;  1X9X A;  2HBM A;  5KG7 A;  3EPG A;  1XU4 A;  2ASL A;  4ECV A;  4ZOH C;  2W55 A;  4JMU A;  4DLG A;  4RZR A;  8ICT A;  1IXR A;  4F50 A;  1SL0 A;  5TIS U;  2GO7 A;  1KEJ A;  1NK8 A;  1Z4N A;  1ZQZ A;  2DQN B;  3HIL A;  2YX8 A;  1NKB A;  4M9G A;  2DKX A;  4KN4 A; 
#chains in the Genus database with same CATH homology
 4P0Q A;  4PL2 A;  2ZIU B;  3OPX A;  3D2N A;  3ALR A;  3SAG A;  4O3M A;  2KKP A;  3DEE A;  1YT3 A;  4C0Z A;  2ZIX A;  2F77 X;  5C0Y A;  3N7S C;  3N7P D;  3RF9 A;  2VIX A;  2OYY A;  2JGA A;  2K8B B;  2G0A A;  2CN1 A;  2LYB A;  4OJO A;  3VCB A;  2OH2 A;  4P0P B;  3L3F X;  1ZQ1 C;  2WB1 C;  4FZM A;  2G06 A;  4KX5 A;  4QJF B;  1XO0 A;  2OXO A;  2A3V A;  2ZIU A;  2ZXI A;  3AQE A;  1DRG A;  2ZIV B;  3O0F A;  2E5S A;  5KL8 B;  4CDG A;  3AL0 B;  4OJP A;  2MRL A;  3PSI A;  2HOI A;  3KFU F;  1T94 A;  2MA1 A;  1KBU A;  1PVQ A;  3GU3 A;  3PSP A;  2JH1 A;  4AYB C;  1SZH A;  3H0M B;  3SAH A;  2NV3 A;  2F8L A;  2K8A A;  3ICX A;  2KD1 A;  4U6P A;  2WB1 F;  4GFJ A;  2W04 A;  5HR7 A;  1TAM A;  4PL1 A;  4U7C A;  4OJL A;  1XNS A;  3CRX A;  2K4E A;  4OO1 J;  4OJ5 A;  5T14 A;  2GH1 A;  2GOL A;  1ECW A;  3SAF A;  1ED1 A;  2H3V A;  3E0F A;  4NV0 A;  1MA7 A;  3VC8 A;  1Z19 A;  2HBJ A;  1Z1B A;  4AYB F;  4NWI A;  1P7D A;  2KJ8 A;  3C28 A;  2ZIW B;  2LBO A;  1HIW A;  2KNJ A;  2W03 A;  4FZN A;  4BX9 C;  5KL1 B;  3CYM A;  3F2D A;  3IG5 A;  2ZIW A;  4P0P A;  4KMO B;  2HMX A;  2PMZ C;  2F2A B;  2KHQ A;  2CPR A;  3C29 A;  2K4I A;  2KIC A;  2ZIV A;  3IG8 A;  2DGZ A;  2YB4 A;  1GO3 F;  2JHD A;  2H3F A;  2BDU A;  2WAQ C;  5A0L A;  3RFA A;  3AQF A;  2OM6 A;  3F5A A;  1WUD A;  2KJ5 A;  2N1R A;  4BUG A;  4KX3 A;  2YB1 A;  2XID A;  2H3Z A;  1IIP A;  2K8C B;  2KHV A;  2PMZ F;  3CP8 A;  3HKZ F;  2HBK A;  3LYS A;  2Z7J A;  2ZXH A;  2RHF A;  4ICA A;  2D6F C;  2K89 A;  3NRW A;  2HOQ A;  3SQI A;  2VKQ A;  2WAQ F;  3K1Z A;  3N7R C;  2CRX A;  2G5I B;  3LVW A;  1A0P A;  2E1F A;  2KEY A;  2DF4 B;  1F44 A;  4CRX A;  4FE3 A;  4NLC A;  2KVC A;  3PSF A;  3M7D A;  3T79 A;  2XIC A;  2Q4T A;  3ONN A;  4ACO A;  5CRX A;  1L6N A;  2HBM A;  3HKZ C;  4CGZ A;  2XVT A;  2KJ9 A;  3LVV A;  2G07 A;  2W7O A;  2LYA A;  4QNL A;  3F2B A;  2KIW A;  2HBL A;  2RRD A;  1PVP A;  3D2Q A;  2KV2 A;  4QIW F;  5HR6 A;  3PZP A;  2LHT A;  4WJ3 B;  3H0R B;  2H3Q A;  3M6K A;  1A6S A;  2VJ5 A;  3IN5 A;  1UPH A;  2LKY A;  1CRX A;  1PVR A;  3F53 A;  2G08 A;  4NLB A;  3PST A;  1HEK A;  2XI9 A;  4JMU A;  3F2C A;  1OUQ A;  2Y0S C;  2H3I A;  1URJ A;  2M0N A;  2KOB A;  2F76 X;  3F5E A;  4A8E A;  3IP4 B;  1Q3U A;  2G5H B;  2VJ4 A;  3H0L B;  3GZF A;  4QIW C;  1D8B A;  2K4H A;  2RP5 A;  3M6Z A;  2ZG6 A;  4OJ6 A;  2JMG A;  1NZB A;  4P0Q B;  4FZL A;  3D2S A;  2R18 A;  2ZIX B;  2KKV A;  2G09 A;  3KZX A;  2DQN B;  2JH7 A;  2YX8 A;  4IC9 A;  2Y0S F;  2E1E A;  4BJQ A;  3MGV A;  1Q3V A;  2HOF A;  2W7P A;  3NUQ A;  3SMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...