2LIPA

Pseudomonas lipase open conformation
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The open conformation of a Pseudomonas lipase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords LIPASE
total genus 122
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1996-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lipA00
4Y2YA 1JU4A 1S8OA 1ZD3A 4O08A 3SX4A 3IVMA 1R3DA 3H17A 2EDCA 3G9UA 4X6UA 4C01A 2XQGA 4CCYB 5AM5A 4H7JA 1TIBA 2XUOA 4U2GA 3WK9A 3QH4A 2IIVA 4WDQA 4RE6A 1DWOA 5AKKA 4DLNA 5K5EA 2JGEA 3HACA 4RNCA 1XZEA 4U2DA 4NZZA 2RONA 2IX9A 2JGKA 5ALJA 3FAKA 4P9NA 3FCYA 2HA5A 3G9ZA 3VVMA 2HADA 3FNBA 4EUSA 3DL4A 1XZBA 2YH2A 5J3JA 5D3ZA 1F6WA 2DHEA 2W22A 5JD6A 3PF9A 3DOHA 1ZI6A 1NX9A 5K3FB 5CH8A 1U65A 4W1SA 3ICVA 3STUA 2XUFA 3VVLA 3QYJA 3WL5A 3WL7A 4AB1A 2PPLA 3QPAA 4GLBA 4OSEA 3LLCA 3MGAA 5H3HA 1U8EA 3TGLA 1A8UA 3SWWA 1FFAA 1XKLA 3FSGA 4QDXA 3K9BA 3PF8A 5AIBA 3FVTA 1EHYA 4HS9A 1UOQA 1CUFA 1XFDA 3A2NA 3PFBA 4DIUA 1F0PA 2HRQA 4J0GA 5JAUA 1EDDA 2WJ4A 2GBCA 3I2GA 3LCRA 4ZREA 2DHDA 3OPMA 1FSSA 1LPSA 4OCZA 1ZICA 1DTEA 1G66A 3IUMA 4UBOA 5FRDA 1EK2A 2QOEA 5AK4A 3C6YA 4ZRDA 1YAJA 1UT6A 1JMKC 4A5SA 3I1IA 2G5PA 4K2AA 3H18A 4KE9A 2H9YA 3WK8A 3CN9A 4ROTA 1QFMA 3QVMA 5LZ2A 3DOIA 1GZ7A 4ZV9A 2HA4A 5FLKA 1XZCA 1IZ8A 2D0DA 1USWA 4GBGA 1EA5A 5KWJA 2HL6A 5D7BA 3G0BA 4G8CA 3OOSA 4I4CA 4KRYA 2WILA 4CG1A 5JAHA 4HXGA 1JU3A 3C87A 3LIIA 2CB9A 2I3ZA 4BCDA 4E11A 5ALLA 1CUVA 3DS8A 1ORWA 3QMVA 1CEXA 3WK7A 1SCQA 1TCCA 4KR0A 1VE7A 4WFKA 1JJBA 2QXUA 4FLEA 5IVHA 5AKGA 5ALFA 3T52A 1T2NA 4B85A 1XZAA 5KWIA 3GUUA 4IH1A 1UZAA 4UFPA 1YAHA 3C5VA 4EY6A 5C8XA 4E15A 4KAJA 2QVBA 2C0QA 2O7RA 2R11A 4FKBA 2HU7A 1SCIA 3F8SA 3WQHA 3IUNA 4H35A 4G1FA 2XUQA 1GGVA 1QIKA 2WUGA 2FUKA 3V1KA 2WG1A 2AXEA 3B5EA 2PSFA 3DD5A 2WHPB 4X00A 2EDAA 4WY5A 5A7GA 3O4GA 2H7XA 4J0KA 4C4ZA 1QIIA 1E8MA 3FBWA 2EEPA 3GFFA 2JBWA 5HF5A 3I2HA 4HVTA 1QTIA 3ANSA 3BJMA 1KU0A 1ETHA 1XZHA 4ARAA 2HRRA 3V1MA 2Y1KA 2Z8XA 3FLAA 3QMMA 3I2IA 3OTQA 3B3QA 1YB6A 2X5XA 3I6ZA 2J4FA 1H2XA 1DX6A 4LXIA 1VLQA 3I6MA 5HKBA 5ALOA 5AKYA 1HLGA 2WKWA 1ACJA 4BVKA 4JYPA 2WM2A 3QBJA 4K6HA 3WKBA 4B82A 5ALEA 4AN1A 6YASA 4TVKA 4PF1A 4XWGA 1X2BA 2OAEA 4BAZA 3OG9A 4UBLA 3IA2A 2PSJA 2VEOA 4X7BA 2PUJA 1LBSA 3Q8WA 3NWOA 2XDWA 1BCSA 2IITA 1AUOA 4X93A 2WTNA 2JGIA 3GROA 3GZJA 4S0XA 4BCCA 2XMGA 4PV7A 5K3FA 4MYDA 3QZUA 4CFSA 1CQZA 2PM8A 4RGYA 4DNQA 5AM4A 2FX5A 3A70A 4GDMA 4FNGA 5AKXA 1LPOA 2XMRA 3AIKA 3IUJA 4UHEA 2G4LA 4UBKA 5DNVA 4X91A 1W75A 5DLPA 1B41A 5C7YA 3AIMA 4X95A 1P0PA 2WG2A 1HKHA 4X6XA 1VXOA 1AMNA 2FJPA 4X97A 1CUHA 3W2TA 1A88A 4MJ3A 3WI7A 3G7NA 1K6EA 4UBNA 2QMQA 4UHBA 3O0DA 4MQLA 4QDOA 1KU6A 2BJHA 5AHXA 3K6KA 2OGTA 1EVQA 4X71A 5K3AA 3R3WA 3HC7A 4K6KA 4IH4A 4YASA 1CUJA 3D2AA 4KRXA 4DM7A 3TRDA 1L7QA 4ZXFA 3AJAA 3R40A 4BDTA 5FXMA 1ZGCA 1LPPA 3H2GA 2LIPA 1KEZA 4EY4A 4M0FA 4B84A 2YXPX 3FYUA 1EXWA 4ETWA 4V2IA 2JEYA 4DYHA 3AIOA 3LP5A 3FYUC 2GYVA 4OU4A 4ARBA 4F5ZA 1YR2A 5JARA 2ORYA 3C6XA 4WFIA 3PFCA 3W9BA 1GPKA 3BJRA 3O9MA 3OM8A 1OXMA 5HK8A 3O4JA 2HM7A 3R0VA 2WIFA 4LYDA 1SCKA 3CN7A 5LZ5A 5ALIA 4YK7A 4BBZA 3WK4A 5DYYA 2YASA 2X8BA 3QITA 4CG2A 3R3YA 2OQIA 1EB8A 1QIMA 1CUAA 2VAVA 5LKAA 3PUIA 5AI9A 4QWWA 5SYMA 1CUCA 3DYIA 4QDUA 3DCNA 2XMQA 3IIIA 4U2BA 3WWCA 4PNZA 2AJDA 7YASA 4H18A 4JUIA 3TEJA 5C8VA 2ZYSA 5LIPA 4W63A 2GZSA 4PSCA 2XQIA 4FNMA 4BB0A 1UOPA 1LPAB 3G9TA 2J3QA 1Y37A 2DR0A 3F97A 1MAAA 1QE3A 5HK9A 2WHPA 4EB0A 2C4HA 1WM1A 3BDIA 2G63A 3X3HA 2Z5GA 1LGYA 5ALWA 1DINA 4J0JA 1QONA 2VJCA 4AX4A 4Y9SA 2VTVA 3WLAA 4H7FA 5AOAA 5T4FA 1H2ZA 2D5LA 4AMYA 2JIDA 1LLFA 4L9AA 1QIEA 3GELA 1Y7HA 3M83A 4XX1A 2HA7A 4G9EA 5AKEA 1IUNA 1EI9A 3WK6A 3G0GA 2BUAA 1RWQA 4K5QA 2XUGA 1YCDA 3R41A 5EHQA 3ESCA 2VJAA 1ZIXA 1BS9A 2WUFA 1XQVA 4BRZA 2OPHA 1MJ5A 4F0JA 3VJLA 2GZRA 5JIBA 1K8QA 4AN0A 2QJWA 4PSUA 5HF9A 4ZGBA 1QO7A 1DWQA 2BGNA 2NW6A 3I28A 5LP1A 4AZ3A 5ALRA 1CUZA 4AO7A 3PDCA 4BDSA 2AJCA 5DNWA 2PX6A 5AM1A 1YS1X 3G9XA 4DSAA 3WZLA 1CUIA 3ZI7A 1CIJA 2XUKA 4AO6A 4Q3LA 1DWPA 1R88A 3STTA 3L1IA 4C4XA 4PQEA 1ZD2P 4X6YA 4OYYA 1CR6A 1MX1A 4PO3X 5A62A 3H2KA 5EHZA 4Q05A 3B12A 2H1IA 3PI6A 3WKEA 2QZPA 3BIWA 4OD0A 2V97A 4MQMA 4DMCA 1CVLA 4UHHA 4H0CA 3M82A 4N8SA 1MNQA 1MNAA 2B4KA 1IZ7A 3W04A 5AM2A 2CMFA 1HBJA 5DTIA 4HZGA 3FOBA 2I78A 4PSDA 5F4ZA 3IDAA 4D9JA 1BEEA 4QZVA 3K2IA 5LLSA 3V1LA 4YPVA 4GXNA 2PVSA 5I9IA 3W06A 4OUKX 4Y2PA 2HFKA 1R9MA 5E4TA 4G8DA 5EIAA 1XQXA 3WJ2A 4BAGA 2Z3WA 1XZJA 2JGJA 1YS2X 2DCMA 5HFNA 4U2FA 5IVDA 4IO0A 1MX5A 3O4HA 1MAHA 5ALQA 3F98A 1XQYA 5LKRA 1TAHA 4X94A 3MUOA 4QA9A 1CUWA 3FWHA 4WY8A 1YSCA 2ZYRA 4KE7A 4AQDA 3VKFA 3VISA 5LZ4A 5ALTA 4CIBA 1MU0A 1D07A 4OB8A 3JWEA 5EIHA 1R50A 3HSSA 2VJBA 1P0IA 2XE4A 3WL8A 1GQSA 5FUMA 3STVA 1CUBA 4QLAA 4Y2VA 5CURA 4MEBA 1CFJA 2WUDA 5HF6A 2HU8A 3BE8A 3IBTA 2W6CX 4EZIA 3BL8A 1VKHA 3HEAA 1MT3A 1G42A 1XZGA 3H0CA 1T4MA 3E0XA 3WJ1A 5EI5A 1SFRA 4LHEA 1YA8A 4G4IA 2Z8ZA 2HU5A 1W52X 4PW0A 3WIBA 3W9UA 1CUSA 2B20A 4BVJA 1C4XA 4TPKA 3MUNA 4XIIA 2VAXA 5CT9A 1GKKA 2WHRA 2PU7A 5HQ3B 2C58A 2PSHA 5E2IA 5AJHA 3DNMA 1OCEA 1XZIA 3EF3A 3HLKA 5AP9A 4BE4A 1ZI9A 1GT6A 2QKYA 1QJ4A 3G0CA 1I6WA 3WKCA 1B6GA 4FWBA 3CCCA 2JF0A 1CV2A 5D3KA 2HHAA 4HRXA 4BYMA 3NGMA 5FPQA 1H2YA 5ALDA 5LYYA 3FLEA 1M33A 5ALXA 4FFWA 4W1RA 1Q0RA 3RLIA 1TQHA 1RP1A 5BWBA 2QRUA 3I1YA 2WUEA 2Z3ZA 2Y2UA 3HXKA 3R3VA 5ISMA 4BE9A 4CCYA 3LS2A 2I3DA 3DKKA 2QT9A 4FBLA 2C5GA 1C7IA 1UOOA 2AJBA 3I2JA 3E3AA 3HABA 2AJ8A 1EX9A 2OCIA 1RYYA 4DNPA 3U1TA 1FFCA 2DSNA 5EHNA 4Q82A 2HIHA 1QIJA 4B7ZA 4L3WA 1MPXA 1NU6A 3L1HA 1IUOA 3C45A 4MXDA 4KYVA 4M0EA 2JGMA 5IH7A 3CCBA 2C0PA 2DQYA 4GEGA 1QZ3A 2OXEA 1XKTA 1DQYA 3NUZA 5AK5A 2JGLA 4X92A 1N1MA 4FLFA 3HI4A 3HJUA 3WA6A 3AUKA 1HPLA 1ZGBA 2GBIA 2QUBA 4N8DA 5IVIA 1PFQA 5JASA 5CXUA 2GYWA 4Y7DA 5K3DA 4BRSA 5ALZA 2GBFA 4BVLA 3D5EA 1XRPA 3IUQA 3ZLUA 1HDEA 1Q0ZA 2VA9A 1DU4A 2RI6A 2XUJA 3N0TA 1UFOA 1XZLA 3DLTA 1TK3A 3D7RA 2B9VA 4OPMA 4KE8A 5C8ZA 1F0NA 2XT0A 4X3CA 3I6YA 2ACKA 1LZLA 3V1NA 4GWLA 1CUUA 1TCBA 3WK5A 3WL6A 4H7HA 4BTLA 5CRIA 3KDAA 1GQRA 1LPMA 5ALKA 1QIDA 2BKLA 1E5TA 3SC2A 5AH0A 4OYLA 1IMJA 1QIFA 1X70A 4Y2TA 1R9NA 2CJPA 1XLVA 1MO2A 4KACA 1H23A 3E4DA 3PE6A 1P0MA 4H7IA 5CT4A 4GHWA 2VF2A 3AZOA 1W4LA 4G8BA 4WDRA 1WPXA 3ZV7A 3P2MA 4UHFA 4BTVA 2WIDA 1XROA 2ZJ6A 1LNSA 3YASA 4IHAA 4EY8A 4Q3KA 4AXBA 1N8SA 2O7VA 2HA2A 5BWCA 4DMHA 1VZ3A 3KWFA 4C6HA 5CT8A 2J4CA 2WJ6A 1PV1A 4UFOA 5CH5A 5CBKA 3IULA 1XQWA 1AZWA 5AKHA 4G9GA 4UBJA 3FYTA 5E4JA 5ALNA 4B83A 2WFLA 2WIJA 4IH9A 2ZYIA 2RHTA 4DSZA 2E3JA 4TGLA 3RKSA 3UMJA 4FDMA 5HFAA 5ALVA 4OB6A 3AINA 3IURA 4N5HX 1U2EA 5JADA 1CPYA 1FFDA 3V48A 4W1PA 3ZLVA 1J2EA 5DWDA 3O4IA 5DYTA 2XMCA 1EDEA 5AKZA 1LBTA 4XVCA 3KD2A 1QO9A 1BEZA 4QDTA 2V9ZA 4J3JA 3EQ7A 1DX4A 4C89A 3KOOA 4UHCA 3UUFA 4Q1VA 4C88A 5FKJA 2WG0A 1QIHA 2OQVA 1CRLA 2CKMA 2DFPA 4CIAA 5FPPA 2C7BA 4DMKA 3AZPA 1K5PA 4EA6A 1W1IA 4K6GA 3EBLA 3D59A 3ESAA 1CUGA 3G02A 1XRLA 3H1AA 2YYSA 4B0PA 1L7AA 5I7UA 2PBLA 3GBSA 5IVKA 4GECA 3STXA 4AMZA 4BCBA 2O2GA 2VSQA 4ZI5A 1DQZA 4KE6A 1WHSA 1WPRA 4H7EA 4OB7A 1XRNA 1P0QA 1Z68A 1R1DA 3H2IA 3WWDA 4NMWA 3TJMA 1EINA 3WYDA 1VE6A 5AI6A 3AILA 3FVRA 5ALPA 3FSGD 1THGA 4AZ0A 2XUIA 5DTJA 3C43A 5A7FA 1BN7A 1W6RA 1N5RA 4JYMA 3R3UA 5FP0A 4GW3A 4NVRA 2RHWA 3ZWQA 5E4YA 4OU5A 3I2KA 3D4LA 3QPCA 2ZVDA 2ROQA 4J0IA 3G0IA 2PL5A 4H7DA 2XQKA 2CUTA 4G4GA 4CI9A 5EHXA 4GI1A 3DJYA 3WZMA 1EK1A 1WCYA 2QTBA 3C6ZA 2B61A 3OC0A 1DT5A 1FFBA 2OLEA 3KWJA 4Y2JA 2WFLB 3D3NA 1G5FA 4J0CA 3O9VA 4P92A 1XLWA 2VATA 3F96A 4MWTA 1UKCA 4MEAA 3RK4A 1LPNA 2UZ0A 1A7UA 2OCKA 1EB9A 4A23A 1J06A 5CT5A 3AFIA 4N8EA 1CUYA 1VOTA 4RPCA 3MVEA 5AICA 2WU4A 2XQJA 3KXPA 4NS4A 4YX9A 4KEAA 1UK6A 1K63A 4FTWA 2HDWA 4BAUA 5IKXA 4P08A 5DYWA 2ZJ7A 5K3CA 3WIOA 4F60A 3QMWA 3EQ8A 4QDZA 1JJFA 3D2CA 1AGYA 5EFZA 2RIPA 1MTZA 5T4HA 1QGED 3H19A 5AI8A 4BC0A 1HL7A 4X85A 1EVEA 2HA0A 3PUHA 3BWXA 5BV7A 4DNOA 1TRHA 1QFSA 3OURA 4W1QA 5K3EA 2ZJFA 1IVYA 1SC9A 2BAGA 1Y7IA 1R4ZA 1AURA 2H7CA 3H04A 1XRMA 1EDBA 1Q84A 4E46A 5CTAA 5AM3A 1GKLA 3V9AA 5AKJA 5EGNA 2BCEA 1K4YA 1YB7A 2DHCA 3DKRA 4EHBA 4RE5A 3DDUA 2R8BA 1GXSA 2PSDA 5AM0A 4B0OA 3C5WP 5HQ3A 1JFRA 1SOMA 3I2FA 5FV4A 3C8DA 1CUXA 3G0DA 5I8PA 1XZDA 5JANA 3BF7A 3ESBA 4DGQA 2XLBA 3BXPA 1BCRA 2AJLI 2QJRA 3PICA 4LIPD 4WJLA 1TCAA 5SYNA 1VXRA 4L72A 2WLSA 3T4UA 3A2LA 4HRYA 4L0CA 2XMDA 4CCWA 3AZQA 4WFJA 2ES4A 4UUQA 1XRRA 5JATA 1EH5A 2XQFA 1ZD5A 1WB5A 5HKAA 3QM1A 4ZWNA 2FJ0A 2BGRA 2V98A 4B9AA 4AO8A 1WOMA 3HRHA 5HF8A 4MWSA 5A2GA 4BZWA 1BN6A 3WWEA 1QLWA 4QLOA 1ODTC 1ACLA 4HXFB 5BOVA 4UPDA 4Y2UA 4J0DA 3HYSA 3ESDA 1LPBB 1C7JA 4BZZA 2WTMA 4FOLA 1Q83A 1YASA 4FMPA 3S2ZA 4B9EA 3NOXA 4B80A 1UK7A 2ONCA 3ED1A 2WHQA 5AI4A 3FYUB 1HQDA 4J7AA 4BC1A 2QR5A 2OG1A 5AOBA 3BDVA 1ZOIA 2BFNA 1WB6A 5LZ7A 1A8SA 4U2CA 3IB3A 4IQ4A 3CXUA 4LXGA 2PU5A 5DJ5A 1YA4A 4UBIA 3WKAA 1JI3A 1XRQA 1XZFA 1X2EA 3HZOA 4DNFA 5JZSA 2HA3A 1MX9A 5T4EA 4G5XA 1UWCA 1NU8A 3H1BA 1VA5A 1IUPA 4FHZA 3C70A 3VDXA 4B81A 1JKMA 5ALYA 5JD5A 1AC5A 4H77A 2OGZA 4H7KA 5AO9A 3STWA 4INZA 3W05A 1ZJ5A 4ITVA 1PJAA 1E66A 3M3DA 5DNUA 3VJMA 1UK8A 5JD4A 5A7HA 1ZIYA 4Y2RA 3VJKA 1UK9A 2WFMA 1JT2A 1VJ5A 4UBMA 1BRTA 2H7YA 4C4YA 2PKYX 5HCUA 2O2IA 3EIOA 1DT3A 1GPLA 4QEKA 4F21A 3ICWA 3C8HA 5ALSA 3WYNA 1VA4A 2OGSA 3R3XA 1E8DA 1MN6A 2XLCA 2XMZA 4EBBA 1GPNA 1CUEA 2O2HA 3F9CA 3KSRA 5YASA 4QE3A 4J0HA 3BF8A 2JGFA 1UKBA 4U2EA 1A8QA 4JNCA 5JAPA 4QNNA 1WB4A 3O95A 2ZSIA 2OCGA 2QUAA 1N5MA 1VZ2A 5AI5A 2BUCA 4Y2XA 3A6ZA 2VT6A 4EY5A 4C87A 1UXOA 2VJDA 4B6GA 5LZ8A 5A71A 2P8SA 1QIGA 3A2MA 1BE0A 4Q3OA 4LYEA 1JMYA 4HAIA 4QWMA 3DEAA 5FOQA 2C5FA 1ZI8A 3STYA 4DTCA 3F67A 2HFJA 5LZ9A 3VXKA 3RM3A 4EY7A 4LKOA 2RGUA 4FLMA 2ACEA 5JYCA 2CBGA 1OILA 5K3BA 2BUBA 3WA7A 2PSEA 1J07A 5JZ9A 4UFNA 3WWPA 2J3DA 3WMRA 3E1GA 3SK0A 4Q34A 2WIKA 5KREA 4MYSA 2QM0A 2QXTA 3ANTA 2K2QB 4HXEB 2VQ6A 5FDFA 2GBGA 4I3FA 5AIAA 3Q0TA 5JZBA 5ALHA 4KAAA 3DQZA 2XMBA 2GYUA 2WSLA 1CQWA 4Y2SA 2XUHA 4Z49A 1BROA 1TKRA 3JYHA 3RARA 1LZKA 2ZYHA 4WCVA 3QPDA 5CH3A 5JALA 3BIXA 1AX9A 4UHDA 1O6FA 3C6BA 3L1JA 5AKLA 5ALUA 4P93A 3LIPA 5A6VA 4ZV7A 2WJ3A 3R3ZA 1J1IA 3D2BA 3UUEA 2OCLA 4J03A 4A16A 4JEIA 5ALMA 1W76A 3JW8A 2DQZA 4KJXA 2PUHA 3D0KA 1WHTA 5CMLA 1ISPA 2VT7A 5CXXA 3ILSA 1AQLA 3WWOA 1XLUA 4Y2QA 3EQ9A 2ECFA 2ZSHA 1H2WA 2X76A 4BP9A 1O6GA 2I03A 2CEKA 2XB6A 3DL7A 5JAOA 5ALGA 2CZQA 1QTRA 2RAUA 5ESRA 5AK3A 4HTAA 4G4JA 1ODCA 5AOCA 1ORVA 2WFZA 3H2JA 3S8YA 5AK6A 2WU3A 4BATA 5AI0A 3H2HA 1XZKA 1E8NA 1FJ2A 1AKNA 1JJIA 5CW2A 4E14A 3ZPXA 1THTA 1UKAA 1H22A 2Q0XA 3FCXA 5HZGA 1CUDA 4XJVA 4FFVA 1L7RA 1BU8A 1CLEA 1ODSA 1FFEA 2XMSA 1U4NA 4JH0A 2Y6VA 3GA7A 1E89A 3ZLTA 3DYVA 2XI4A 2WIGA 4I19A 3N2ZB 5KBYA 4M0MA 2XUAA 2XUDA 2QS9A 5D6OA 2XUPA 2V96A 5EIEA 4X90A 4DMFA 1QOZA 2OAGA 1F8UA 2Y2VA 4FBMA 1ZJ4A 4LXHA 1G4HA 5C81A 1XZMA 5AKIA 3FLBA 2HA6A 3M81A 5CT6A 1E3QA 2WQZA 2Y6UA 3U0VA 4KAFA 3WKDA 2G5TA 1ZD4A 2JEZA 5T4BA 4BP8A 3G8YA 4W9RA 4N5IX 4CG3A
chains in the Genus database with same CATH superfamily
2PA0A 1B8NA 1Z0ZA 3LXRA 1ZD3A 3BWDD 1J6UA 4O08A 5HDBB 3SX4A 1HFWA 3T1QA 2GETA 4UAVA 4XSHA 4OJQA 1DKQA 4L4UA 1WV0A 4X8HA 1JQJC 4IIJF 5EMHA 2Y66A 4LRXA 3BB1A 1ZH0A 3M6MD 4R2JA 1TK9A 2VYFA 3N2KA 1ZN2A 1B3RA 1OYVA 4Q4LA 3SY8A 5CEFA 3PXDA 4R2XA 3RHZA 5CDUA 4LJSA 4KQ2A 3NWJA 2BFCA 1YCFA 3WIVA 1TIBA 4R0NA 2E1RA 4D41A 1YDGA 2B21A 5FWNA 2CXNA 4CM1A 4ZDWA 2JI4A 3EEYA 3WK9A 3CUVA 4Q16A 1H1TA 3GZNB 5EOVA 1GNLA 1NT2A 3V1TC 2VHTA 3RYFB 3VNRA 2MSWA 4PYKA 5M2QA 3EG9A 2XNHA 4UMEA 5GMOA 1NJSA 2P8JA 2EFEB 2HPAA 1RVDA 3R0QA 4TLMB 3NHFA 4DLLA 5JSUA 2RONA 2JGKA 3ZHZA 1FQKA 1V2HE 2BKAA 4TKVA 3IX7A 2N0SA 2PL1A 2QRJA 5GZ1A 1NATA 2VAWA 3FHJA 1WXDA 3ECSA 1I1QB 3K0FA 3TG2A 4N48A 5A4DA 1HG0A 4NCNA 2ZOSA 4PVCA 3AQ4A 4ITRC 3NOOA 2G8NA 4R31A 2Z04A 1FY2A 1FU8A 2IVZA 4KFTA 1XZBA 2WP8J 2VQEB 1H6BA 5D3ZA 2FCAA 2CY0A 3PI7A 1NV8A 1SB9A 4GPAA 1B7GO 1NONA 4NH0A 4B4DA 4UTPA 4YTEA 5HMLA 3SXPA 1WJGA 2IDKA 2RHCA 1DBWA 3T61A 2BSAA 2C82A 2GJKA 3K94A 5TEVA 1FLNA 3NRJA 2RC5A 4GYYA 4UZEA 4W1SA 3THXA 3O2QB 4Y1GA 3ICVA 5KWVA 3TNLA 4J2TA 4BQOA 2XUFA 4XPZA 4Z1MA 3RDPA 2W8BB 2UZIR 2DWUA 3WL5A 3R9XB 3WL7A 4UNIA 4ZAGA 1ESEA 2OHGA 1JR2A 1RHMA 4AB1A 1D2EA 1VL2A 2PUTA 4GLBA 4OSEA 4QU8A 4C07A 4FX2A 1E4YA 1XTSA 3ZU6A 4DCOA 4US1R 3C6MA 3EVBA 3RT7A 4PPQA 3U31A 2FOLA 1A8UA 4ZT5A 4IXDA 1PHRA 1R5NA 4URFA 3HLYA 4PZEA 4KXLA 4IP0A 4JI6B 2DX7A 1YJ5A 1E2HA 2AWOA 1Y4SA 1NXTA 1VKZA 2VK4A 2B1GA 4QDXA 3X0DA 1AN0A 3FLMA 4US2R 3K9BA 1L7DA 1N0WA 1OBVA 2XOKD 2G76A 2VNAA 3GH1A 3KHKA 1WY7A 3OX2A 3FVTA 1U0JA 4TN5A 5EA2A 2GA8A 5IT5A 2HWKA 3N2GA 3BPSA 4XCQA 5MGBA 1KO5A 4DIUA 2JAWA 3A2NA 1FNDA 2HRQA 2OXFA 5C8YF 5IPFA 2CMDA 3GGJA 4IIXA 4J0GA 4R7TA 2DLDA 5ADWA 1YFKA 2PR7A 4I8IA 4D6XA 1E61A 2P6MA 3ODPA 2O0KA 3B36A 3Q9SA 3QWFA 4D5EA 3UVEA 3QBEA 4U9HS 1OC4A 5E6RA 3WYEA 1LPSA 4NCBA 3HM9A 5EJ7A 3FNRA 5FRDA 2IPNA 2XDYA 1Z29A 2BFFA 2G1UA 2JDID 3OEHD 4IOLA 2QD1A 4V3BA 1E1MA 5AK4A 5DBOA 5I7FA 4MQEB 1UT6A 1ORHA 3IT3A 2JJ1D 3LWZA 5KAMA 3CWQA 3IHTA 5HJ5A 2I0FA 3M1AA 4P86A 4H17A 4WWHA 1N6PA 4YJ2F 3L0IB 3MWEB 3NTXA 2G5PA 1BWSA 4ND8A 4JB3A 4PIVA 4EITA 4Q39A 4F3TA 1TYEB 5H1YA 3VR3A 4X54A 3U3ZA 2JLUA 2CHFA 3TKLA 1Z8HA 3KR9A 2UUCB 3IT2A 2B4YA 5KHLB 5LZ2A 1GZ7A 1QYVA 4NCIA 1G21B 2V5AA 1IZ8A 3CA8A 3ABSB 1DAGA 2BEKA 2PWBA 3JRXA 4GVXA 1Z7WA 4ZDJA 2CL5A 3HVIA 3QVJA 1ZR2A 1T3SA 5TQ2B 3TSYA 4EK9A 3QOYA 1USWA 3VR6D 5CEEA 1O0CA 1EA5A 2C3YA 3MOIA 4DHEA 5C52B 2OLKA 2C5EA 1Z6PA 2CZGA 3JQ9C 5CNKA 3EJ6A 3RSFA 1ZH6A 6GPBA 3W90A 2NQTA 1UZUA 3KQVA 3VPSA 4BN4A 1ORIA 3FGNA 4YRDA 4B3FX 2WILA 1P8JA 5K3OA 2OORC 2WHXA 1K06A 2WWGA 3OSUA 4CG1A 3TG8A 3OUUA 1N2SA 1SU8A 4WGFA 2OHOA 3BSSA 3LDFA 2GM4A 4XD2A 3SYTA 2G71A 1DCMA 4ML3A 3VAAA 1MB3A 3DE1X 4X3OA 3WZ2A 4YLYA 2BTOA 2YHSA 3LIIA 3QLEA 1KI8A 4OIFA 4ZK2A 3PNYA 3S1AA 5E8RA 1DAIA 5L9AA 4IQFA 1WQ4A 4COKA 5A5EA 3P9SA 1WZNA 3H86A 3GAZA 1Q2UA 4GMHA 3KPVA 1T3LA 3ML1A 3TLKA 5AXBA 4AC9A 1RCUA 4MV8A 1LDYA 1IQRA 1TAGA 3PCRB 4TLAA 3CVJA 1NNI1 4CWAA 1Y7PA 1AKEA 3OCJA 1VE7A 1OKKA 4IRMA 2DBZA 2O4CA 1YHYA 5A9RA 1LSOA 3AMVA 3P4UA 3RV4A 4AJEA 3RS7A 4ND7A 3KYIB 1GPBA 3KM0A 4FHGA 4HDNB 3KQHA 2ZBFA 1PR1A 3ER9A 1FDTA 1GV0A 2QXUA 5GONB 3HKDB 1OPRA 3VSBA 4NONA 1VI5A 1L0BA 1LLDA 2V8BA 3IV7A 5FFFA 2RIRA 3T52A 5GTDA 4XGIA 3TOVA 3O3CA 1KZ7B 3E6AA 3TLJA 2VT2A 2BL4A 1RWVA 3N58A 3U4GA 3RV3A 2FGKA 4L4YA 4ZTZB 2GEJA 1WXGA 1B0ZA 4M9SA 4JI3B 4L15A 3K4QA 1YAHA 2RMKA 3D02A 3C5VA 1IY0A 1N3BA 1P33A 4BX9A 4EY6A 3L9WA 4E3WA 3TX6A 2ZUDA 3ZK7A 1FSFA 2PT9A 3H1PA 2AT1A 3BSWA 4B4VA 3IDSA 3WB9A 1CQXA 3OUTA 1KQFA 1NVVR 4N9QA 1UADA 5KU1A 3G0HA 3UWSA 5DBEX 4RWZA 1FMLA 1NFFA 2IPLA 1BYUA 2I62A 3C4VA 1V1RA 1P3DA 4EF6A 1G4AE 2XIJA 5FOTA 4HWOA 1XWWA 1D1TA 4Y3UA 1QP8A 3FFTA 4G1FA 5FI3A 2XUQA 4MVWA 1E5QA 1D0IA 4TQAA 2DERA 4FSXA 1PK7A 1TUGA 3H42B 1W59A 2PZAA 2X1MA 1D04A 1EE9A 4TUYA 5IT4A 3O8BA 1GAJA 1W8IA 2XCSB 2C7OA 1XTBA 4KMMA 4MS4B 1WWKA 4TKMA 4UU1A 2NXEA 5CVCA 2H2HA 1P1BA 1ULZA 4HB2A 4MDHA 3KTDA 3T7RA 2OC4A 2WHPB 3TRHA 1N3LA 3WYCA 3PV0A 1KYXA 1SWVA 2EDAA 4QJBA 1TL7C 1A9TA 2H7XA 2DPHA 2R84A 4J0KA 5E9AA 3E03A 3TTSA 1IB6A 3LI2A 2AG0A 1QIIA 1OTYA 5DN6D 2AB0A 3JTMA 4TKUA 3PCXA 4JBXA 2J67A 3MBKA 2EEPA 3GFFA 3DBLB 1ULAA 5KOHA 1ZNYA 4DXDA 4OM7A 5HF5A 4HSEA 4JC0A 1EA7A 4N3NA 2JATA 1QP4A 3L8EA 1PT6A 1T3GA 4M55A 3UAVA 4UOZA 5K0CA 5KNBA 2YVKA 3AO0B 2KBEA 1DRUA 3BJMA 1J39A 5EZ5A 4OQEA 3GJZA 3NTVA 1ZUNA 3P9PA 3JYNA 5FBZA 4RF2A 4KR2A 1D2MA 1WEKA 4V39A 4IHJA 2Y1KA 2R79A 5ICFA 1E99A 3W6UA 1KERA 4JXZA 4BQPA 2J85A 4M60A 3KTOA 3RFVA 3I2IA 3DM9B 3OTQA 1VKOA 3LNCA 4JI8B 1IZYA 4GRAA 1XQ6A 3BWYA 3R6LA 1I6KA 2PLRA 3DMYA 3VYWA 3R4CA 1QH8A 4LTNA 1YJ8A 3AY3A 4UCFA 3ORFA 5FNZA 3ZUGA 1AH2A 5A5DA 3VU9B 2J4FA 1RM0A 3K6JA 1YF3A 2V8OA 1U5BA 2FGJA 3WFIA 5ALOA 5AKYA 3UMGA 3GJSA 1TF5A 2B3TA 2QV0A 1E6MA 1HE5A 5EKXA 5JE8A 4K9DA 3DXFA 5KOJB 1G5IA 4PWZA 2XADA 3PPIA 4RVHA 1DAHA 1K75A 5BSRA 3GLIE 1ETUA 4IJUA 1L5QA 1MFZA 3PU6A 3VPGA 3VZDA 2LTAA 3NKVA 3NZEA 4PRKA 4C7MA 5DEOA 2HPVA 1YUNA 4YWJA 3VAZA 2FSVC 4TMWA 4R81A 1ODFA 2XB9A 1LCIA 2C57A 3VNSA 4OFZA 1UZMA 5HKKA 4PF1A 1KQ3A 1ECLA 3ITEA 4EUHA 1KEEA 1D7AA 2OAEA 3F6RA 5AJTA 3NEAA 1O95C 1YCGA 3E22B 4UBLA 5CG2A 3T7DA 1JQBA 3IA2A 1TE2A 2X0IA 3DPIA 3EMDA 3LUAA 3V8NA 4CCSA 1O96B 3DO8A 3B3AA 1TQ2A 1UP6A 3OCWA 4ND3A 4OP1A 4DUPA 1CQJB 2PUJA 2O8CA 5TMDA 1B0AA 5JCJA 4UVIA 1B1CA 3G88A 3JRWA 2ZSJA 1FEZA 3N70A 4UVHA 4ZVVA 2XDWA 5TVGA 2AH5A 1AUOA 3IMKA 1S3SA 4JJGA 2WTNA 1Z4IA 3AFMA 3QUQA 1EDOA 4X93A 4BFWA 4E2FA 1J8DA 1TVMA 2I87A 3D4BA 4QJ4A 1S9HA 4RFLA 5IS2A 2XMGA 1XVUA 4HATA 4ZC8A 2WKQA 4TWIA 4BBJA 1Z16A 2V74B 2OZLB 2VNSA 3W7AA 1YO6A 4DREA 2D54A 3FWYA 2WINI 2I34A 5K3FA 3AESA 3F7TA 3TZEA 4FFBB 2NIPA 4YAKA 1VIYA 4OQZA 4RC9A 4LGYA 4CFSA 2YN0A 1PE0A 1VGVA 1L1EA 3SMVA 1DELA 1G21E 1GYRA 4DQ0A 2UVPB 3LLVA 4KXXA 2GUGA 3THXB 1B0UA 4PQRA 1CRQA 4MCIA 1C41A 5TF0A 1T9AA 3ZV5A 5CA0A 5HXAA 2DUJA 2FX5A 3C1AA 1H1LB 2R85A 4RORA 1Z28A 4H9GA 5KI6A 4U8HA 4CIWA 3QGMA 3R9XA 3D6VA 1D0VA 2XMRA 3KOXA 1L5KA 3AIKA 1FP4A 4AZSA 1UFVA 3O26A 3PZBA 3FTFA 3ZD8A 1A98A 5EHGA 1IXKA 1P4RA 1YE5A 2IYYA 4GRDA 5DNVA 2OHXA 3UATA 4EW1A 2MYTA 5AW6A 1W75A 4LF9B 5K3SA 1TW3A 1XKXA 2IW3A 3CX6A 2R1UA 2Z3VA 4LOLA 3C6QA 4P22A 5KUTA 1AHPA 4D99A 2WG2A 2VDKB 4DLVA 3FPCA 2ZRJA 4UUOA 1G5HA 4D9IA 4YRKA 4FBGA 2IXBA 4YMUA 1Z7EA 5ESWA 3A1EA 4B76A 5E3IA 5ECWA 1PUJA 1R5OA 2H18A 1PW7A 1CUHA 3ZHRA 1E63A 4TRMA 3W2TA 1A88A 3ORRA 3I3OA 4K81B 2QDXA 4AULA 3G7NA 2VHCA 3FSRA 4FVTA 2G25A 3A4YA 2HDOA 4UBNA 3NH6A 4MPJA 3K35A 2VOJA 3V3TA 1UZNA 4UHBA 3AYXB 3KQKA 1KU6A 1SKUA 4RL4A 3TBFA 3T7TA 3C7AA 4FLMA 3OLQA 4IIJB 3TSCA 5K3AA 3R3WA 1YBAA 3I9LA 4ZZ2A 5KTMA 3HC7A 2JLZA 5J47A 1N57A 4MVJG 5LJLA 2XWBF 3ASUA 3BERA 3JD2A 2F67A 4FEGA 4D57A 4KGVA 4WLVA 3UHPA 2REXB 1DRWA 1XU4A 3Q88A 4NAHA 4DCUA 5CB6A 5D86A 3D2AA 4FJ2A 1AKQA 2BZSA 2J6HA 4TL7A 5CM9C 1LVUA 5IBQA 4CDGA 3F4BA 2CCGA 2CUZA 3CLUC 4CKEA 1DVRA 2X2OA 4JKOA 5COAA 3U9TA 3OZRA 1KIAA 2VDQB 1N2CE 3J7TA 2MYPA 2SKCA 4QUJA 4BFYA 1S1MA 3GNSA 1Z8FA 4P2GA 1P81A 3FY4A 4NCXA 3CZRA 4GUAA 2P9QA 4C6RA 3GGOA 2BR4A 3H2GA 5JNVA 2CXPA 2FMKA 3NDRA 2LIPA 4QC2A 1KEZA 3IAFA 3RD5A 3H6GA 3KWMA 4H16A 2W2LD 3FDFA 3SC2B 4P4UA 4D9FA 1OAOC 4P31A 3SZMA 1S8AA 2Y1GA 3FR8A 4LQ4A 4P81A 4R7GA 3IAM1 4HLCA 3UPUA 2CVOA 3ISTA 3OFKA 1NNUA 3BHMA 4V2IA 4BZPA 3I6QA 2VR1A 3GNTA 2YZKA 3KD3A 5DRYA 3AIOA 4EQ6A 1G8PA 1Z4JA 5LMZA 3FYUC 4RM2A 2P5TB 3U1BA 5C34B 4BS9A 3KQNA 4QYMA 2GYVA 3D6FA 1Y42X 4MUNA 4NY1A 4X62B 1TVKB 1YR2A 3H83A 1IN8A 1ENOA 3EGDB 4P36A 5JARA 2O3SA 1KVTA 4WFIA 1V16B 5JDIA 2GK6A 3O91A 4I4TA 1Q0QA 1FB5A 2AR9A 2N9UA 1PUIA 3RC2A 2QY6A 1Z37A 2XJ9A 3RI3A 3F8TA 3IDZA 4GD3Q 1E2MA 5HM8A 1BKSB 4MOWA 2KE5A 3Q7TA 4O4IA 1F9AA 4GMXA 3BJRA 3A1SA 4ZCIA 3O9MA 1E2PA 1EPUA 3A14A 4AT1A 5JQGF 3O3NB 4A27A 4XJTA 1BFKA 2X7JA 1QYXA 2H1OA 5HK8A 3DAHA 1LA2A 4PLWA 3LT4A 2DR2A 1ONPA 5KO2A 3QRWA 3UF0A 3LYHA 1CY6A 1EUDA 1MVLA 1PN3A 4NARA 1DTSA 1MA0A 8OHMA 2WIFA 3IBFA 4GQAA 2QUJA 2WR8A 1T9GR 2CV2A 1Y8AA 2V0NA 3CN7A 3F5MA 5ALIA 5KX5A 4YK7A 3OZXA 1EFHA 4BBZA 1K8YB 1ZK3A 2XR1A 5DYYA 4RZ2A 4MV0A 2NUAB 4PEVA 1UDBA 4G6ZA 2WAOA 4M88A 3MCVA 1G63A 1I3MA 2OHVA 4A0SA 3S81A 4CG2A 4LFBB 4RZIA 3L0PA 1MZVA 1BE6A 3KV1A 3QNWA 4PYQA 3PFFA 4QQKA 3WNBA 5B3JC 4F7WA 4RW0A 1I2AA 2QA5A 2ECPA 5HILA 1N6LA 5FJIA 5T6BA 4CPDA 2CB0A 4Z9BA 2JHFA 2V58A 3I4FA 2O4UX 4P5PA 4ZOLB 3K1YA 3K16A 2IHYA 4G1EB 2C54A 1ZOOA 4NPCA 2G5CA 3DCIA 3G23A 3NWEA 2BGKA 4UQLA 1V0JA 3PLAE 4EJMA 1A5ZA 1KH1A 1ZR4A 3DCNA 3ASVA 1PS8A 1LBHA 1W0JA 1WETA 3C98A 2AX4A 3NX4A 2IU6A 1R0RE 2B1RA 1R5BA 1DKOA 5BOSA 3IALA 1JVNA 1V7CA 2AJDA 2Z1NA 1QX4A 1E3WA 3QKWA 4MB2A 3TEJA 4ZYTA 3DCYA 2IP1A 3P1JA 1RWPA 1G9SA 4YUYA 3LK6A 2V54A 4ZU6X 1GNVA 3G2NA 5LIPA 4B46A 2WSMA 3IQZA 3T5CA 4BFTA 3WGVA 2QUHA 2Y4NA 5HQJA 4QFCA 1XK6A 1U9CA 4KO3S 5IT0A 2RGEA 2BZ0A 2Z8YA 2XQIA 4TUYB 3A36A 5JQWA 4KV7A 3EGXA 4HTFB 1I2DA 1N5KA 3DR5A 4CNBA 1Z4OA 4ALJA 2PFGA 3F97A 3QUAA 4HNUA 5ELXA 1ADYA 1LTHR 2QZSA 3S2EA 4DA6A 4YJ2A 3GVHA 2WHPA 1XLTC 2XCQA 3AR7A 1HOXA 1ZK2A 2PPVA 3CUSA 1IBCA 3DOFA 3FVQA 3SJCA 3UB4A 3WICA 1WM1A 5FQNA 1CE8A 5HS6A 4CLOB 1YONA 4ZU1X 1GRRA 3N2KB 4WNAA 2E6UX 4HKTA 1GUDA 1DJPA 2SNIE 3QJYA 1GSHA 1T8YA 1FNMA 3DFKA 3NT2A 1G1AA 5FOXA 5KTRA 5C8YA 1QONA 1U6JA 2V7EA 4AX4A 3RB8A 4PAGA 4QELA 4X63A 3ND7A 5AXDA 4IY1A 5HIKA 4H7FA 4MUXA 5AOAA 4D3YA 1NPTO 4YECA 4JT2A 3NEJA 4AMYA 1ZUNB 5CVEA 3HXOA 1M73E 3DMNA 4L9AA 4LWOA 4YT4A 2Z4SA 1Y7HA 3M83A 5FA5A 4F1WA 1UBJS 2FR8A 4UE2A 3HUDA 3CIOA 3VNVA 1Q92A 2ZYGA 3RVDA 4CXMA 4AY6A 3IC5A 3IP5A 5AVTA 1X1TA 3DAYA 2GD1O 4GP7A 3EZ9A 4GAEA 3JYLA 2ERXA 1UBHS 3CNNA 5FADA 5TQVA 4BO8A 3FNQA 1PJSA 1KE1A 2AEEA 3B1VA 4RY8A 1MJGM 4PG4A 1E98A 1AXRA 4R2LA 1YCDA 4J75A 2VDWA 1D3AA 4BJ5A 2GM9A 2AA3A 4CT0A 1ZC3A 2VJAA 4CYMA 4G0NA 3VU9A 4YMIA 4F5YA 3AUSA 1VE5A 3Q4GA 2ATXA 2X6TA 1ZIXA 5B6JA 3RAGA 4E7PA 4Q1BA 4TROA 2NZWA 3BX1A 1M2OB 3A4LA 3PUXA 5BYJA 2GD6A 4BRZA 4PC3A 5FOWA 5EMNA 1UXKA 3DXXA 2ODAA 1DADA 1N5DA 2I6QA 3CMMA 3P32A 1A8IA 2ZDQA 1N9GB 5H4HA 3VJLA 2GZRA 1WHSB 1MA3A 2G07A 3H4IA 3QUCA 4NHEA 3VR4A 4BEJA 4F46A 3O8DA 4OXKA 1L4UA 4AN0A 3FYCA 4FINA 1I5OA 2XXAB 4EG6A 3OIDA 3W3AH 4LC0A 2OO5C 1D1SA 2NV0A 3PWKA 4PSUA 4YYZA 5A3SA 1HT1E 2W2MA 1ZIDA 2QQ5A 4XX0B 1I14A 1PVVA 1TU0A 3A1UA 3MWDA 2NW6A 3X2SA 1TEZA 1GKYA 1CU1A 3HYLA 4CM8B 4QXAA 4A91A 4RIHA 3WJAA 3NHRA 5DCYA 4OKIA 3LQYA 2AJCA 2PMCA 2BFOA 5AM1A 4K6OA 4OOEA 3TDKA 3OMLA 4TL9A 4G63A 1CIJA 4IXTA 3CTMA 1QG2A 3BMQB 4Q3LA 1XCOA 1WVIA 1FSPA 1DC7A 3HHEA 3STTA 2QBYB 1B93A 2PTHA 1DE0A 2NAPA 4Z1MD 3L1IA 2WFAA 3JASB 3ABIA 1OX4A 1OXUA 2IHTA 2FDRA 3DP7A 4NNPA 5PNTA 3VU8A 1QQAA 3OD1A 4X6YA 2JAQA 2P2LA 4LHYA 3NALA 1ONOA 4MGIR 4OXYA 4YRAA 1EBBA 1JDPA 1MX1A 1RMYA 3BTSA 3E9NA 3MMXA 4G5GA 3VM6A 4E7OA 3PI6A 2Y1OA 3WGKA 3WKEA 4D5GA 4YJFB 4CEHA 2OV1A 3NIWA 1NT4A 3ANNA 5A6SA 1IOWA 2QZPA 4U0KA 3BA6A 2A8YA 4KN6A 4M83A 3EEIA 4L4XA 2A86A 2VYVA 3BIWA 4CLRA 2V45A 2HLPA 3RNLA 4A6XA 1QYDA 1RAGA 2I6UA 4UHHA 5F2NA 4RELA 3HV2A 1VYHA 1RPZA 3TUJC 3WNDA 2YOGA 5TF4A 1UEXC 3GP3A 1ZCFA 3QBTA 1R27A 3LY5A 4PQFA 2A9QA 1TZMA 3ZCSA 1G20E 3L01A 4J9VA 2H9AA 3W04A 3VPCA 2BZ1A 9ATCA 2Q6TA 2FZGA 4K88A 1UBGA 1IEXA 1P18A 4MQEA 2Q2WA 4HZGA 1OLUB 4JJZA 1N8KA 1NGSA 1W4RA 4IPTA 4PSDA 4XDHA 1L9XA 2I2AA 3KB6A 3DBRA 3ISVA 4IDAA 2JD2A 5AJZA 4QZVA 3ZVMA 4YPVA 1F4LA 4GXNA 3PGXA 5ENVA 5K6RA 1W87A 1FUUA 4EB0A 2YV1A 2VCHA 5EJ9A 1JYFA 1SK9A 5IX8A 2VPQA 1Y1RA 4JLKA 3RSLA 1UUFA 5CYPA 3V1UA 2JW5A 2VJMA 4DVGA 4BE7B 5G40A 3VZRA 3GD7A 3CPEA 3WJ2A 1JZSA 2JHPA 2QVYX 4ZO6A 1CY8A 2R2GA 3BRWD 8LDHA 2OORA 1Z13A 2Z3WA 1XZJA 2AFRA 5DGIA 3ZBPA 1I3CA 2IEAA 3KT3A 1WUIS 4ZRMA 3V6LA 4OHCA 2E4XA 4WCDA 5H80A 1YS2X 2FVXA 4OQLA 4HUQB 2FW8A 3JQ9A 4RY2A 3T5PA 3KUXA 3V7YA 3D81A 1Y33E 4YREA 4UTZA 1C30B 5JCXA 3GLGE 3COJA 2NXNA 2HIGA 2JCXA 3N0VA 4P8RA 1G6OA 2QTMA 1H0SA 3RC7A 3O4HA 1MAHA 1EUQA 3F98A 1XRJA 3GK3A 5LKRA 3GRCA 1YQXA 1JFFA 1ONNA 5HPYB 1TAHA 1FRQA 3MUOA 4JYBA 1CUWA 1NF8A 3O4VA 2W6QA 3QE2A 4MP3A 3PQ4A 3WLFA 2ZYRA 2YXDA 5EXDA 4A26A 4JVMA 1E58A 4BN5A 2M6RA 3IAXA 3L1KA 2ECQA 3BKXA 3VX3A 4H0FA 4OP3A 3T54A 5ALTA 4D81A 4GICA 3DV9A 2WQ6A 2G08A 3E61A 4MKGA 3BS4A 1CLUA 5DIZA 4YP7A 1QRRA 3K4PA 3OAAA 4U2KA 5BR8B 1S96A 1AB6A 4G56A 1T8UA 1G5QA 3HSSA 4IJKA 2YWGA 5AJVB 5EIHA 2Z5LA 2PEZA 5KCZA 1KJ9A 1RJFA 3TEFA 1GQYA 1PRYA 4HN2A 3TLBA 1NHWA 1NM5A 1TXGA 3OQIA 3MB8A 5EUQB 3WL8A 3BQNB 2PUDA 3I3SR 2A9RA 3HY6A 2V7WA 2AI2A 4RMIA 4QLAA 1QS0A 2A5YB 2G4VA 3ONDA 4DB4A 5LXTF 3GVIA 3TIGA 2AI3A 3P26A 2R65A 3AP1A 2R2AA 1E3SA 1ZMXA 1J5EB 3Q6IA 3SDSA 3VR1A 3DE3X 3DT6A 5LP6B 1GY8A 2IGTA 1I3KA 4I5DA 1QQ6A 4O5OA 3RSQA 5THXA 4F3YA 2KMLA 3JQPA 4DPLA 3JZFA 1W7AA 1VKHA 2HOQA 1V9LA 3KJIA 5IXYA 3HEAA 2LKDA 1JN0A 5COBA 3QE4A 4EUFA 2OUKA 3UJCA 3GB9A 3TQQA 3X2FA 1T4MA 3KU4A 1F1BA 3ESRA 4AVYA 4C05A 2B0JA 2WF5A 2AG8A 3HO6A 1NLZA 1K27A 1EUDB 4LPKA 4G67A 3QVVA 4NH4A 3HZHA 5H82A 1M8FA 2FX2A 5HIIA 4M76B 1M6VB 5IJ9B 3OP1A 3K53A 2Z8ZA 3FHOA 5DYNA 4H08A 5JDCC 3VOAA 3VR2D 5U4QA 3WQSB 2GRAA 4IF4A 1GFWA 2CDNA 2O8NA 1W52X 1TW2A 2H4XA 4FR0A 4F9FA 5CM8B 4DABA 3WXMA 1NN3A 1B23P 3CNHA 1CSEE 1CUSA 1YRWA 1F4PA 1P0FA 4N5MA 4RU1A 2QRQA 2I4LA 3ZGYA 4PGFA 5E1MA 4ZI2A 4W5WA 2XZLA 5D00A 1ZJYA 5KPJA 2OAP1 1X9GA 3P9KA 5HDQA 2AFHA 4L6AA 5CT9A 1HUQA 3TIIA 4YT8A 2ZIZA 1GKKA 1DC5A 1NQ5A 2QTVA 5BP7A 1BMQA 2PKWA 1SBZA 3FDJA 3IVGA 4D3XA 4JBLA 3AK4A 5KQLA 2PL3A 3D4PA 2IKQA 1AXEA 3IAM6 2X0EA 1L3IA 1YUMA 1FMCA 2PSHA 4TT3D 2XGOA 4C04A 4KCGA 1KK1A 3DNMA 2VZ9A 3R77A 2IYPA 1QNFA 4YO7A 1UCFA 4QUIA 4RZUA 1AMOA 3KAJA 4G0QA 1OW3B 1ZI9A 3R4VA 1OAOA 2QKYA 1JAHA 2FV8A 2COUA 5FUYA 1QJ4A 2YJ4A 2IYFA 3D8UA 5F64A 1E3WB 3X1WA 2BGWA 1S2LA 2YXBA 2I1QA 3EULA 3MGCA 1NI5A 4RPKA 2A1UA 2FNAA 5E7IA 3WNQA 2Z83A 1P2FA 4KQKA 1HT3A 1LC0A 5KJ6A 1XTKA 3LQQA 3HB9A 4WESB 5FPQA 4PYMA 2A9FA 5ALDA 3LECA 4K6MA 1ZN8A 2FFAA 5IM4A 1BX1A 2I4NA 2WB4A 3T7JA 3BXOA 5ALXA 3SM9A 4W1RA 4KIWA 4RH0A 4DXAA 3UC9A 1RP1A 4ZPJA 2PE5A 5BWBA 2P4UA 3PSAA 4LDJA 2QRUA 1XHEA 3UGTA 2WUEA 2WWVD 1U11A 2QVXX 2HGSA 3ZCQA 4AG3A 1TYZA 4JC5A 4QHYA 4REQA 4AURA 2A14A 2HREA 4HFRA 5KU7A 3Q41A 2QT9A 5I7SA 1WQ3A 1DO8A 4M0UA 5DMHA 2E18A 3LGAA 1NYTA 3PL5A 1C7IA 5E38A 5HW0A 4C7KA 5DH9A 5K8VA 2AJBA 3IUEA 4RX1A 3PUYA 1TO1E 3PR3A 4R6XA 3TB6A 2OM6A 4I5EA 1BH2A 4JI5B 3HABA 2JK1A 4KWEA 2O8EB 3DUWA 3K0CC 4YUWA 1GZVA 1JDUA 3HA3A 4RHXA 4D4IA 3L0CA 2GOYA 4PAQA 3H6KA 5KZMB 1GD1O 4IM7A 3ROGA 2BVNA 3T6KA 1RADA 1HA3A 1R4AA 3CZQA 4WH0A 2VS1A 3AF3A 4KBGA 5H9WA 2QPLA 4ZPXA 1HH4A 1WCXA 2AK3A 3OOEA 3AETA 2OV8A 1QIJA 3CBGA 2K7FA 2XWSA 3JQAD 3ZE9A 4B7ZA 4DCJA 1NU6A 1JR3A 2BGTA 1EGQA 3MGGA 1SMKA 4WBSA 2ZRCA 1YE8A 5LUAA 3JQFC 4MXDA 1LSUA 1DZ3A 3FCOA 5PGMA 2RHOA 3MJ4A 2UZ1B 3NR2A 4C5AA 1M7GA 1O97D 2YZMA 3TB4A 2RCYA 3CCBA 1BXKA 3RF6A 4NBRA 2X9NA 1GUYA 4I9FA 2P2NA 1JQLB 1U28A 4KBYA 1NDQA 1XVLA 2A9OA 1QZ3A 2R44A 4QREA 5JPIA 2P27A 4B2PA 1YFJA 3EIUA 1JEOA 1RLJA 1SHLA 1XKTA 3VDMA 1DQYA 4JDUA 3EC7A 2F9LA 4TXNA 4QG7A 3TAHA 5K20A 1M5UA 2JGLA 2D5BA 2XGJA 3A1CA 2RSLA 5CNJA 1QGUA 4DMMA 3HI4A 4X24A 2J07A 1UPXA 2NWQA 1RQPA 3HJUA 3AUFA 3WA6A 4DC0A 4DY6A 1XCBA 1OLSA 1RM4A 3EQ2A 4MS1A 3AF1A 1JHAA 1IFXA 3IHLA 2QUBA 3IJ5A 4J90A 1U7OA 3OJFA 4TQUS 4B87A 4DIEA 4G86A 1VPDA 2O8DA 1EGAA 4CQJA 3EDYA 3G8AA 4GKBA 3FZGA 1PFQA 1KYWA 3D6TB 4Q01A 5IVIA 1LBIA 2B8JA 1NC3A 1OKKD 2GYWA 3K2EA 4YRQA 4BNWA 4BRSA 4M1YA 1ULTA 5ALZA 4GZLA 2ONJA 1QH0A 3R6WA 1DAKA 3I76A 3OE7A 2BISA 4BVLA 2ZRIA 4RDXA 5LQCA 1XRPA 2V59A 1DOAA 2AXPA 3JASA 5KSYA 4YCLA 4LBVA 1QQTA 2ZCVA 3C39A 4K28A 1ZMTA 4Z7NB 4Q1DA 2ZAGA 3W1VA 1P5ZB 4TX1A 4DBVO 2BTEA 2OK8A 2GRUA 4Y1EA 3MHTA 1COWA 1VL8A 1DU4A 1Z88A 3A31A 4A6PA 2WHYA 5LYJA 3ICEA 2Z09A 2B36A 3RRMA 4ZYZA 4KVGA 1AQUA 2WVAA 2ARKA 4YCAA 2XUJA 3RWMB 3X1XA 1KEUA 5G0VA 1UFOA 3NB0A 3H9UA 3PYLA 2ZXFA 4FMBB 4TM7A 4UJ5A 2QM3A 1EX7A 4LS3A 1QHFA 4TTVA 4AW9A 1XPRA 5E7QA 2W5UA 3BEDA 2EFDB 2IV7A 4C0JA 2VYNA 3ZE2B 1DLJA 5HZHA 2ZUSA 1KC3A 1Z47A 1A71A 2GPWA 3CU5A 4JQSA 4CW7A 1VMAA 4KE8A 2Q9BA 3ORQA 2YVUA 3OT1B 5C8ZA 1F0NA 2XT0A 3BCUA 2VP4A 2AC4A 3MHPA 4XUGB 1Y3HA 5E9WA 4MJXA 4MI3A 5J9FA 3VR4D 3B9QA 5BSTA 1ZK4A 1U2DC 2W00A 2IH5A 3IJPA 4B35A 1PT7A 1TUIA 3T1YB 2GLXA 4H7HA 5FL7D 5CRIA 1KSGA 3BAZA 1CQPA 3H8JA 1RMTA 2WAXA 3ZDZB 2DFNA 2WYVA 3SC2A 3IA7A 3H9QA 3ZQJA 2D1TA 5K0EA 3QKRB 3W5UA 2NYVA 3SZ3A 3QF4B 4WK0B 1XX6A 4M1QA 4XJXA 5EZYA 4D8WA 4W5HA 2L17A 1U0EA 4OUDA 2CXSA 1N8NA 3CX8A 2VUHB 4N7RA 2CJPA 1FQOA 5KC9A 3GDWA 3LWBA 1LKZA 4KACA 4NYJQ 5IBPA 4LOIA 5FWYA 3VKGA 4S1TA 3L6CA 3PQ3A 3PE6A 5CT4A 3GHHA 5IKOA 5C80A 4NU6A 2O2EA 5KYUB 4MAAA 2WA2A 1WABA 5DWVA 1NUUA 5E2BA 3T9FA 3TZLA 2N46A 5JY1A 4R8LA 2QW8A 3SOZA 4TRJA 4WDRA 5AVUA 3SGLA 1X80B 1WPXA 3NANA 4TV9B 1PWYE 3RFTA 5HJ7A 3EZYA 3FUTA 1NG1A 2H5IA 2E4WA 1M2KA 4MVJF 4PYOA 2O54A 4BTVA 3GDHA 4TRRA 3HLTA 3AR8A 2IEDA 3RSZA 1USUA 6LDHA 5LDHA 3R9WA 1LNSA 1RM5A 5KYXB 3WB0A 4AXBA 2RI1A 5A4AA 3DFMA 4WL0A 3JAMA 3E9CA 1S3FA 3B1KA 4MGKR 1DS6A 1L6IA 1YKSA 2Q6LA 1N8SA 1RP7A 2RGCA 2XRYA 3DAFA 4OSOA 2O7VA 4FOSA 3BRWA 3UOGA 3VHXB 3KWFA 3QBDA 3LO5A 3NM6B 1ZC4A 2OG2A 2R6GA 3DMHA 2RK4A 3AM3A 2J1LA 2AZ4A 2Q5IA 3AHDA 3HS3A 1P2TA 1PF7E 1KOJA 3NWPA 4UFOA 4XKJA 3WIEA 5BV0A 2HBRA 3DFUA 3DZFA 3WWZA 5CBKA 2YFKA 8ABPA 1WXHA 4INPA 1X7HA 4C0QC 2JJYA 2NNWB 4LV6A 3VSCA 2OBFA 1CF4A 5K0NA 2RHMA 4DRXB 4B2IA 1IXZA 1OJLA 1VMKA 2O5VA 2DUUA 3OZCA 4TXHA 5GONA 3TLYA 4ARVA 1H8HA 3AJ8A 1MB9A 5K9ZA 1EU1A 4KQ6A 3GAMA 4U5QA 1IQUA 2FWIA 1G16A 1Q74A 1KP9A 2AHOA 2WIJA 1WUJS 4IH9A 5AW4A 1KAEA 1LLUA 3OA2A 2X9QA 4XIJA 1AF4A 3KSDO 4IW3B 1LW7A 3P2KA 2ENUA 2RHTA 1QR2A 3F7OA 1PSDA 3LKDA 2YCBA 3GDGA 3EH1A 3LVRE 4INJA 2NO6A 2IYEA 2QTFA 4OTZA 5G1OA 4D8YA 1S7GA 1L4HA 1GZ6A 4G25A 1YMVA 4DEYA 4TV8B 3DHVA 5CNMA 4Q1EA 5IDXA 3EHDA 2BOVA 4Q3AA 4ZO9A 1A9SA 1RZUA 2R6JA 1C8LA 2GJ9A 1ORTA 1CPYA 1VB5A 1KPIA 1T3TA 1XDWA 2IFTA 2ZTUA 2P0EA 2GAFA 2QAGC 3LE8A 4JP2A 4RVDA 2W83A 1PZMA 2X0JA 4IDOA 1Y5RA 3IOCA 1E9CA 3CH5A 5EE1A 1ODJA 3V48A 3GLGB 2D8MA 2ZWOA 2DTXA 3G7SA 5A0TA 4QBIA 2EQBA 3EZXA 2DYKA 3FOCA 4N0DA 1IN7A 1VJ1A 1MXHA 3QVUA 1L4GA 2A0XA 5F9MA 3ZLVA 1WOYA 5J2TB 2R4TA 3OMXA 5LR6A 1L7VC 3O4IA 5AVQA 5DYTA 5C53B 4LEIA 1EDEA 3RRZA 1XMOB 1E0DA 1L7BA 1XXHE 3GUYA 4KYUA 3A05A 3KD2A 4TVSA 4XVCA 4ZVUA 5G4KB 1BEZA 1JG7A 4FI3F 4JBHA 4BMYA 1J21A 1K68A 1SD1A 1RWBA 1XMPA 2B1IA 4FUTA 4JOCA 1V26A 4P0TA 3EQ7A 4KI0A 1DC6A 4M9UA 1EZ4A 1E9DA 2G4CA 3OT5A 3C3WA 4RPJA 3CLUD 2VDMB 2QLNA 1NURA 4ZANA 4RIFA 4QOSA 3MJRA 5JCJD 3TL2A 1H85A 1ENZA 4DUGA 4W99A 3N07A 2IDMA 1JSRA 5LQUA 4LGMA 4FMCB 4FYMA 3KR1A 5ICEA 1THMA 1EWTA 2XVZA 1L5LA 4EG1A 4QXRA 3AUAA 3V7WA 1CRLA 3K70B 3HBMA 2HMAA 3KZNA 3AR9A 2C7BA 1NVDA 1KDVA 2X22A 3AZPA 2WU8A 2HO5A 1E6WA 3PXGA 1DXOA 2R4UA 4EA6A 1W1IA 1E3MA 1NULA 1YFZA 3D59A 2BR3A 2EBUA 1CUGA 4LMRA 2WMOB 3O47A 4AJLA 5IKMA 5E95A 1XRLA 3HXMA 1D9XA 5A4KA 3H1AA 4DIFA 2YYSA 4U7WA 4BWGA 5I5EA 2HX1A 3ZX5A 3B60A 3ECCA 2YC2C 1SU7A 1DXQA 2PS0A 4OK5A 2OCBA 4PVDA 3U0BA 4ER0A 2PBLA 1SXQA 4N0QA 1TX4B 3KOUA 4BLQA 3SR0A 3EFEA 1ILWA 3GD5A 4DCTA 3T9DA 2FRDA 4E88A 4OH1A 5IVKA 4QUBA 3SQMA 2HPZA 4LV8B 3STXA 2DVMA 1TOAA 1EP9A 4N3BA 3DOJA 2CC2A 3T99A 4AMZA 2BKXA 2QPTA 1DEHA 1WV1A 2ZBVA 4FE4A 4GU5A 4JMPA 2VSQA 3P0JA 2EX0A 1VPLA 3T38A 1OLXB 4FYKA 4WHMA 4ND2A 3TTTA 4EP1A 2ZWPA 2PBRA 4IKOA 3PD0A 2A0WA 2AUTA 3W9YA 4KRFA 4NBNA 4IDDA 3S5UA 3HFGA 4HP8A 3TDMA 4O2AB 1H2HA 4F3NA 3OZ7A 3T1TA 1P0QA 1YQWA 1R1DA 2O8EA 3WWDA 3A6EA 4IVQA 3UW1A 3BHJA 1EINA 4KGDA 3WYDA 5JEEA 4RIIA 1YNSA 3ZJUA 1KXZA 2YFQA 3OKCA 5A5FA 1TO6A 3AVQA 4Q1CA 3IDFA 4QPZA 5IW8A 2ZYUX 4LFAB 3B1ZA 1Y9DA 6ABPA 1JQDA 4QLBA 1T0UA 2QE6A 3UV6A 3AETB 3RAPR 5IHPA 4AZ0A 2XUIA 3EXHC 4I66A 2PJRA 3JQEA 5J2UB 4M0PA 1H3EA 1RDFA 3C43A 1C1HA 1W6RA 1ELOA 3LYUA 1NAIA 5SY9A 3C97A 4MLPA 4YCCA 2C4NA 2V6IA 3CNOA 3PD1A 4FZ5A 2XYRA 3SICE 1N5RA 3CM0A 5DM4A 5LQNA 4REMA 3RVKA 1NXOA 5J1TB 4YFVA 4I2VA 4CL0A 1SPXA 3FI9A 4Y0VA 5BQXA 3D3QA 4GW3A 1FYFA 3NCHA 1U80A 3RK0A 5T67A 3QYPA 1LLQA 4LY6A 3TI9A 1H1DA 3PNKA 1E6LA 3D4LA 4YJFA 3UA3A 2YZNA 2XW6A 1T24A 1BKYA 1PR9A 1SBQA 1OY1A 4J0IA 1LV7A 5SZHB 1E1QA 5TDHA 3Q7EA 1XRSB 4PZDA 1PJRA 1ZBQA 2OMEA 4JBGA 1CBUA 1P7VA 1PK8A 1IMOA 1E1DA 1ZL2A 2H17A 2WD8A 1QDLB 1E5XA 3FPBA 3LBIA 3PQ6A 1Y5NA 4NZYA 1X19A 4CI9A 1V3VA 1VC2A 2BJVA 4IEIA 4Y9RA 3T0GA 1LDBA 3DJYA 5EHXA 3LV8A 5IM5A 2C2WA 1I0LA 4CBVA 2Q7OE 1FLAA 3HCBA 3PGKA 3TIXB 4MUFA 2O20A 4XYMA 4ZJUA 4DOMA 4UJ3A 3OC0A 2XRZA 3K0HA 4ZK6A 2GHTA 4OYRA 2WFLB 1JHQA 1XTQA 2VUTA 4EO9A 1D2NA 1KBQA 1ZRMA 4RKQA 2X0FA 5CDHA 2P67A 1ZRHA 4JL6A 4O1MA 1DBPA 2BP7A 3FH0A 3ND8A 4MWTA 3KK0A 3K1AA 1GHTA 2I2CA 1ICEA 3I9MA 3K8OE 2RHRA 2ZSFA 3IEPA 1P1FA 3R3HA 2YCLA 3AJ9A 4LCEA 1LPNA 1N0VC 3FJ1A 1UAYA 2VPYA 4IL5A 4KGXA 3IIMA 3E35A 4QXQA 1AS3A 4RD0A 1A7UA 4KR3A 1M0TA 3A9SA 2F6RA 1IJBA 4O4HF 2DECA 4G37A 2EYUA 3AFIA 1DPGA 2E49A 1WF6A 1IHYA 1PJBA 3OJXA 1I7DA 1CUYA 4ISCA 2A4MA 5DWQA 1PVDA 1XMQB 1NQTA 4MKIA 3U40A 4G2TA 1E69A 5LVAA 2A5FA 3PC8A 1FDRA 4MMXB 3D0QA 1V7ZA 1PFGA 4PGGA 4C2AA 2XE8A 5BORA 5A1TA 1RYHA 4X20A 5K0TA 2D2EA 3HVKA 4LECA 1GR1A 4KXNA 1Z6TA 3B7WA 1KQNA 4BMOB 1UK6A 2CXTA 3NC1C 5TNXA 1K63A 1WZIA 4FTWA 5JSKA 5I8WA 2EG5A 2I80A 2WK1A 4NYMQ 1ODIA 1L4EA 5U1PA 4BBPA 3AKZA 2ZR8A 1E0KA 3QVSA 3VOSA 3S8MA 3U3KA 1KRWA 3RVJA 5MHTA 2WSSD 4URUR 4NENA 1LDMA 3WIOA 3C16C 1JIJA 4Z6KA 5BXQC 2QRKA 1E20A 1RI4A 1PD0A 3EOAI 4RQAA 4BNUA 2NZ2A 3MTAA 4QDZA 3ZV4A 2AW5A 3QF4A 2AR0A 3D2CA 4LYHA 4WX2B 3VNBA 2J9FA 5CVDA 3FPEA 3T5MA 1QGED 2OM2A 3CRQA 2WJAA 2P6RA 3LUKA 1Z08A 4PPNA 5AOVA 1XF9A 5GY7A 2G67A 4UEWA 4ZI7B 3AWIA 3HBJA 5AHWA 4BO9A 2M1XA 1X1DA 4LF7B 4C6SA 4EL5A 1SHJA 2GAAA 1A2QA 2AXNA 3GT7A 3OF2A 1Q1GA 3O3OB 3PXUA 5BV7A 1TA0A 3GAFA 2PUVA 4O5AA 1T9HA 2WTXA 2PANA 1F2VA 3AM5A 3FYSA 3HB0A 2GVNA 4FGLA 3TUIC 2V5VA 3BXGA 2Q5CA 821PA 4LXUA 4TV9A 4W5JA 1XDSA 1MQAA 3BMOB 5T5QA 1YA6A 1GAWA 5BPFA 5L40A 4KJZA 4P0QB 3I42A 1R10A 5IJAA 2Q50A 3R9KA 3KCQA 4RBNA 1CD5A 4I7EA 5BYBA 4KDFA 1KZ4A 3A9UA 4FFRA 2AOTA 4JL5A 1Z5NA 3I05A 3TZKA 3EYAA 3WDSA 3FMFA 2D5AA 1E2NA 5AW5A 4DILA 4E33A 1X1BA 5KTPA 2QR3A 1HURA 4L6CA 3TRFA 4ATNA 3GCWA 4DQLA 4C4SA 4NS1A 4GP6A 3WX0A 2QRVB 3B52X 4D0LB 2EWWA 4TTPA 1CDDA 1FDWA 5JH7F 1KAMA 4MS3A 1ZOLA 2ZB4A 1VE3A 4L2IA 4KIGA 3EEOA 3BXHA 2IHUA 3ZTYA 1V8BA 3NBYC 1K4YA 4P2BA 1NBIA 2GHIA 3VYTB 1WMEA 4P32A 4DCVA 3F5FA 4JFRA 3HXLA 1L9KA 4EHBA 2WB2A 2N75A 5IVPA 1ZJ6A 4BY9E 4GH5A 2ZPTX 3M6VA 5ELMA 5EUBA 5FUXA 1K0UA 1GXSA 1DSSG 2QN9A 3GC6A 2XSZA 4GVLA 5EIOA 3KJQA 2UYYA 5FPYA 3U7QB 4AG5A 4JASB 1VLLA 4HO1X 3T5GA 2VQSA 5FJJA 3FAZA 3TLGB 3MOSA 3F78A 2ZLBA 1Z6QA 4A9AA 2VHJA 3C8DA 4WV3A 4ZQBA 5IJ0A 1DQSA 3RT9A 5T3YA 3R7NA 2CHEA 2X6QA 1CY7A 2QTHA 4D8UA 2Q29A 3GGPA 5LM3A 1GM5A 1PR6A 1QG4A 1ZUHA 3HM2A 1XJ5A 2JEOA 4JR1A 3BF7A 3WGJA 7MDHA 5JANA 1M9NA 5A3VA 4LY0A 4RLSA 3R7WB 3S1LA 4ED9A 3BXPA 2O9JA 1M5TA 3BH6A 3DDCA 1BCRA 2ATVA 4QIHA 5BUZA 3FWNA 3L4BA 1V7QA 3PICA 4I1UA 1HR0B 4UPVA 3F6YA 4LIPD 2J59A 2R96A 1VXRA 4L72A 5SYNA 5BSHA 3ZWAA 3A2LA 4LBYA 3D8HA 4H2DA 1NVAA 4DDTA 1H05A 1L4FA 3BSYA 4O4JF 4RVGA 4M86A 3DP9A 1W2HA 3JPYA 4JOSA 4RF3A 3LFTA 1I7NA 2FEXA 2XB4A 3LQ2A 3U7HB 1ADBA 1HKUA 4G0PA 4GM0A 1CZHA 4IZ6A 4PZZA 4WFJA 1XPUA 2C9MA 1ZCAA 3R0ZA 1WDKA 4ID3A 3IERA 4BNJA 4DAOA 4MVJH 5JATA 2QIPA 2KHZA 4LC1A 4QGAA 1J33A 1SJ9A 3CBQA 4YJHA 1UFKA 3B9PA 3VBEA 2VQ3A 2I1WA 3WLKX 2HSDA 4ZT7A 5B7PA 1YOBA 1TJ4A 5CFNA 1AZLA 1CE8B 1WO8A 1RHQA 3ON5A 1WB5A 4ZWNA 4WN9B 4Q9KA 1EM8B 4G0ZA 4L8VA 4RTKA 2HYDA 4ZTUB 2V6GA 5KVSA 4M21A 1XA4A 3AKEA 2DPYA 3ZYZA 4KIJA 1N2OA 4CV1A 4DWJA 1FUEA 1GSIA 3N9IA 3OBIA 4H4EA 3SD7A 2WM9B 2HC9A 1XTVA 2LNDA 4IV5A 1BN6A 3PRJA 1NI3A 5LMCA 1Y8RB 4MW5A 3FDXA 3HKCA 1OOEA 3ZXYA 2UYHA 1ACLA 1EP3B 4LBZA 3WGNA 4I1PA 2NO7A 4PFKA 2IS6A 1ILEA 1S7CA 4C2BA 5ESDA 4CDNA 4UPDA 1KKLA 3ESZA 2W4IA 2JFBA 4J0DA 1VGQA 2IX3A 4M54A 3QOWA 3DTYA 1NXQA 3H4MA 2AOWA 4ALKA 1JHPA 1TTTA 4GWGA 1G55A 1RW4A 2WTMA 4OMCA 5CCBA 4NV1A 3Q8MA 1ZU4A 3WDLA 4A3SA 2HXSA 3QXXA 2UZ1A 3C5EA 4EUKA 3NOXA 4FMDF 1VQ1A 2O8FA 7REQB 1GU0A 5FB3A 2ONCA 2P9JA 4GNKA 3R7BA 3S0JA 1DJNA 2V7PA 1ZAKA 1JEJA 4QUGA 2BV3A 4B6RA 3RUCA 3QE0A 4L4ZA 1P4SA 3QJGA 4PANA 2J31A 5K2OA 2RCNA 3D54D 2OG1A 3BDVA 4JIMA 3KSUA 2HHJA 1WB6A 4IS2A 4D74A 2FJUA 1T2UA 2HQRA 4U2CA 3IB3A 4LSZA 3C14C 1A4XA 2Z98A 4JODA 2PYDA 4KVZA 4DRZA 2ORVA 4ZFNA 1AMUA 2PU5A 1V9SA 4KQIA 5DJ5A 4DYDA 1XMXA 4YAUA 4PIPA 4PX3A 2HZBA 4B33A 1WCIB 4M38A 1SG6A 4JUFA 4KYIB 2FE1A 1IBMB 3AB7A 1KFBB 2LGJA 1N7JA 1YRAA 2J45A 4DNFA 1F60A 5KMGB 2P90A 3FB1A 3OECA 4M87A 2WRZA 3K2BA 4E03A 3KU1A 3FDZA 4BKUA 3PEFA 1I0ZA 3M6XA 4AJKA 1VG9B 5F2KA 1MX9A 1UKZA 4LJ8A 2W43A 3KBOA 5EJ4A 2INGX 2VPTA 1NU8A 4E5PA 4JZYA 5F9FA 1VIAA 2CW5A 2X0KA 2YY7A 4BKOA 2F9MA 4U7JA 4FHZA 3C70A 5AW7A 1OX4B 3N6VA 1OV4A 5AD1A 5KTOA 2WM8A 2YWFA 3ZVRA 4G84A 1AO3A 4D0SA 3DD1A 1NLUA 3HP1A 2ADFA 4HDMA 2YIDA 5CHEA 5JD5A 1YC5A 3KJGA 3PPVA 3TW0A 1X42A 2IYQA 2WD9A 4ZQEA 5AO9A 3STWA 1TJNA 2GN6A 2GN9A 1WMSA 4INZA 1DEKA 1BVHA 3M6FA 3W4KA 5JAMA 1YVRA 2R7AA 2GEVA 4M1WA 1A97A 4GM1A 1OLOA 3SF8A 1EXVA 3OJ0A 1A72A 1Y7TA 3LSYA 2ZJ0A 3A3PA 3OT1A 5IFKA 3M3DA 5DNUA 2VJPA 3OLCX 3LY9A 4KQFA 4MRNA 1UDCA 4OQNA 1XN1A 4KO8A 5TJ9A 5BMVA 4QEDA 1H9CA 1GA1A 3V4VB 2C3OA 4E13A 4A8HA 1G2IA 1NLFA 2WSYB 3IVAA 3W77A 5CCEA 4MRMB 3HHPA 5GM1A 4K9LA 3B6EA 1JR6A 3EISA 3CF2A 5JDCA 5K09A 2W7TA 1T0BA 2HCFA 3L92A 4J0QA 4W7HA 3SLRA 1JT2A 2QAGA 5GIPE 2O8BB 3K9GA 3BHNA 2IXTA 3L8MA 2A4KA 3EEQA 3NVDA 3LXMA 4PAMA 4D3DA 3ES9A 2H7YA 4C4YA 1T9CA 3DYBA 3KKNA 4LC9A 4N6NA 4DR5B 4IEEA 4X8MA 1C8BA 1OPXA 2BGUA 3DE5X 3EIOA 5HCUA 3R9IA 3S5JA 4KRGA 1YQTA 3QY9A 5EIXA 2ZB2A 2Q7XA 3WNVA 2C0CA 2UUBB 3I39X 3M89A 2ZANA 3W6NA 1R15A 2C77A 3RS0A 3ST7A 3ZE1B 1NY6A 1FP6A 1E1CA 5ALSA 1ECGA 3SIPA 3FTPA 3S8EA 3WNCA 3WGHA 2VWHA 4OI0A 1YK0A 2ZBRA 3QUTA 4G41A 1Y1SA 1G2OA 5JS2A 1MN6A 1PR5A 1DLIA 2GZAA 1ESDA 2XMZA 3H5NA 1BW9B 3OP4A 1X77A 4ROSA 3SCZA 2KJQA 3O93A 3KX2A 1GPNA 3DBHB 1U63A 4TV8F 1CUEA 1HV8A 2CHUA 2FZLA 3CLHA 3FVVA 2O2HA 3TNYA 3SOPA 2EKDA 2WMYA 3KSRA 5EPEA 5YASA 2AVNA 4KDRA 3AF6A 3B9RA 3GL9A 4ENTA 5JBNA 1FRNA 1HDCA 1O58A 1S4MA 4Z0NA 1EHIA 3JZAA 1QCDA 2JGFA 3D4OA 4X64B 1PNTA 3FUVA 3LA8A 4UXHA 5DYIA 5LWQA 2RK3A 2X2FA 1ZEJA 3ZWNA 5B2FA 1PCXA 3M6AA 3VNAA 2XVAA 4AJ2A 2GVZC 2B30A 2HWXA 3GEPA 4HEA6 5JAPA 4TMZA 2ZUWA 4WLFA 4JAVC 3BK1A 4WOJA 4B3BA 3DUFB 3O95A 4XUEA 5EESA 3QLUA 1EZ1A 5B58C 2CFOA 2QG6A 3WAGA 2QUAA 2P9HA 5DI3B 1YWGO 1TT5A 3IP1A 4OXRA 3TVDA 4ZI7A 4PG6A 1OAKA 2G1AA 1UAGA 3H9BA 1GDHA 5AI5A 2GCOA 3GPBA 4P4LA 4DLTA 5I7RA 5F51A 1DDIA 5C7IO 4PLZA 1VHQA 4Y2XA 1XTIA 2H4FA 3A6ZA 1GNRA 2VT6A 3I8OA 2R5WA 4CTNA 2MR6A 4DRXA 4CQMB 3UH1A 3AM1A 2EHJA 4BOYA 5GZ3A 5JT1A 3EPLA 4ME6A 1PJLA 4WGGA 3H5VA 2KSQA 3ZIAA 4OFWA 3ZVLA 1EJBA 2ATCA 4CMBA 5A71A 4E3ZA 2FEAA 3DPSA 1RYDA 5DHPA 3R23A 3SC6A 2P4QA 4JXJA 4DKXA 1WB9A 3OU7A 1WIWA 4AYXA 2CDCA 1M1NB 1ZK0A 1KTVA 1KYIA 1SURA 3OLVA 5E1OA 4POOA 5BSGA 3WHKA 4GGMX 3G6KA 2WJGA 4JA0A 4TYPA 3QX8A 1JF8A 1SVIA 4HGRA 4UEQA 3DEAA 1N5IA 1FVXA 2P2SA 4QU5A 3VGPA 5A04A 4NWIA 4HSGA 5AW2A 4LMPA 3DVAB 2Q4DA 1IJFA 2EWMA 3EXG2 4O4JA 1KI6A 2VP9A 4NIMA 3WNZA 1OB5A 5L7YA 1JQAA 2Q9CA 4MVYA 1E2DA 3R7LA 4B8WA 4E5NA 1MOPA 2DBRA 3E5MA 4RCZA 2GK7A 4BP3A 4RKRA 1J2RA 4WLEA 5L3SB 4DQUA 1NRIA 3RM3A 2NUBA 4A36A 1I01A 2FZKA 3H4VA 4LKOA 3WLJA 4MUHA 1XEXA 1RQNA 4EI8A 5JYCA 5DNDA 3L82B 1V35A 5C3MA 3IUBA 5K3BA 1RYBA 1KHTA 4C7XA 1YJQA 5DV9A 3CUEF 1K0FA 1NSTA 1XZQA 4QAQA 2LP4Y 5ES3A 2QVZX 2I3BA 4BGEA 1Z62A 1RFLA 4MUMA 4D97A 1CP2A 4UFNA 2E55A 1SG9A 1V8ZA 5DHQA 4D9BA 1Z5ZA 2M9MA 4B6FA 1P1CA 1TMKA 3EIHA 5DVZA 1Q1AA 5JXJA 1CB7A 3LOQA 4GR4A 4O4HA 1ISHA 1J0DA 3OVMA 1HSOA 3BXFA 3I45A 3ZIAD 2QXTA 5GOZA 3ZJ4A 3HDJA 2R87A 5JS6A 2IS4A 2GBGA 4FIDA 5EHIA 1WU8A 4EDFA 1FRFS 4EOGA 1IONA 1UDXA 4KAAA 3WLIA 3EDOA 2B7CA 4FEEA 4ZV4A 3CLVA 1MG5A 2OYSA 3PNMA 2EF1A 4MUBA 2AZTA 2H0RA 2CD7A 2R6CA 4L7VA 4Q00A 2ZVJA 2F43B 1CQWA 4RHUA 1OZFA 3LHDA 2XUHA 4Y2SA 2OPBA 4LTDA 2WMDA 2J3MA 3C74A 3M8KA 3NHMA 4YUZA 1VLMA 3MD9A 1QRTA 3PWZA 3RARA 4EH1A 2CNKA 4ECAA 2MINA 1GG9A 2ZYHA 3H0KA 1BDIA 3ACCA 3FZEA 2PJZA 1MH1A 2G1JA 4RGVA 3ZOZA 3GLVA 1M5RA 2OD2A 2ZBDA 3SHWA 1EWKA 2ZIFA 3NUGA 2GJ4A 2G9RA 1Z5WA 1AX9A 2DWQA 3CONA 1SVNA 3E1KA 4WZAB 1M54A 2NSYA 3N8NA 4KLNA 1GZDA 2EW2A 4PPYA 3DNPA 3THWA 4JCOA 3ZDAA 1RAIA 1TYCA 2EJVA 4N7BA 3I34X 4RJJA 5ALUA 4D0NA 3U09A 3I2YX 2JLRA 2DY1A 3JAWA 2VRCD 1NTRA 5A6VA 2WZQA 3J7AC 2GXSA 3AEUB 4ZV7A 3GJ6A 1T8TA 3H5LA 2WJ3A 5LNK1 3KKQA 3VC2A 2PRZA 5F9HA 3EVNA 1RXYA 3M70A 3UUEA 4OHMA 1RQ7A 3REOA 1PGPA 3UXYA 3KKOA 2JRCA 1Y6FA 4J03A 3JQ8B 4GQBA 3JX9A 1XR3A 3VMMA 2IEBA 2XVMA 3SDBA 4EPVA 1V5GA 4R68A 3TFWA 2YQ5A 1K5HA 4B6PA 4UE3S 1DKLA 3IR7A 4C03A 2II6A 1CS4C 1E0AA 2ZQYA 4BFXA 5J2UA 3ZJ5A 1WD5A 1ZGJA 3CG4A 5AVYA 4Y6SA 2Q46A 2GMWA 3DHYA 2Q99A 5KC8A 1HSZA 2B4QA 4HWGA 4EARA 1OGYA 3NRBA 3LPMA 3NHLA 4G1BA 2HBYA 4DV0B 3A3NA 1AQLA 1H2AS 1QFYA 3CZ5A 3JQDA 4O33A 1G291 5THQA 4BLUA 5CEJA 5L6MB 1TA9A 1EKXA 4I4IA 1Z45A 4TS3A 1E1RA 1I80A 2CWDA 1UPTA 3QYAA 4F2GA 1V1JA 5KVAA 3EQ9A 1NDHA 3CURA 1H2WA 2X76A 3BQ9A 1A27A 1A7KA 1DO2A 1GCIA 2R8OA 1IK6A 1LX6A 3LPCA 3GLIB 1IHXA 2QI9C 3K1JA 1O6GA 221PA 4UZSA 4X5OA 3NTLA 1FX0A 4MR8A 4M1OA 2P75A 2PH3A 4ZJYA 4ZCLA 4RPHA 2JBAA 4GGOA 4Y6PA 3DHNA 4XOUA 5ARBA 4FYWA 5EZ6B 2CZQA 1VI6A 3H8VA 2B25A 2GZ3A 4LZPA 3NS7A 5DFAA 4G4JA 3KS9A 2OXTA 3BGIA 3O8OB 3ET4A 2QWXA 3UEOA 2JIRA 2X41A 4FILA 1ORVA 1WXEA 3L4KA 2BMEA 5EE3A 3H2JA 4XVRA 1WXWA 3HCEA 3OFSA 3RREA 1G8MA 1G3MA 3PKZA 1LVHA 1FUYB 2GNOA 4MMZB 2B8NA 2BFEB 2IRWA 3H1FA 4KFUA 4DVJA 4R3NA 2IYAA 2TRSB 3H2HA 2FWJA 4TMXA 1AJEA 5EWLA 1FFXA 5HKLA 2Z1DA 4HUJA 4BHTA 4MCAA 1LBQA 2D62A 1HYEA 2G7ZA 3FCXA 4J2OA 5FOSA 1QUEA 3EMKA 3X1KA 4BV2A 1XP8A 3FI0A 4ZT4A 1C2YA 1FFEA 2XMSA 4GF5A 4DIDA 3P9IA 3L7BA 1U4NA 2QRZA 1FTNA 2VTEA 3QVWA 1NBMA 2HWYA 1ZK1A 1WTAA 1JSZA 1TA4A 2I2FA 3OPVA 1RAAA