2LIQA

Solution structure of ccl2 in complex with glycan
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
MGHHHHHHHHSGDSPAVTLSAGNYIIYNRVLSPRGEKLALTYPGRQRTPVTVSPLDGSSEQAWILRSYDSNSNTWTISPVGSPNSQIGWGAGNVPVVLPPNNYVWTLTLTSGGYNIQDGKRTVSWSLNNATAGEEVSIGADATFSGRWVIEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL2 lectin
publication title Plasticity of the beta-Trefoil Protein Fold in the Recognition and Control of Invertebrate Predators and Parasites by a Fungal Defence System
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Sugar binding protein
total genus 28
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2011-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2liqA01
1HKNA 2GZBA 3I2XA 4LO3A 1G82A 4HR6C 4G6MA 2D7RA 4ISRA 1QQLA 3CA1A 3CU1B 3PHZA 1HIBA 4KEIA 3ZC9A 4QALA 2UUSA 1I1BA 2RG9B 4IZEA 1WBAA 3CA4A 1W3GA 3UD7A 3ZXDA 3FGMA 4IZXA 3N7MA 4USPA 4QBCA 4WBCA 4QKSA 1YBIA 3AJ5A 1PWAA 2Y9FA 3BRDA 3A23A 1JTCA 1RY7A 1YF8B 2F2FA 3OGGA 3R4UA 3OJ2A 4IYBA 4Q91A 1TTUA 5D63A 2FO1A 4X39A 1CVSA 2XOAA 1CE7B 8I1BA 4EEEB 1YTOA 2D24A 1HWMB 1XYFA 2KKIA 4J2KA 4D0TA 2K43A 4GOYA 5F8WA 3I2AA 2Z48A 3OGFA 2I1BA 1DZDA 2HWAA 3FJFA 3IM7A 5FZUA 3LLPA 1GGPB 5FNWA 3O44A 1BFGA 2NVHA 3JRRA 5BQUC 1JT5A 1SR4C 3BAHA 2D23A 3WINC 1S0DA 9ILBA 2E4MA 4DCKC 1DJSB 1BA7A 4I37A 2D43A 1PC8B 3FJIA 3ZX7A 1TOOA 3A21A 4I4UA 3VWCA 5HPZA 1S0FA 4I4RA 1G9BA 1BFFA 3AKHA 4KEKA 3WO2A 3A22A 1DQGA 3ILAA 5B2HA 3MPPG 1ONKB 1FQ9A 4IHZA 5BP5A 2KI4A 4JP0A 1DFCA 3BRGC 2MLLB 3O3QA 2VUAA 3HN1A 1JT3A 2ESUA 2RQ9A 1HCDA 2NYYA 4LO0C 3Q7WA 3T8SA 2Z49A 3OBRA 4R6UB 4D8HA 1FWUA 1WD3A 2K4AB 1F31A 21BIA 4L4IA 4I96A 1JQZA 3QR5A 4OW4A 3BA7A 2VSAA 3PUBA 2NM1A 3BAUA 5FNXA 1E0OA 1NZKA 1XHBA 3CAHA 4Q9GA 4OWLA 3FJJA 4ZOTA 3FFZA 2D22A 2Y9XE 4I2SA 3BAGA 4EB2B 4ZFWB 1V6UA 2MC2A 1WD4A 3EF2A 1M16A 4EFPA 3V0AB 1M2TB 3NBDA 4HJJA 3RTIB 2DRZA 3N7JA 5EHAA 5FZZA 1WBCA 1Z4SA 2P23A 1AVAC 1JY0A 1I1EA 4OEFA 1TWMA 3OJMA 2FFVA 1W3AA 3B9UA 3CA6A 2AXMA 3NBCA 3RMYA 1JLXA 4LO2A 3P53A 4FGFA 1EV2A 1FMMS 1BARA 1L2HA 5GAQA 3H6RA 4OWJA 4I3NA 3CA0A 1NUNA 1AVWB 2VXTI 41BIA 3UJ4A 3V0BA 3O4AA 3VSZA 3FJCA 1N4KA 3OBTA 2J3PA 1EYLA 1HWNB 3WA1A 4XFSA 2F8XC 4QC4A 1R8NA 1IHKA 5DVHA 1DLLA 3CQAA 2L5XA 4LO8B 1S0GA 1EPWA 2K8RA 3FJEA 2NTDA 5EG6C 3WINA 4HA2A 1DQOA 4P0LA 1FMZA 6I1BA 3H6QA 2ZQOA 1TWEA 1XZZA 1K5VA 3HMYA 4JKXB 3WO4A 1DIWA 1TFMB 4TLPA 3RTJB 4LO1A 3KMVA 1J0SA 3PMEA 1S0EA 3CRGA 3BAQA 3NJ5A 4EFQA 4EKXB 1V6XA 4I4SA 4I0YA 4G6JA 4I4VA 2DRYA 3O4DA 4OEGA 1RZOB 4ZBVB 4YOLA 4LO0A 2ERMA 3O4CA 3BTAA 4A7ZA 1PZZA 1Q04A 1Z2VA 3BRFA 3FUOA 5BXPA 3FJ9A 4X37A 2AAIB 3FJAA 5EC5A 1D0HA 2VXRA 3O4BA 4OWKA 4X38A 3ZXGA 1QQKA 1RG8A 2HW9A 1ILR1 4A7KA 3VUOA 5BXSA 3O4OA 4J2XA 3W9TA 1II4A 4P0KA 1IRAX 4I4XA 1R8OA 5BXTA 2IWTB 4Q9PA 1P63A 5JLVA 3UJ0A 4QD2B 4IQPA 4JAWA 1IJTA 2DREA 2YUGA 3JUTA 4I4OA 1FWVA 3H6SE 3N0KA 1HWOB 4EFRA 1BASA 5BVPI 2AFGA 4KBBA 5JMCA 2Y9GA 4G9NA 3RSJA 4I4QA 1JT7A 2ET2A 4ZA3B 2QYIB 1Z0HA 5F90A 3VEQA 1V6VA 3BX1C 4GP3A 3P6JA 1FN0A 1TP0A 4Z9WB 2ZR1B 2GO2A 2IHOA 4J23B 3Q7YA 1IRPA 1ISZA 4I1BA 4JKQA 2AQZA 4A7YA 1HWPB 2FDBM 2WBCA 4IY8A 3WMUA 1XG6A 2X2SA 3CA5A 1T9FA 4ZKTB 4JRAA 3AZWA 4G9MA 1BFCA 3E8LC 1Q03A 1IT0A 3FJ8A 3TC2A 1VCLA 4FVVA 4DEPA 2QN4A 4QD2C 1PUUB 4QBVA 2VSEA 2D1ZA 4AN7B 5BP5C 5D62A 3ZC8A 3F62B 4ISQA 1T4QA 3NBEA 2D7IA 4PC4A 2ZQNA 3F1RA 3H6RB 1K5UA 3VT2A 1AF9A 4KEJA 1YXWA 1FV3A 3BADA 3WMVA 4ZFYB 1EVTA 2Y9WC 1S0CA 3RMXA 4II0A 1YYNA 1S0BA 3AKFA 1UPSA 1ISWA 1ISVA 3CA3A 5BQUA 4I6IA 3NBNA 1SR4A 5DZUA 4OEEA 1G9AA 3IM5A 3FJBA 4XKIA 4H04A 1DFQA 2MIBA 1BLAA 1ABRB 3HOMA 4J2SA 1ITBA 3P6IA 1Q1UA 4OUJA 4USOA 2BEBA 1AXMA 3IM6A 3K1XA 4I7IA 3I29B 2DS0A 1JLYA 3AH4A 2LIQA 1AVXB 3BAOA 2R9KB 3VT1A 3D7WB 3LTQA 5I1BA 5E24E 3O49A 3AH2A 4ZFUB 1BLDA 4J2YA 4LO2C 5DSSB 3VSFA 2BEAA 4LO3C 4XFTA 1SZ6B 4G1RA 4JQ0A 4ZGRB 4H9WA 3FJDA 4LO7B 4KC3A 1AFCA 3O5WB 7I1BA 4D0ZA 5DUYA 1RMLA 4GP0A 2Q3NB 3QYDA 4I4PA 2BFHA 1HCEA 5BOWA 2HZ9A 2FGFA 2LIEA 4X3AA 2X2TA 3AKIA 3FJHA 2WRYA 3Q7XA 3R4SA 3AJ6A 2RSTA 1FGAA 3HALA 4I4YA 4GOVA 3UDAA 3S8JA 3PG0A 5F8YA 5BXRA 2F2FC 3S8KA 3IAGC 1A8DA 3HSMA 3WO3A 5G00A 2M49A 2KI6B 3BB2A 3C9ZA 4LO1C 4GAFA 4ENDA 3HBWA 2HWMA 1DZCA 2KH2A 3AZVA 1IILA 1MD6A 2NZ9A 4P6AA 4IONA 5F8SA 3UD8A 2D20A 4QO3A 4ZLBB 4I8MA 4I1EA 1W3FA 2VLCA 3IIRA 1G9DA 3AKGA 4JPZA 1BFBA 4LO7C 1ISYA 3N7KA 4L4HA 4F34A 3UD9A 1PUMB 2P39A 2NP0A 2D44A 2E4MC 2KLLA 3N7LA 3BA4A 2Q9XA 1KNMA 4P0JA 3OJVA 4F83A 3POKA 1S0LA 1IOBA 1AVUA 3V0AA 1MC9A 3FUQA 3V79C 4IY9A 1FV2A 4DENA 1V6WA 4Z8SB 5D61A 1OQLB 3BA5A 5FZYA 1ISXA 4XFUA 3FJKA 3CRHA 31BIA 2VU9A 4GAIA 2FFUA 1G9CA 1QXMA 4QKRA 3VT0A 3MALA 3SNVA 1JT4A 3BAVA 4AN6A 3A07A 3V0BB 4CJMA 3CRIA 3AH1A 1TIEA
chains in the Genus database with same CATH superfamily
1HKNA 2GZBA 3I2XA 4LO3A 1G82A 4UY4A 4HR6C 4G6MA 2D7RA 4ISRA 1QQLA 3CA1A 3CU1B 3PHZA 1HIBA 4KEIA 3ZC9A 4QALA 2UUSA 1I1BA 2RG9B 4IZEA 1WBAA 3CA4A 1W3GA 3UD7A 3ZXDA 3FGMA 4IZXA 3N7MA 4USPA 4QBCA 4WBCA 4QKSA 1YBIA 3AJ5A 1PWAA 2Y9FA 3BRDA 3A23A 1JTCA 1RY7A 1YF8B 2F2FA 3OGGA 3R4UA 3OJ2A 4IYBA 4Q91A 1TTUA 5D63A 2FO1A 4X39A 1CVSA 2XOAA 1CE7B 8I1BA 4EEEB 1YTOA 2D24A 1HWMB 1XYFA 2KKIA 4J2KA 4D0TA 2K43A 4GOYA 5F8WA 3I2AA 2Z48A 3OGFA 2I1BA 1DZDA 2HWAA 3FJFA 3IM7A 5FZUA 3LLPA 1GGPB 5FNWA 3O44A 1BFGA 2NVHA 3JRRA 5BQUC 2NS2A 1JT5A 1SR4C 3BAHA 2D23A 3WINC 1S0DA 9ILBA 2E4MA 4DCKC 1DJSB 1BA7A 4I37A 2D43A 1PC8B 3FJIA 3ZX7A 1TOOA 3A21A 4I4UA 3VWCA 5HPZA 1S0FA 4I4RA 1G9BA 1BFFA 3AKHA 4KEKA 3WO2A 3A22A 1DQGA 3ILAA 5B2HA 3MPPG 1ONKB 1FQ9A 4IHZA 5BP5A 2KI4A 4JP0A 1DFCA 3BRGC 2MLLB 3O3QA 2VUAA 3HN1A 1JT3A 2ESUA 2RQ9A 1HCDA 2NYYA 4LO0C 3Q7WA 3T8SA 2Z49A 3OBRA 4R6UB 4D8HA 1FWUA 1WD3A 2K4AB 1F31A 21BIA 4L4IA 4I96A 1JQZA 3QR5A 4OW4A 3BA7A 2VSAA 3PUBA 2NM1A 3BAUA 5FNXA 1E0OA 1NZKA 1XHBA 3CAHA 4Q9GA 4OWLA 3FJJA 4ZOTA 3FFZA 2D22A 2Y9XE 4I2SA 3BAGA 4EB2B 4ZFWB 1V6UA 2MC2A 1WD4A 3EF2A 1M16A 4EFPA 3V0AB 1M2TB 3NBDA 4HJJA 3RTIB 2DRZA 3N7JA 5EHAA 5FZZA 1WBCA 1Z4SA 2P23A 1AVAC 1JY0A 1I1EA 4OEFA 1TWMA 3OJMA 2FFVA 1W3AA 3B9UA 3CA6A 2AXMA 3NBCA 3RMYA 1JLXA 4LO2A 3P53A 4FGFA 1EV2A 1FMMS 1BARA 1L2HA 5GAQA 3H6RA 4OWJA 4I3NA 3CA0A 1NUNA 1AVWB 2VXTI 41BIA 3UJ4A 3V0BA 3O4AA 3VSZA 3FJCA 1N4KA 3OBTA 2J3PA 1EYLA 1HWNB 3WA1A 4XFSA 2F8XC 4QC4A 1R8NA 1IHKA 5DVHA 1DLLA 3CQAA 2L5XA 4LO8B 1S0GA 1EPWA 2K8RA 3FJEA 2NTDA 5EG6C 3WINA 4HA2A 1DQOA 4P0LA 1FMZA 6I1BA 3H6QA 2ZQOA 1TWEA 1XZZA 1K5VA 3HMYA 4JKXB 3WO4A 1DIWA 1TFMB 4TLPA 3RTJB 4LO1A 3KMVA 1J0SA 3PMEA 1S0EA 3CRGA 3BAQA 3NJ5A 4EFQA 4EKXB 1V6XA 4I4SA 4I0YA 4G6JA 4I4VA 2DRYA 3O4DA 4OEGA 1RZOB 4ZBVB 4YOLA 4LO0A 2ERMA 3O4CA 3BTAA 4A7ZA 1PZZA 1Q04A 1Z2VA 3BRFA 3FUOA 5BXPA 3FJ9A 4X37A 2AAIB 3FJAA 5EC5A 1D0HA 2VXRA 3O4BA 4OWKA 4X38A 3ZXGA 1QQKA 1RG8A 2HW9A 1ILR1 4A7KA 3VUOA 5BXSA 3O4OA 4J2XA 3W9TA 1II4A 4P0KA 1IRAX 4I4XA 1R8OA 5BXTA 2IWTB 4Q9PA 1P63A 5JLVA 3UJ0A 4QD2B 4IQPA 4JAWA 1IJTA 2DREA 2YUGA 3JUTA 4I4OA 1FWVA 3H6SE 3N0KA 1HWOB 4EFRA 1BASA 5BVPI 2AFGA 4KBBA 5JMCA 2Y9GA 4G9NA 3RSJA 4I4QA 1JT7A 2ET2A 4MZHA 4ZA3B 2QYIB 1Z0HA 5F90A 3VEQA 1V6VA 3BX1C 4GP3A 3P6JA 1FN0A 1TP0A 4Z9WB 2ZR1B 2GO2A 2IHOA 4J23B 3Q7YA 1IRPA 1ISZA 4I1BA 4JKQA 2AQZA 4A7YA 1HWPB 2FDBM 2WBCA 4IY8A 3WMUA 1XG6A 2X2SA 3CA5A 1T9FA 4ZKTB 4JRAA 3AZWA 4G9MA 1BFCA 3E8LC 1Q03A 1IT0A 3FJ8A 3TC2A 1VCLA 4FVVA 4DEPA 2QN4A 4QD2C 1PUUB 4QBVA 2VSEA 2D1ZA 4AN7B 5BP5C 5D62A 3ZC8A 3F62B 4ISQA 1T4QA 3NBEA 2D7IA 4PC4A 2ZQNA 3F1RA 3H6RB 1K5UA 3VT2A 1AF9A 4KEJA 1YXWA 1FV3A 3BADA 3WMVA 4ZFYB 1EVTA 2Y9WC 1S0CA 3RMXA 4II0A 1YYNA 1S0BA 3AKFA 1UPSA 1ISWA 1ISVA 3CA3A 5BQUA 4I6IA 3NBNA 4MZGB 1SR4A 5DZUA 4OEEA 1G9AA 3IM5A 3FJBA 4XKIA 4H04A 1DFQA 2MIBA 1BLAA 1ABRB 3HOMA 4J2SA 1ITBA 3P6IA 1Q1UA 4OUJA 4USOA 2BEBA 1AXMA 3IM6A 3K1XA 4I7IA 3I29B 2DS0A 1JLYA 3AH4A 2LIQA 1AVXB 3BAOA 2R9KB 3VT1A 3D7WB 3LTQA 5I1BA 5E24E 3O49A 3AH2A 4ZFUB 1BLDA 4J2YA 4LO2C 5DSSB 3VSFA 2BEAA 4LO3C 4XFTA 1SZ6B 4G1RA 4JQ0A 4ZGRB 4H9WA 3FJDA 4LO7B 4KC3A 1AFCA 3O5WB 7I1BA 4D0ZA 5DUYA 1RMLA 4GP0A 2Q3NB 3QYDA 4I4PA 2BFHA 1HCEA 5BOWA 2HZ9A 2FGFA 2LIEA 4X3AA 2X2TA 3AKIA 3FJHA 2WRYA 3Q7XA 3R4SA 3AJ6A 2RSTA 1FGAA 3HALA 4I4YA 4GOVA 3UDAA 3S8JA 3PG0A 5F8YA 5BXRA 2F2FC 3S8KA 3IAGC 1A8DA 3HSMA 3WO3A 5G00A 2M49A 2KI6B 3BB2A 3C9ZA 4LO1C 4GAFA 4ENDA 3HBWA 2HWMA 1DZCA 2KH2A 3AZVA 1IILA 1MD6A 2NZ9A 4P6AA 4IONA 5F8SA 3UD8A 2D20A 4QO3A 4ZLBB 4I8MA 4I1EA 1W3FA 2VLCA 3IIRA 1G9DA 3AKGA 4JPZA 1BFBA 4LO7C 1ISYA 3N7KA 4L4HA 4F34A 3UD9A 1PUMB 2P39A 2NP0A 2D44A 2E4MC 2KLLA 3N7LA 3BA4A 2Q9XA 1KNMA 4P0JA 3OJVA 4F83A 3POKA 1S0LA 1IOBA 1AVUA 3V0AA 1MC9A 3FUQA 3V79C 4IY9A 1FV2A 4DENA 1V6WA 4Z8SB 5D61A 1OQLB 3BA5A 5FZYA 1ISXA 4XFUA 3FJKA 3CRHA 4H75A 31BIA 2VU9A 4GAIA 2FFUA 1G9CA 1QXMA 4QKRA 3VT0A 3MALA 4MZFB 3SNVA 1JT4A 3BAVA 4AN6A 3A07A 3V0BB 4CJMA 3CRIA 3AH1A 1TIEA
chains in the Genus database with same CATH topology
1HKNA 2GZBA 3I2XA 4LO3A 1G82A 4UY4A 4HR6C 4G6MA 2D7RA 4ISRA 1QQLA 3CA1A 3CU1B 3PHZA 1HIBA 4KEIA 3ZC9A 4QALA 2UUSA 1I1BA 2RG9B 4IZEA 1WBAA 3CA4A 1W3GA 3UD7A 3ZXDA 3FGMA 4IZXA 3N7MA 4USPA 4QBCA 4WBCA 4QKSA 1YBIA 3AJ5A 1PWAA 2Y9FA 3BRDA 3A23A 1JTCA 1RY7A 1YF8B 2F2FA 3OGGA 3R4UA 3OJ2A 4IYBA 4Q91A 1TTUA 5D63A 2FO1A 4X39A 1CVSA 2XOAA 1CE7B 8I1BA 4EEEB 1YTOA 2D24A 1HWMB 1XYFA 2KKIA 4J2KA 4D0TA 2K43A 4GOYA 5F8WA 3I2AA 2Z48A 3OGFA 2I1BA 1DZDA 2HWAA 3FJFA 3IM7A 5FZUA 3LLPA 1GGPB 5FNWA 3O44A 1BFGA 2NVHA 3JRRA 5BQUC 2NS2A 1JT5A 1SR4C 3BAHA 2D23A 3WINC 1S0DA 9ILBA 2E4MA 4DCKC 1DJSB 1BA7A 4I37A 2D43A 1PC8B 3FJIA 3ZX7A 1TOOA 3A21A 4I4UA 3VWCA 5HPZA 1S0FA 4I4RA 1G9BA 1BFFA 3AKHA 4KEKA 3WO2A 3A22A 1DQGA 3ILAA 5B2HA 3MPPG 1ONKB 1FQ9A 4IHZA 5BP5A 2KI4A 4JP0A 1DFCA 3BRGC 2MLLB 3O3QA 2VUAA 3HN1A 1JT3A 2ESUA 2RQ9A 1HCDA 2NYYA 4LO0C 3Q7WA 3T8SA 2Z49A 3OBRA 4R6UB 4D8HA 1FWUA 1WD3A 2K4AB 1F31A 21BIA 4L4IA 4I96A 1JQZA 3QR5A 4OW4A 3BA7A 2VSAA 3PUBA 2NM1A 3BAUA 5FNXA 1E0OA 1NZKA 1XHBA 3CAHA 4Q9GA 4OWLA 3FJJA 4ZOTA 3FFZA 2D22A 2Y9XE 4I2SA 3BAGA 4EB2B 4ZFWB 1V6UA 2MC2A 1WD4A 3EF2A 1M16A 4EFPA 3V0AB 1M2TB 3NBDA 4HJJA 3RTIB 2DRZA 3N7JA 5EHAA 5FZZA 1WBCA 1Z4SA 2P23A 1AVAC 1JY0A 1I1EA 4OEFA 1TWMA 3OJMA 2FFVA 1W3AA 3B9UA 3CA6A 2AXMA 3NBCA 3RMYA 1JLXA 4LO2A 3P53A 4FGFA 1EV2A 1FMMS 1BARA 1L2HA 5GAQA 3H6RA 4OWJA 4I3NA 3CA0A 1NUNA 1AVWB 2VXTI 41BIA 3UJ4A 3V0BA 3O4AA 3VSZA 3FJCA 1N4KA 3OBTA 2J3PA 1EYLA 1HWNB 3WA1A 4XFSA 2F8XC 4QC4A 1R8NA 1IHKA 5DVHA 1DLLA 3CQAA 2L5XA 4LO8B 1S0GA 1EPWA 2K8RA 3FJEA 2NTDA 5EG6C 3WINA 4HA2A 1DQOA 4P0LA 1FMZA 6I1BA 3H6QA 2ZQOA 1TWEA 1XZZA 1K5VA 3HMYA 4JKXB 3WO4A 1DIWA 1TFMB 4TLPA 3RTJB 4LO1A 3KMVA 1J0SA 3PMEA 1S0EA 3CRGA 3BAQA 3NJ5A 4EFQA 4EKXB 1V6XA 4I4SA 4I0YA 4G6JA 4I4VA 2DRYA 3O4DA 4OEGA 1RZOB 4ZBVB 4YOLA 4LO0A 2ERMA 3O4CA 3BTAA 4A7ZA 1PZZA 1Q04A 1Z2VA 3BRFA 3FUOA 5BXPA 3FJ9A 4X37A 2AAIB 3FJAA 5EC5A 1D0HA 2VXRA 3O4BA 4OWKA 4X38A 3ZXGA 1QQKA 1RG8A 2HW9A 1ILR1 4A7KA 3VUOA 5BXSA 3O4OA 4J2XA 3W9TA 1II4A 4P0KA 1IRAX 4I4XA 1R8OA 5BXTA 2IWTB 4Q9PA 1P63A 5JLVA 3UJ0A 4QD2B 4IQPA 4JAWA 1IJTA 2DREA 2YUGA 3JUTA 4I4OA 1FWVA 3H6SE 3N0KA 1HWOB 4EFRA 1BASA 5BVPI 2AFGA 4KBBA 5JMCA 2Y9GA 4G9NA 3RSJA 4I4QA 1JT7A 2ET2A 4MZHA 4ZA3B 2QYIB 1Z0HA 5F90A 3VEQA 1V6VA 3BX1C 4GP3A 3P6JA 1FN0A 1TP0A 4Z9WB 2ZR1B 2GO2A 2IHOA 4J23B 3Q7YA 1IRPA 1ISZA 4I1BA 4JKQA 2AQZA 4A7YA 1HWPB 2FDBM 2WBCA 4IY8A 3WMUA 1XG6A 2X2SA 3CA5A 1T9FA 4ZKTB 4JRAA 3AZWA 4G9MA 1BFCA 3E8LC 1Q03A 1IT0A 3FJ8A 3TC2A 1VCLA 4FVVA 4DEPA 2QN4A 4QD2C 1PUUB 4QBVA 2VSEA 2D1ZA 4AN7B 5BP5C 5D62A 3ZC8A 3F62B 4ISQA 1T4QA 3NBEA 2D7IA 4PC4A 2ZQNA 3F1RA 3H6RB 1K5UA 3VT2A 1AF9A 4KEJA 1YXWA 1FV3A 3BADA 3WMVA 4ZFYB 1EVTA 2Y9WC 1S0CA 3RMXA 4II0A 1YYNA 1S0BA 3AKFA 1UPSA 1ISWA 1ISVA 3CA3A 5BQUA 4I6IA 3NBNA 4MZGB 1SR4A 5DZUA 4OEEA 1G9AA 3IM5A 3FJBA 4XKIA 4H04A 1DFQA 2MIBA 1BLAA 1ABRB 3HOMA 4J2SA 1ITBA 3P6IA 1Q1UA 4OUJA 4USOA 2BEBA 1AXMA 3IM6A 3K1XA 4I7IA 3I29B 2DS0A 1JLYA 3AH4A 2LIQA 1AVXB 3BAOA 2R9KB 3VT1A 3D7WB 3LTQA 5I1BA 5E24E 3O49A 3AH2A 4ZFUB 1BLDA 4J2YA 4LO2C 5DSSB 3VSFA 2BEAA 4LO3C 4XFTA 1SZ6B 4G1RA 4JQ0A 4ZGRB 4H9WA 3FJDA 4LO7B 4KC3A 1AFCA 3O5WB 7I1BA 4D0ZA 5DUYA 1RMLA 4GP0A 2Q3NB 3QYDA 4I4PA 2BFHA 1HCEA 5BOWA 2HZ9A 2FGFA 2LIEA 4X3AA 2X2TA 3AKIA 3FJHA 2WRYA 3Q7XA 3R4SA 3AJ6A 2RSTA 1FGAA 3HALA 4I4YA 4GOVA 3UDAA 3S8JA 3PG0A 5F8YA 5BXRA 2F2FC 3S8KA 3IAGC 1A8DA 3HSMA 3WO3A 5G00A 2M49A 2KI6B 3BB2A 3C9ZA 4LO1C 4GAFA 4ENDA 3HBWA 2HWMA 1DZCA 2KH2A 3AZVA 1IILA 1MD6A 2NZ9A 4P6AA 4IONA 5F8SA 3UD8A 2D20A 4QO3A 4ZLBB 4I8MA 4I1EA 1W3FA 2VLCA 3IIRA 1G9DA 3AKGA 4JPZA 1BFBA 4LO7C 1ISYA 3N7KA 4L4HA 4F34A 3UD9A 1PUMB 2P39A 2NP0A 2D44A 2E4MC 2KLLA 3N7LA 3BA4A 2Q9XA 1KNMA 4P0JA 3OJVA 4F83A 3POKA 1S0LA 1IOBA 1AVUA 3V0AA 1MC9A 3FUQA 3V79C 4IY9A 1FV2A 4DENA 1V6WA 4Z8SB 5D61A 1OQLB 3BA5A 5FZYA 1ISXA 4XFUA 3FJKA 3CRHA 4H75A 31BIA 2VU9A 4GAIA 2FFUA 1G9CA 1QXMA 4QKRA 3VT0A 3MALA 4MZFB 3SNVA 1JT4A 3BAVA 4AN6A 3A07A 3V0BB 4CJMA 3CRIA 3AH1A 1TIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKN A;  2GZB A;  3I2X A;  4LO3 A;  1G82 A;  4HR6 C;  4G6M A;  2D7R A;  4ISR A;  1QQL A;  3CA1 A;  3CU1 B;  3PHZ A;  1HIB A;  4KEI A;  3ZC9 A;  4QAL A;  2UUS A;  1I1B A;  2RG9 B;  4IZE A;  1WBA A;  3CA4 A;  1W3G A;  3UD7 A;  3ZXD A;  3FGM A;  4IZX A;  3N7M A;  4USP A;  4QBC A;  4WBC A;  4QKS A;  1YBI A;  3AJ5 A;  1PWA A;  2Y9F A;  3BRD A;  3A23 A;  1JTC A;  1RY7 A;  1YF8 B;  2F2F A;  3OGG A;  3R4U A;  3OJ2 A;  4IYB A;  4Q91 A;  1TTU A;  5D63 A;  2FO1 A;  4X39 A;  1CVS A;  2XOA A;  1CE7 B;  8I1B A;  4EEE B;  1YTO A;  2D24 A;  1HWM B;  1XYF A;  2KKI A;  4J2K A;  4D0T A;  2K43 A;  4GOY A;  5F8W A;  3I2A A;  2Z48 A;  3OGF A;  2I1B A;  1DZD A;  2HWA A;  3FJF A;  3IM7 A;  5FZU A;  3LLP A;  1GGP B;  5FNW A;  3O44 A;  1BFG A;  2NVH A;  3JRR A;  5BQU C;  1JT5 A;  1SR4 C;  3BAH A;  2D23 A;  3WIN C;  1S0D A;  9ILB A;  2E4M A;  4DCK C;  1DJS B;  1BA7 A;  4I37 A;  2D43 A;  1PC8 B;  3FJI A;  3ZX7 A;  1TOO A;  3A21 A;  4I4U A;  3VWC A;  5HPZ A;  1S0F A;  4I4R A;  1G9B A;  1BFF A;  3AKH A;  4KEK A;  3WO2 A;  3A22 A;  1DQG A;  3ILA A;  5B2H A;  3MPP G;  1ONK B;  1FQ9 A;  4IHZ A;  5BP5 A;  2KI4 A;  4JP0 A;  1DFC A;  3BRG C;  2MLL B;  3O3Q A;  2VUA A;  3HN1 A;  1JT3 A;  2ESU A;  2RQ9 A;  1HCD A;  2NYY A;  4LO0 C;  3Q7W A;  3T8S A;  2Z49 A;  3OBR A;  4R6U B;  4D8H A;  1FWU A;  1WD3 A;  2K4A B;  1F31 A;  21BI A;  4L4I A;  4I96 A;  1JQZ A;  3QR5 A;  4OW4 A;  3BA7 A;  2VSA A;  3PUB A;  2NM1 A;  3BAU A;  5FNX A;  1E0O A;  1NZK A;  1XHB A;  3CAH A;  4Q9G A;  4OWL A;  3FJJ A;  4ZOT A;  3FFZ A;  2D22 A;  2Y9X E;  4I2S A;  3BAG A;  4EB2 B;  4ZFW B;  1V6U A;  2MC2 A;  1WD4 A;  3EF2 A;  1M16 A;  4EFP A;  3V0A B;  1M2T B;  3NBD A;  4HJJ A;  3RTI B;  2DRZ A;  3N7J A;  5EHA A;  5FZZ A;  1WBC A;  1Z4S A;  2P23 A;  1AVA C;  1JY0 A;  1I1E A;  4OEF A;  1TWM A;  3OJM A;  2FFV A;  1W3A A;  3B9U A;  3CA6 A;  2AXM A;  3NBC A;  3RMY A;  1JLX A;  4LO2 A;  3P53 A;  4FGF A;  1EV2 A;  1FMM S;  1BAR A;  1L2H A;  5GAQ A;  3H6R A;  4OWJ A;  4I3N A;  3CA0 A;  1NUN A;  1AVW B;  2VXT I;  41BI A;  3UJ4 A;  3V0B A;  3O4A A;  3VSZ A;  3FJC A;  1N4K A;  3OBT A;  2J3P A;  1EYL A;  1HWN B;  3WA1 A;  4XFS A;  2F8X C;  4QC4 A;  1R8N A;  1IHK A;  5DVH A;  1DLL A;  3CQA A;  2L5X A;  4LO8 B;  1S0G A;  1EPW A;  2K8R A;  3FJE A;  2NTD A;  5EG6 C;  3WIN A;  4HA2 A;  1DQO A;  4P0L A;  1FMZ A;  6I1B A;  3H6Q A;  2ZQO A;  1TWE A;  1XZZ A;  1K5V A;  3HMY A;  4JKX B;  3WO4 A;  1DIW A;  1TFM B;  4TLP A;  3RTJ B;  4LO1 A;  3KMV A;  1J0S A;  3PME A;  1S0E A;  3CRG A;  3BAQ A;  3NJ5 A;  4EFQ A;  4EKX B;  1V6X A;  4I4S A;  4I0Y A;  4G6J A;  4I4V A;  2DRY A;  3O4D A;  4OEG A;  1RZO B;  4ZBV B;  4YOL A;  4LO0 A;  2ERM A;  3O4C A;  3BTA A;  4A7Z A;  1PZZ A;  1Q04 A;  1Z2V A;  3BRF A;  3FUO A;  5BXP A;  3FJ9 A;  4X37 A;  2AAI B;  3FJA A;  5EC5 A;  1D0H A;  2VXR A;  3O4B A;  4OWK A;  4X38 A;  3ZXG A;  1QQK A;  1RG8 A;  2HW9 A;  1ILR 1;  4A7K A;  3VUO A;  5BXS A;  3O4O A;  4J2X A;  3W9T A;  1II4 A;  4P0K A;  1IRA X;  4I4X A;  1R8O A;  5BXT A;  2IWT B;  4Q9P A;  1P63 A;  5JLV A;  3UJ0 A;  4QD2 B;  4IQP A;  4JAW A;  1IJT A;  2DRE A;  2YUG A;  3JUT A;  4I4O A;  1FWV A;  3H6S E;  3N0K A;  1HWO B;  4EFR A;  1BAS A;  5BVP I;  2AFG A;  4KBB A;  5JMC A;  2Y9G A;  4G9N A;  3RSJ A;  4I4Q A;  1JT7 A;  2ET2 A;  4ZA3 B;  2QYI B;  1Z0H A;  5F90 A;  3VEQ A;  1V6V A;  3BX1 C;  4GP3 A;  3P6J A;  1FN0 A;  1TP0 A;  4Z9W B;  2ZR1 B;  2GO2 A;  2IHO A;  4J23 B;  3Q7Y A;  1IRP A;  1ISZ A;  4I1B A;  4JKQ A;  2AQZ A;  4A7Y A;  1HWP B;  2FDB M;  2WBC A;  4IY8 A;  3WMU A;  1XG6 A;  2X2S A;  3CA5 A;  1T9F A;  4ZKT B;  4JRA A;  3AZW A;  4G9M A;  1BFC A;  3E8L C;  1Q03 A;  1IT0 A;  3FJ8 A;  3TC2 A;  1VCL A;  4FVV A;  4DEP A;  2QN4 A;  4QD2 C;  1PUU B;  4QBV A;  2VSE A;  2D1Z A;  4AN7 B;  5BP5 C;  5D62 A;  3ZC8 A;  3F62 B;  4ISQ A;  1T4Q A;  3NBE A;  2D7I A;  4PC4 A;  2ZQN A;  3F1R A;  3H6R B;  1K5U A;  3VT2 A;  1AF9 A;  4KEJ A;  1YXW A;  1FV3 A;  3BAD A;  3WMV A;  4ZFY B;  1EVT A;  2Y9W C;  1S0C A;  3RMX A;  4II0 A;  1YYN A;  1S0B A;  3AKF A;  1UPS A;  1ISW A;  1ISV A;  3CA3 A;  5BQU A;  4I6I A;  3NBN A;  1SR4 A;  5DZU A;  4OEE A;  1G9A A;  3IM5 A;  3FJB A;  4XKI A;  4H04 A;  1DFQ A;  2MIB A;  1BLA A;  1ABR B;  3HOM A;  4J2S A;  1ITB A;  3P6I A;  1Q1U A;  4OUJ A;  4USO A;  2BEB A;  1AXM A;  3IM6 A;  3K1X A;  4I7I A;  3I29 B;  2DS0 A;  1JLY A;  3AH4 A;  2LIQ A;  1AVX B;  3BAO A;  2R9K B;  3VT1 A;  3D7W B;  3LTQ A;  5I1B A;  5E24 E;  3O49 A;  3AH2 A;  4ZFU B;  1BLD A;  4J2Y A;  4LO2 C;  5DSS B;  3VSF A;  2BEA A;  4LO3 C;  4XFT A;  1SZ6 B;  4G1R A;  4JQ0 A;  4ZGR B;  4H9W A;  3FJD A;  4LO7 B;  4KC3 A;  1AFC A;  3O5W B;  7I1B A;  4D0Z A;  5DUY A;  1RML A;  4GP0 A;  2Q3N B;  3QYD A;  4I4P A;  2BFH A;  1HCE A;  5BOW A;  2HZ9 A;  2FGF A;  2LIE A;  4X3A A;  2X2T A;  3AKI A;  3FJH A;  2WRY A;  3Q7X A;  3R4S A;  3AJ6 A;  2RST A;  1FGA A;  3HAL A;  4I4Y A;  4GOV A;  3UDA A;  3S8J A;  3PG0 A;  5F8Y A;  5BXR A;  2F2F C;  3S8K A;  3IAG C;  1A8D A;  3HSM A;  3WO3 A;  5G00 A;  2M49 A;  2KI6 B;  3BB2 A;  3C9Z A;  4LO1 C;  4GAF A;  4END A;  3HBW A;  2HWM A;  1DZC A;  2KH2 A;  3AZV A;  1IIL A;  1MD6 A;  2NZ9 A;  4P6A A;  4ION A;  5F8S A;  3UD8 A;  2D20 A;  4QO3 A;  4ZLB B;  4I8M A;  4I1E A;  1W3F A;  2VLC A;  3IIR A;  1G9D A;  3AKG A;  4JPZ A;  1BFB A;  4LO7 C;  1ISY A;  3N7K A;  4L4H A;  4F34 A;  3UD9 A;  1PUM B;  2P39 A;  2NP0 A;  2D44 A;  2E4M C;  2KLL A;  3N7L A;  3BA4 A;  2Q9X A;  1KNM A;  4P0J A;  3OJV A;  4F83 A;  3POK A;  1S0L A;  1IOB A;  1AVU A;  3V0A A;  1MC9 A;  3FUQ A;  3V79 C;  4IY9 A;  1FV2 A;  4DEN A;  1V6W A;  4Z8S B;  5D61 A;  1OQL B;  3BA5 A;  5FZY A;  1ISX A;  4XFU A;  3FJK A;  3CRH A;  31BI A;  2VU9 A;  4GAI A;  2FFU A;  1G9C A;  1QXM A;  4QKR A;  3VT0 A;  3MAL A;  3SNV A;  1JT4 A;  3BAV A;  4AN6 A;  3A07 A;  3V0B B;  4CJM A;  3CRI A;  3AH1 A;  1TIE A; 
#chains in the Genus database with same CATH topology
 1HKN A;  2GZB A;  3I2X A;  4LO3 A;  1G82 A;  4UY4 A;  4HR6 C;  4G6M A;  2D7R A;  4ISR A;  1QQL A;  3CA1 A;  3CU1 B;  3PHZ A;  1HIB A;  4KEI A;  3ZC9 A;  4QAL A;  2UUS A;  1I1B A;  2RG9 B;  4IZE A;  1WBA A;  3CA4 A;  1W3G A;  3UD7 A;  3ZXD A;  3FGM A;  4IZX A;  3N7M A;  4USP A;  4QBC A;  4WBC A;  4QKS A;  1YBI A;  3AJ5 A;  1PWA A;  2Y9F A;  3BRD A;  3A23 A;  1JTC A;  1RY7 A;  1YF8 B;  2F2F A;  3OGG A;  3R4U A;  3OJ2 A;  4IYB A;  4Q91 A;  1TTU A;  5D63 A;  2FO1 A;  4X39 A;  1CVS A;  2XOA A;  1CE7 B;  8I1B A;  4EEE B;  1YTO A;  2D24 A;  1HWM B;  1XYF A;  2KKI A;  4J2K A;  4D0T A;  2K43 A;  4GOY A;  5F8W A;  3I2A A;  2Z48 A;  3OGF A;  2I1B A;  1DZD A;  2HWA A;  3FJF A;  3IM7 A;  5FZU A;  3LLP A;  1GGP B;  5FNW A;  3O44 A;  1BFG A;  2NVH A;  3JRR A;  5BQU C;  2NS2 A;  1JT5 A;  1SR4 C;  3BAH A;  2D23 A;  3WIN C;  1S0D A;  9ILB A;  2E4M A;  4DCK C;  1DJS B;  1BA7 A;  4I37 A;  2D43 A;  1PC8 B;  3FJI A;  3ZX7 A;  1TOO A;  3A21 A;  4I4U A;  3VWC A;  5HPZ A;  1S0F A;  4I4R A;  1G9B A;  1BFF A;  3AKH A;  4KEK A;  3WO2 A;  3A22 A;  1DQG A;  3ILA A;  5B2H A;  3MPP G;  1ONK B;  1FQ9 A;  4IHZ A;  5BP5 A;  2KI4 A;  4JP0 A;  1DFC A;  3BRG C;  2MLL B;  3O3Q A;  2VUA A;  3HN1 A;  1JT3 A;  2ESU A;  2RQ9 A;  1HCD A;  2NYY A;  4LO0 C;  3Q7W A;  3T8S A;  2Z49 A;  3OBR A;  4R6U B;  4D8H A;  1FWU A;  1WD3 A;  2K4A B;  1F31 A;  21BI A;  4L4I A;  4I96 A;  1JQZ A;  3QR5 A;  4OW4 A;  3BA7 A;  2VSA A;  3PUB A;  2NM1 A;  3BAU A;  5FNX A;  1E0O A;  1NZK A;  1XHB A;  3CAH A;  4Q9G A;  4OWL A;  3FJJ A;  4ZOT A;  3FFZ A;  2D22 A;  2Y9X E;  4I2S A;  3BAG A;  4EB2 B;  4ZFW B;  1V6U A;  2MC2 A;  1WD4 A;  3EF2 A;  1M16 A;  4EFP A;  3V0A B;  1M2T B;  3NBD A;  4HJJ A;  3RTI B;  2DRZ A;  3N7J A;  5EHA A;  5FZZ A;  1WBC A;  1Z4S A;  2P23 A;  1AVA C;  1JY0 A;  1I1E A;  4OEF A;  1TWM A;  3OJM A;  2FFV A;  1W3A A;  3B9U A;  3CA6 A;  2AXM A;  3NBC A;  3RMY A;  1JLX A;  4LO2 A;  3P53 A;  4FGF A;  1EV2 A;  1FMM S;  1BAR A;  1L2H A;  5GAQ A;  3H6R A;  4OWJ A;  4I3N A;  3CA0 A;  1NUN A;  1AVW B;  2VXT I;  41BI A;  3UJ4 A;  3V0B A;  3O4A A;  3VSZ A;  3FJC A;  1N4K A;  3OBT A;  2J3P A;  1EYL A;  1HWN B;  3WA1 A;  4XFS A;  2F8X C;  4QC4 A;  1R8N A;  1IHK A;  5DVH A;  1DLL A;  3CQA A;  2L5X A;  4LO8 B;  1S0G A;  1EPW A;  2K8R A;  3FJE A;  2NTD A;  5EG6 C;  3WIN A;  4HA2 A;  1DQO A;  4P0L A;  1FMZ A;  6I1B A;  3H6Q A;  2ZQO A;  1TWE A;  1XZZ A;  1K5V A;  3HMY A;  4JKX B;  3WO4 A;  1DIW A;  1TFM B;  4TLP A;  3RTJ B;  4LO1 A;  3KMV A;  1J0S A;  3PME A;  1S0E A;  3CRG A;  3BAQ A;  3NJ5 A;  4EFQ A;  4EKX B;  1V6X A;  4I4S A;  4I0Y A;  4G6J A;  4I4V A;  2DRY A;  3O4D A;  4OEG A;  1RZO B;  4ZBV B;  4YOL A;  4LO0 A;  2ERM A;  3O4C A;  3BTA A;  4A7Z A;  1PZZ A;  1Q04 A;  1Z2V A;  3BRF A;  3FUO A;  5BXP A;  3FJ9 A;  4X37 A;  2AAI B;  3FJA A;  5EC5 A;  1D0H A;  2VXR A;  3O4B A;  4OWK A;  4X38 A;  3ZXG A;  1QQK A;  1RG8 A;  2HW9 A;  1ILR 1;  4A7K A;  3VUO A;  5BXS A;  3O4O A;  4J2X A;  3W9T A;  1II4 A;  4P0K A;  1IRA X;  4I4X A;  1R8O A;  5BXT A;  2IWT B;  4Q9P A;  1P63 A;  5JLV A;  3UJ0 A;  4QD2 B;  4IQP A;  4JAW A;  1IJT A;  2DRE A;  2YUG A;  3JUT A;  4I4O A;  1FWV A;  3H6S E;  3N0K A;  1HWO B;  4EFR A;  1BAS A;  5BVP I;  2AFG A;  4KBB A;  5JMC A;  2Y9G A;  4G9N A;  3RSJ A;  4I4Q A;  1JT7 A;  2ET2 A;  4MZH A;  4ZA3 B;  2QYI B;  1Z0H A;  5F90 A;  3VEQ A;  1V6V A;  3BX1 C;  4GP3 A;  3P6J A;  1FN0 A;  1TP0 A;  4Z9W B;  2ZR1 B;  2GO2 A;  2IHO A;  4J23 B;  3Q7Y A;  1IRP A;  1ISZ A;  4I1B A;  4JKQ A;  2AQZ A;  4A7Y A;  1HWP B;  2FDB M;  2WBC A;  4IY8 A;  3WMU A;  1XG6 A;  2X2S A;  3CA5 A;  1T9F A;  4ZKT B;  4JRA A;  3AZW A;  4G9M A;  1BFC A;  3E8L C;  1Q03 A;  1IT0 A;  3FJ8 A;  3TC2 A;  1VCL A;  4FVV A;  4DEP A;  2QN4 A;  4QD2 C;  1PUU B;  4QBV A;  2VSE A;  2D1Z A;  4AN7 B;  5BP5 C;  5D62 A;  3ZC8 A;  3F62 B;  4ISQ A;  1T4Q A;  3NBE A;  2D7I A;  4PC4 A;  2ZQN A;  3F1R A;  3H6R B;  1K5U A;  3VT2 A;  1AF9 A;  4KEJ A;  1YXW A;  1FV3 A;  3BAD A;  3WMV A;  4ZFY B;  1EVT A;  2Y9W C;  1S0C A;  3RMX A;  4II0 A;  1YYN A;  1S0B A;  3AKF A;  1UPS A;  1ISW A;  1ISV A;  3CA3 A;  5BQU A;  4I6I A;  3NBN A;  4MZG B;  1SR4 A;  5DZU A;  4OEE A;  1G9A A;  3IM5 A;  3FJB A;  4XKI A;  4H04 A;  1DFQ A;  2MIB A;  1BLA A;  1ABR B;  3HOM A;  4J2S A;  1ITB A;  3P6I A;  1Q1U A;  4OUJ A;  4USO A;  2BEB A;  1AXM A;  3IM6 A;  3K1X A;  4I7I A;  3I29 B;  2DS0 A;  1JLY A;  3AH4 A;  2LIQ A;  1AVX B;  3BAO A;  2R9K B;  3VT1 A;  3D7W B;  3LTQ A;  5I1B A;  5E24 E;  3O49 A;  3AH2 A;  4ZFU B;  1BLD A;  4J2Y A;  4LO2 C;  5DSS B;  3VSF A;  2BEA A;  4LO3 C;  4XFT A;  1SZ6 B;  4G1R A;  4JQ0 A;  4ZGR B;  4H9W A;  3FJD A;  4LO7 B;  4KC3 A;  1AFC A;  3O5W B;  7I1B A;  4D0Z A;  5DUY A;  1RML A;  4GP0 A;  2Q3N B;  3QYD A;  4I4P A;  2BFH A;  1HCE A;  5BOW A;  2HZ9 A;  2FGF A;  2LIE A;  4X3A A;  2X2T A;  3AKI A;  3FJH A;  2WRY A;  3Q7X A;  3R4S A;  3AJ6 A;  2RST A;  1FGA A;  3HAL A;  4I4Y A;  4GOV A;  3UDA A;  3S8J A;  3PG0 A;  5F8Y A;  5BXR A;  2F2F C;  3S8K A;  3IAG C;  1A8D A;  3HSM A;  3WO3 A;  5G00 A;  2M49 A;  2KI6 B;  3BB2 A;  3C9Z A;  4LO1 C;  4GAF A;  4END A;  3HBW A;  2HWM A;  1DZC A;  2KH2 A;  3AZV A;  1IIL A;  1MD6 A;  2NZ9 A;  4P6A A;  4ION A;  5F8S A;  3UD8 A;  2D20 A;  4QO3 A;  4ZLB B;  4I8M A;  4I1E A;  1W3F A;  2VLC A;  3IIR A;  1G9D A;  3AKG A;  4JPZ A;  1BFB A;  4LO7 C;  1ISY A;  3N7K A;  4L4H A;  4F34 A;  3UD9 A;  1PUM B;  2P39 A;  2NP0 A;  2D44 A;  2E4M C;  2KLL A;  3N7L A;  3BA4 A;  2Q9X A;  1KNM A;  4P0J A;  3OJV A;  4F83 A;  3POK A;  1S0L A;  1IOB A;  1AVU A;  3V0A A;  1MC9 A;  3FUQ A;  3V79 C;  4IY9 A;  1FV2 A;  4DEN A;  1V6W A;  4Z8S B;  5D61 A;  1OQL B;  3BA5 A;  5FZY A;  1ISX A;  4XFU A;  3FJK A;  3CRH A;  4H75 A;  31BI A;  2VU9 A;  4GAI A;  2FFU A;  1G9C A;  1QXM A;  4QKR A;  3VT0 A;  3MAL A;  4MZF B;  3SNV A;  1JT4 A;  3BAV A;  4AN6 A;  3A07 A;  3V0B B;  4CJM A;  3CRI A;  3AH1 A;  1TIE A; 
#chains in the Genus database with same CATH homology
 1HKN A;  2GZB A;  3I2X A;  4LO3 A;  1G82 A;  4UY4 A;  4HR6 C;  4G6M A;  2D7R A;  4ISR A;  1QQL A;  3CA1 A;  3CU1 B;  3PHZ A;  1HIB A;  4KEI A;  3ZC9 A;  4QAL A;  2UUS A;  1I1B A;  2RG9 B;  4IZE A;  1WBA A;  3CA4 A;  1W3G A;  3UD7 A;  3ZXD A;  3FGM A;  4IZX A;  3N7M A;  4USP A;  4QBC A;  4WBC A;  4QKS A;  1YBI A;  3AJ5 A;  1PWA A;  2Y9F A;  3BRD A;  3A23 A;  1JTC A;  1RY7 A;  1YF8 B;  2F2F A;  3OGG A;  3R4U A;  3OJ2 A;  4IYB A;  4Q91 A;  1TTU A;  5D63 A;  2FO1 A;  4X39 A;  1CVS A;  2XOA A;  1CE7 B;  8I1B A;  4EEE B;  1YTO A;  2D24 A;  1HWM B;  1XYF A;  2KKI A;  4J2K A;  4D0T A;  2K43 A;  4GOY A;  5F8W A;  3I2A A;  2Z48 A;  3OGF A;  2I1B A;  1DZD A;  2HWA A;  3FJF A;  3IM7 A;  5FZU A;  3LLP A;  1GGP B;  5FNW A;  3O44 A;  1BFG A;  2NVH A;  3JRR A;  5BQU C;  2NS2 A;  1JT5 A;  1SR4 C;  3BAH A;  2D23 A;  3WIN C;  1S0D A;  9ILB A;  2E4M A;  4DCK C;  1DJS B;  1BA7 A;  4I37 A;  2D43 A;  1PC8 B;  3FJI A;  3ZX7 A;  1TOO A;  3A21 A;  4I4U A;  3VWC A;  5HPZ A;  1S0F A;  4I4R A;  1G9B A;  1BFF A;  3AKH A;  4KEK A;  3WO2 A;  3A22 A;  1DQG A;  3ILA A;  5B2H A;  3MPP G;  1ONK B;  1FQ9 A;  4IHZ A;  5BP5 A;  2KI4 A;  4JP0 A;  1DFC A;  3BRG C;  2MLL B;  3O3Q A;  2VUA A;  3HN1 A;  1JT3 A;  2ESU A;  2RQ9 A;  1HCD A;  2NYY A;  4LO0 C;  3Q7W A;  3T8S A;  2Z49 A;  3OBR A;  4R6U B;  4D8H A;  1FWU A;  1WD3 A;  2K4A B;  1F31 A;  21BI A;  4L4I A;  4I96 A;  1JQZ A;  3QR5 A;  4OW4 A;  3BA7 A;  2VSA A;  3PUB A;  2NM1 A;  3BAU A;  5FNX A;  1E0O A;  1NZK A;  1XHB A;  3CAH A;  4Q9G A;  4OWL A;  3FJJ A;  4ZOT A;  3FFZ A;  2D22 A;  2Y9X E;  4I2S A;  3BAG A;  4EB2 B;  4ZFW B;  1V6U A;  2MC2 A;  1WD4 A;  3EF2 A;  1M16 A;  4EFP A;  3V0A B;  1M2T B;  3NBD A;  4HJJ A;  3RTI B;  2DRZ A;  3N7J A;  5EHA A;  5FZZ A;  1WBC A;  1Z4S A;  2P23 A;  1AVA C;  1JY0 A;  1I1E A;  4OEF A;  1TWM A;  3OJM A;  2FFV A;  1W3A A;  3B9U A;  3CA6 A;  2AXM A;  3NBC A;  3RMY A;  1JLX A;  4LO2 A;  3P53 A;  4FGF A;  1EV2 A;  1FMM S;  1BAR A;  1L2H A;  5GAQ A;  3H6R A;  4OWJ A;  4I3N A;  3CA0 A;  1NUN A;  1AVW B;  2VXT I;  41BI A;  3UJ4 A;  3V0B A;  3O4A A;  3VSZ A;  3FJC A;  1N4K A;  3OBT A;  2J3P A;  1EYL A;  1HWN B;  3WA1 A;  4XFS A;  2F8X C;  4QC4 A;  1R8N A;  1IHK A;  5DVH A;  1DLL A;  3CQA A;  2L5X A;  4LO8 B;  1S0G A;  1EPW A;  2K8R A;  3FJE A;  2NTD A;  5EG6 C;  3WIN A;  4HA2 A;  1DQO A;  4P0L A;  1FMZ A;  6I1B A;  3H6Q A;  2ZQO A;  1TWE A;  1XZZ A;  1K5V A;  3HMY A;  4JKX B;  3WO4 A;  1DIW A;  1TFM B;  4TLP A;  3RTJ B;  4LO1 A;  3KMV A;  1J0S A;  3PME A;  1S0E A;  3CRG A;  3BAQ A;  3NJ5 A;  4EFQ A;  4EKX B;  1V6X A;  4I4S A;  4I0Y A;  4G6J A;  4I4V A;  2DRY A;  3O4D A;  4OEG A;  1RZO B;  4ZBV B;  4YOL A;  4LO0 A;  2ERM A;  3O4C A;  3BTA A;  4A7Z A;  1PZZ A;  1Q04 A;  1Z2V A;  3BRF A;  3FUO A;  5BXP A;  3FJ9 A;  4X37 A;  2AAI B;  3FJA A;  5EC5 A;  1D0H A;  2VXR A;  3O4B A;  4OWK A;  4X38 A;  3ZXG A;  1QQK A;  1RG8 A;  2HW9 A;  1ILR 1;  4A7K A;  3VUO A;  5BXS A;  3O4O A;  4J2X A;  3W9T A;  1II4 A;  4P0K A;  1IRA X;  4I4X A;  1R8O A;  5BXT A;  2IWT B;  4Q9P A;  1P63 A;  5JLV A;  3UJ0 A;  4QD2 B;  4IQP A;  4JAW A;  1IJT A;  2DRE A;  2YUG A;  3JUT A;  4I4O A;  1FWV A;  3H6S E;  3N0K A;  1HWO B;  4EFR A;  1BAS A;  5BVP I;  2AFG A;  4KBB A;  5JMC A;  2Y9G A;  4G9N A;  3RSJ A;  4I4Q A;  1JT7 A;  2ET2 A;  4MZH A;  4ZA3 B;  2QYI B;  1Z0H A;  5F90 A;  3VEQ A;  1V6V A;  3BX1 C;  4GP3 A;  3P6J A;  1FN0 A;  1TP0 A;  4Z9W B;  2ZR1 B;  2GO2 A;  2IHO A;  4J23 B;  3Q7Y A;  1IRP A;  1ISZ A;  4I1B A;  4JKQ A;  2AQZ A;  4A7Y A;  1HWP B;  2FDB M;  2WBC A;  4IY8 A;  3WMU A;  1XG6 A;  2X2S A;  3CA5 A;  1T9F A;  4ZKT B;  4JRA A;  3AZW A;  4G9M A;  1BFC A;  3E8L C;  1Q03 A;  1IT0 A;  3FJ8 A;  3TC2 A;  1VCL A;  4FVV A;  4DEP A;  2QN4 A;  4QD2 C;  1PUU B;  4QBV A;  2VSE A;  2D1Z A;  4AN7 B;  5BP5 C;  5D62 A;  3ZC8 A;  3F62 B;  4ISQ A;  1T4Q A;  3NBE A;  2D7I A;  4PC4 A;  2ZQN A;  3F1R A;  3H6R B;  1K5U A;  3VT2 A;  1AF9 A;  4KEJ A;  1YXW A;  1FV3 A;  3BAD A;  3WMV A;  4ZFY B;  1EVT A;  2Y9W C;  1S0C A;  3RMX A;  4II0 A;  1YYN A;  1S0B A;  3AKF A;  1UPS A;  1ISW A;  1ISV A;  3CA3 A;  5BQU A;  4I6I A;  3NBN A;  4MZG B;  1SR4 A;  5DZU A;  4OEE A;  1G9A A;  3IM5 A;  3FJB A;  4XKI A;  4H04 A;  1DFQ A;  2MIB A;  1BLA A;  1ABR B;  3HOM A;  4J2S A;  1ITB A;  3P6I A;  1Q1U A;  4OUJ A;  4USO A;  2BEB A;  1AXM A;  3IM6 A;  3K1X A;  4I7I A;  3I29 B;  2DS0 A;  1JLY A;  3AH4 A;  2LIQ A;  1AVX B;  3BAO A;  2R9K B;  3VT1 A;  3D7W B;  3LTQ A;  5I1B A;  5E24 E;  3O49 A;  3AH2 A;  4ZFU B;  1BLD A;  4J2Y A;  4LO2 C;  5DSS B;  3VSF A;  2BEA A;  4LO3 C;  4XFT A;  1SZ6 B;  4G1R A;  4JQ0 A;  4ZGR B;  4H9W A;  3FJD A;  4LO7 B;  4KC3 A;  1AFC A;  3O5W B;  7I1B A;  4D0Z A;  5DUY A;  1RML A;  4GP0 A;  2Q3N B;  3QYD A;  4I4P A;  2BFH A;  1HCE A;  5BOW A;  2HZ9 A;  2FGF A;  2LIE A;  4X3A A;  2X2T A;  3AKI A;  3FJH A;  2WRY A;  3Q7X A;  3R4S A;  3AJ6 A;  2RST A;  1FGA A;  3HAL A;  4I4Y A;  4GOV A;  3UDA A;  3S8J A;  3PG0 A;  5F8Y A;  5BXR A;  2F2F C;  3S8K A;  3IAG C;  1A8D A;  3HSM A;  3WO3 A;  5G00 A;  2M49 A;  2KI6 B;  3BB2 A;  3C9Z A;  4LO1 C;  4GAF A;  4END A;  3HBW A;  2HWM A;  1DZC A;  2KH2 A;  3AZV A;  1IIL A;  1MD6 A;  2NZ9 A;  4P6A A;  4ION A;  5F8S A;  3UD8 A;  2D20 A;  4QO3 A;  4ZLB B;  4I8M A;  4I1E A;  1W3F A;  2VLC A;  3IIR A;  1G9D A;  3AKG A;  4JPZ A;  1BFB A;  4LO7 C;  1ISY A;  3N7K A;  4L4H A;  4F34 A;  3UD9 A;  1PUM B;  2P39 A;  2NP0 A;  2D44 A;  2E4M C;  2KLL A;  3N7L A;  3BA4 A;  2Q9X A;  1KNM A;  4P0J A;  3OJV A;  4F83 A;  3POK A;  1S0L A;  1IOB A;  1AVU A;  3V0A A;  1MC9 A;  3FUQ A;  3V79 C;  4IY9 A;  1FV2 A;  4DEN A;  1V6W A;  4Z8S B;  5D61 A;  1OQL B;  3BA5 A;  5FZY A;  1ISX A;  4XFU A;  3FJK A;  3CRH A;  4H75 A;  31BI A;  2VU9 A;  4GAI A;  2FFU A;  1G9C A;  1QXM A;  4QKR A;  3VT0 A;  3MAL A;  4MZF B;  3SNV A;  1JT4 A;  3BAV A;  4AN6 A;  3A07 A;  3V0B B;  4CJM A;  3CRI A;  3AH1 A;  1TIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...