2LIRA

Nmr solution structure of yeast iso-1-cytochrome c mutant p71h in oxidized states
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNHAKYIPGTKMAFGGLKKEKDRNDLITYLKKATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c iso-1
publication title Conformational toggling of yeast iso-1-cytochrome C in the oxidized and reduced States.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Metal transport
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2lirA00
5B5EV 2ORLA 1FOCA 3L70D 3RN1A 1YEBA 1CSWA 2MTAC 2OZ1B 3H1HD 2N3YA 1QL4A 3SJLA 1COTA 1GDVA 1HJ3A 1C7MA 1CIFA 1MG3D 5CIDB 1KB9D 2YK3A 1CEDA 3ZCFA 2B0ZB 1BE3D 2YIUB 2I8FA 3HQ6A 1FJ0A 4FA4A 1GQ1A 3O20A 1RZ5A 3O1YA 1NIRA 2GIWA 1PP9D 5C0ZA 1ETPA 1N9CA 1CHIA 1FHBA 3CU4A 3L72D 1NTKD 4GYDA 5E79V 1VYDA 1C2RA 3L71D 1KV9A 3RMZA 2C2CA 2FRCA 1OCDA 3L4OA 5KLIB 3L74D 2IBZD 2B10B 4U3FD 3SLEA 3H1JD 2DVHA 3ORVA 4AX3A 1IRVA 2GB8B 1YCCA 1S5LV 1HROA 2BPBB 1H31B 3MK7B 4WQCA 1CSUA 2N18B 3ZOXA 4EIFA 4EIEA 1CTYA 1DIQC 2D0WA 5DJQB 1L9BC 2QJPB 1E8EA 1CSXA 4XXLA 4O1QA 1CO6A 5GTHV 2B11B 3HQ7A 1P84D 4IL6V 1I54A 3OCDB 3PXSA 1SQVD 1C75A 2GC4D 1KIBA 1YFCA 2ZOOA 2LIRA 4L3HA 1I5TA 4NFGB 3RN0A 2A06D 1NTMD 3L75D 4K3IA 451CA 3DR0A 1A2SA 2LITA 1A56A 2ZZS1 4V2KA 1HZUA 2N3BA 1NMIA 3SXTA 155CA 3VRDA 1I6EA 3PXWA 2BCNB 3ZOOA 3O0RC 5KKZB 3WFCC 3ZBMA 1L0ND 4UB6V 1DT1A 1IZL0 1N50A 5CIHB 1SQXD 1SQBD 1FI9A 5CIBB 4Y5RA 3SVWA 1WVEC 2JQRA 1DW0A 1LC2A 1LC1A 1CCHA 1CIHA 4WQAA 4O1WA 3ZOWA 2BGVX 1CYCA 3NBTA 1MZ4A 5CIFB 2GC7D 3C2CA 1F1CA 1A8CA 1CXCA 4MU8A 2C1VA 3X39A 1H9XA 4AAOA 1J3SA 5C9MA 2FYUD 1KYOW 1KX2A 4FANA 4JCGA 4KMGA 4PJ0V 3SWSA 3TYIA 351CA 1H9YA 1B7VA 1L0LD 1YEAA 3DMIA 1DW3A 1CRJA 1LMSA 1WEJF 3VYMA 2ZXYA 3OA8A 3WFEC 1CTJA 2C1DA 1C6SA 1EB7A 3HQ9A 4GEDB 5KAFV 2HV4A 1BL9A 1QL3A 2MHMA 1BCCD 2QJKB 1H1OA 2JTIB 1CIEA 1EZVD 1CYJA 1F1FA 1I8PA 2B4ZA 5CIGB 1H32B 4FB1A 3WC8A 2N18C 1CRCA 3JBTB 2C9XB 3L4MA 1M70A 1CC5A 5KLVD 3H1ID 5DJQC 3CX5W 4P4QB 1IO3A 4QAOA 4L1QA 1NTZD 4L3GA 3CXHW 2CA3B 1GU2A 2ZONG 5AURA 1C52A 3WFDC 5GTIV 1R0QA 1L9JC 3PXTA 1HH7A 3BCCD 1GKSA 1HJ4A 3DP5A 1LFMA 3HQ8A 4WQ9A 4WQEA 1AOQA 1AYGA 4WQ7A 1CRIA 3A9FA 2C8SA 3ZOYA 4EICA 4WQ8A 2YCCA 4WQDA 3CWBD 1K3GA 1M60A 2L4DA 1RAQA 1H33A 2BCCD 3WFBC 1GIWA 4YE1A 1H31A 1CTZA 2C1DB 4FA5A 3PH2B 3CP5A 3NWVA 2QJYB 1N90A 1HZVA 5B66V 3A0BV 1RZ6A 3A0HV 1C6RA 2YQBA 1CRYA 1K3HA 1W2LA 1FI7A 1RAPA 1M6ZA 2N9JA 4PWAA 1YTCA 1HCMA 3H1KD 1CHHA 2CE1A 3O5CA 2ZBOA 1FI3A 3OCDA 1SQPD 3VNWA 2AXTV 1DIIC 1YIQA 1I6DA 2N9IA 1DW1A 1C6OA 1KX7A 5TISV 1NU1D 1IQCA 1SQQD 1CCRA 1IRWA 1AOFA 1E29A 2PACA 1HRCA 1KYOD 1DVVA 4AAMA 5CICB 1CYIA 4FAVA 2FWLA 1LS9A 4N0KA 4WQBA 4H0KA 2FYNB 1HJ5A 3MK7C 2B12B 4Q5PA 4EIDA 2XTSB 2AI5A 1OAEA 3M97X 1CORA 3ZIYA 1QKSA 2OZ1A 5H2FV 2V08A 2PCBB 3WU2V 3KZIV 1I8OA 2BLFB 1W5CT 1C2NA 5KAIV 2CA4B 2BH4X 3WUIA 3NBSA 4J20A 4PW9B 1H33B 4FA1A 4RSZA 1U74B 1DW2A 5IY51 2DGEA 4LJIA 4DY9A 3H1LD 1CIGA 1YICA 1JDLA 1ZZHA 5CIEB 2PCCB 1NNOA 2V07A 2VHDA 3CX5D 4PD4D 4XYDB 2EXVA 1N15A 1U75B 2BH5X 2CXBA 3CYTI 2CE0A 5DFSA 1YNRA 1BGYD 1CNOA 2AIUA 4H0JA 1CRGA 1CXAA 3CXHD 1S6VB 5DF5A 3L73D 4AALA 1CSVA 1E2RA 3TGUD 4FA9A 2C1UA 1AKKA 1H32A 1QYZA 5CYTR 1CRHA 4D6TD 2D0SA 4UB8V 5EXQA 1ZRTD 3OA8B 1MG2D 5B6QA 3RLMA 1I55A 1DVHA 4AANA 1GJQA 1CHJA 1NMLA 1QN2A 1PPJD 1FCDC 1KB0A
chains in the Genus database with same CATH superfamily
5B5EV 2ORLA 1FOCA 3L70D 3RN1A 1YEBA 1CSWA 2MTAC 2OZ1B 3H1HD 2N3YA 1QL4A 3SJLA 1COTA 1GDVA 1HJ3A 1C7MA 1CIFA 1MG3D 5CIDB 1KB9D 2YK3A 1CEDA 3ZCFA 2B0ZB 1BE3D 2YIUB 2I8FA 3HQ6A 1FJ0A 4FA4A 1GQ1A 3O20A 1RZ5A 3O1YA 1NIRA 2GIWA 1PP9D 5C0ZA 1ETPA 1N9CA 1CHIA 1FHBA 3CU4A 3L72D 1NTKD 4GYDA 5E79V 1VYDA 1C2RA 3L71D 1KV9A 3RMZA 2C2CA 2FRCA 1OCDA 3L4OA 5KLIB 3L74D 2IBZD 2B10B 4U3FD 3SLEA 3H1JD 2DVHA 3ORVA 4AX3A 1IRVA 2GB8B 1YCCA 1S5LV 1HROA 2BPBB 1H31B 3MK7B 4WQCA 1CSUA 2N18B 3ZOXA 4EIFA 4EIEA 1CTYA 1DIQC 2D0WA 5DJQB 1L9BC 2QJPB 1E8EA 1CSXA 4XXLA 4O1QA 1CO6A 5GTHV 2B11B 3HQ7A 1P84D 4IL6V 1I54A 3OCDB 3PXSA 1SQVD 1C75A 2GC4D 1KIBA 1YFCA 2ZOOA 2LIRA 4L3HA 1I5TA 4NFGB 3RN0A 2A06D 1NTMD 3L75D 4K3IA 451CA 3DR0A 1A2SA 2LITA 1A56A 2ZZS1 4V2KA 1HZUA 2N3BA 1NMIA 3SXTA 155CA 3VRDA 1I6EA 3PXWA 2BCNB 3ZOOA 3O0RC 5KKZB 3WFCC 3ZBMA 1L0ND 4UB6V 1DT1A 1IZL0 1N50A 5CIHB 1SQXD 1SQBD 1FI9A 5CIBB 4Y5RA 3SVWA 1WVEC 2JQRA 1DW0A 1LC2A 1LC1A 1CCHA 1CIHA 4WQAA 4O1WA 3ZOWA 2BGVX 1CYCA 3NBTA 1MZ4A 5CIFB 2GC7D 3C2CA 1F1CA 1A8CA 1CXCA 4MU8A 2C1VA 3X39A 1H9XA 4AAOA 1J3SA 5C9MA 2FYUD 1KYOW 1KX2A 4FANA 4JCGA 4KMGA 4PJ0V 3SWSA 3TYIA 351CA 1H9YA 1B7VA 1L0LD 1YEAA 3DMIA 1DW3A 1CRJA 1LMSA 1WEJF 3VYMA 2ZXYA 3OA8A 3WFEC 1CTJA 2C1DA 1C6SA 1EB7A 3HQ9A 4GEDB 5KAFV 2HV4A 1BL9A 1QL3A 2MHMA 1BCCD 2QJKB 1H1OA 2JTIB 1CIEA 1EZVD 1CYJA 1F1FA 1I8PA 2B4ZA 5CIGB 1H32B 4FB1A 3WC8A 2N18C 1CRCA 3JBTB 2C9XB 3L4MA 1M70A 1CC5A 5KLVD 3H1ID 3D0WA 5DJQC 3CX5W 4P4QB 1IO3A 4QAOA 4L1QA 1NTZD 4L3GA 3CXHW 2CA3B 1GU2A 2ZONG 5AURA 1C52A 3WFDC 5GTIV 1R0QA 1L9JC 3PXTA 1HH7A 3BCCD 1GKSA 1HJ4A 3DP5A 1LFMA 3HQ8A 4WQ9A 4WQEA 1AOQA 1AYGA 4WQ7A 1CRIA 3A9FA 2C8SA 3ZOYA 4EICA 4WQ8A 2YCCA 4WQDA 3CWBD 1K3GA 1M60A 2L4DA 1RAQA 1H33A 2BCCD 3WFBC 1GIWA 4YE1A 1H31A 1CTZA 2C1DB 4FA5A 3PH2B 3CP5A 3NWVA 2QJYB 1N90A 1HZVA 5B66V 3A0BV 1RZ6A 3A0HV 1C6RA 2YQBA 1CRYA 1K3HA 1W2LA 1FI7A 1RAPA 1M6ZA 2N9JA 4PWAA 1YTCA 1HCMA 3H1KD 1CHHA 2CE1A 3O5CA 2ZBOA 1FI3A 3OCDA 1SQPD 3VNWA 2AXTV 1DIIC 1YIQA 1I6DA 2N9IA 1DW1A 1C6OA 1KX7A 5TISV 1NU1D 1IQCA 1SQQD 1CCRA 1IRWA 1AOFA 1E29A 2PACA 1HRCA 1KYOD 1DVVA 4AAMA 5CICB 1CYIA 4FAVA 2FWLA 1LS9A 4N0KA 4WQBA 4H0KA 2FYNB 1HJ5A 3MK7C 2B12B 4Q5PA 4EIDA 2XTSB 2AI5A 1OAEA 3M97X 1CORA 3ZIYA 1QKSA 2OZ1A 5H2FV 2V08A 2PCBB 3WU2V 3KZIV 1I8OA 2BLFB 1W5CT 1C2NA 5KAIV 2CA4B 2BH4X 3WUIA 3NBSA 4J20A 4PW9B 1H33B 4FA1A 4RSZA 1U74B 1DW2A 5IY51 2DGEA 4LJIA 4DY9A 3H1LD 1CIGA 1YICA 1JDLA 1ZZHA 5CIEB 2PCCB 1NNOA 2V07A 2VHDA 3CX5D 4PD4D 4XYDB 2EXVA 1N15A 1U75B 2BH5X 2CXBA 3CYTI 2CE0A 5DFSA 1YNRA 1BGYD 1CNOA 2AIUA 4H0JA 1CRGA 1CXAA 3CXHD 1S6VB 5DF5A 3L73D 4AALA 1CSVA 1E2RA 3TGUD 4FA9A 2C1UA 1AKKA 1H32A 1QYZA 5CYTR 1CRHA 4D6TD 2D0SA 4UB8V 5EXQA 1ZRTD 3OA8B 1MG2D 5B6QA 3RLMA 1I55A 1DVHA 4AANA 1GJQA 1CHJA 1NMLA 1QN2A 1PPJD 1FCDC 1KB0A
chains in the Genus database with same CATH topology
5B5EV 2ORLA 1FOCA 3L70D 3RN1A 1YEBA 1CSWA 2MTAC 2OZ1B 3H1HD 2N3YA 1QL4A 3SJLA 1COTA 1GDVA 1HJ3A 1C7MA 1CIFA 1MG3D 5CIDB 1KB9D 2YK3A 1CEDA 3ZCFA 2B0ZB 1BE3D 2YIUB 2I8FA 3HQ6A 1FJ0A 4FA4A 1GQ1A 3O20A 1RZ5A 3O1YA 1NIRA 2GIWA 1PP9D 5C0ZA 1ETPA 1N9CA 1CHIA 1FHBA 3CU4A 3L72D 1NTKD 4GYDA 5E79V 1VYDA 1C2RA 3L71D 1KV9A 3RMZA 2C2CA 2FRCA 1OCDA 3L4OA 5KLIB 3L74D 2IBZD 2B10B 4U3FD 3SLEA 3H1JD 2DVHA 3ORVA 4AX3A 1IRVA 2GB8B 1YCCA 1S5LV 1HROA 2BPBB 1H31B 3MK7B 4WQCA 1CSUA 2N18B 3ZOXA 4EIFA 4EIEA 1CTYA 1DIQC 2D0WA 5DJQB 1L9BC 2QJPB 1E8EA 1CSXA 4XXLA 4O1QA 1CO6A 5GTHV 2B11B 3HQ7A 1P84D 4IL6V 1I54A 3OCDB 3PXSA 1SQVD 1C75A 2GC4D 1KIBA 1YFCA 2ZOOA 2LIRA 4L3HA 1I5TA 4NFGB 3RN0A 2A06D 1NTMD 3L75D 4K3IA 451CA 3DR0A 1A2SA 2LITA 1A56A 2ZZS1 4V2KA 1HZUA 2N3BA 1NMIA 3SXTA 155CA 3VRDA 1I6EA 3PXWA 2BCNB 3ZOOA 3O0RC 5KKZB 3WFCC 3ZBMA 1L0ND 4UB6V 1DT1A 1IZL0 1N50A 5CIHB 1SQXD 1SQBD 1FI9A 5CIBB 4Y5RA 3SVWA 1WVEC 2JQRA 1DW0A 1LC2A 1LC1A 1CCHA 1CIHA 4WQAA 4O1WA 3ZOWA 2BGVX 1CYCA 3NBTA 1MZ4A 5CIFB 2GC7D 3C2CA 1F1CA 1A8CA 1CXCA 4MU8A 2C1VA 3X39A 1H9XA 4AAOA 1J3SA 5C9MA 2FYUD 1KYOW 1KX2A 4FANA 4JCGA 4KMGA 4PJ0V 3SWSA 3TYIA 351CA 1H9YA 1B7VA 1L0LD 1YEAA 3DMIA 1DW3A 1CRJA 1LMSA 1WEJF 3VYMA 2ZXYA 3OA8A 3WFEC 1CTJA 2C1DA 1C6SA 1EB7A 3HQ9A 4GEDB 5KAFV 2HV4A 1BL9A 1QL3A 2MHMA 1BCCD 2QJKB 1H1OA 2JTIB 1CIEA 1EZVD 1CYJA 1F1FA 1I8PA 2B4ZA 5CIGB 1H32B 4FB1A 3WC8A 2N18C 1CRCA 3JBTB 2C9XB 3L4MA 1M70A 1CC5A 5KLVD 3H1ID 5DJQC 3CX5W 4P4QB 1IO3A 4QAOA 4L1QA 1NTZD 4L3GA 3CXHW 2CA3B 1GU2A 2ZONG 5AURA 1C52A 3WFDC 5GTIV 1R0QA 1L9JC 3PXTA 1HH7A 3BCCD 1GKSA 1HJ4A 3DP5A 1LFMA 3HQ8A 4WQ9A 4WQEA 1AOQA 1AYGA 4WQ7A 1CRIA 3A9FA 2C8SA 3ZOYA 4EICA 4WQ8A 2YCCA 4WQDA 3CWBD 1K3GA 1M60A 2L4DA 1RAQA 1H33A 2BCCD 3WFBC 1GIWA 4YE1A 1H31A 1CTZA 2C1DB 4FA5A 3PH2B 3CP5A 3NWVA 2QJYB 1N90A 1HZVA 5B66V 3A0BV 1RZ6A 3A0HV 1C6RA 2YQBA 1CRYA 1K3HA 1W2LA 1FI7A 1RAPA 1M6ZA 2N9JA 4PWAA 1YTCA 1HCMA 3H1KD 1CHHA 2CE1A 3O5CA 2ZBOA 1FI3A 3OCDA 1SQPD 3VNWA 2AXTV 1DIIC 1YIQA 1I6DA 2N9IA 1DW1A 1C6OA 1KX7A 5TISV 1NU1D 1IQCA 1SQQD 1CCRA 1IRWA 1AOFA 1E29A 2PACA 1HRCA 1KYOD 1DVVA 4AAMA 5CICB 1CYIA 4FAVA 2FWLA 1LS9A 4N0KA 4WQBA 4H0KA 2FYNB 1HJ5A 3MK7C 2B12B 4Q5PA 4EIDA 2XTSB 2AI5A 1OAEA 3M97X 1CORA 3ZIYA 1QKSA 2OZ1A 5H2FV 2V08A 2PCBB 3WU2V 3KZIV 1I8OA 2BLFB 1W5CT 1C2NA 5KAIV 2CA4B 2BH4X 3WUIA 3NBSA 4J20A 4PW9B 1H33B 4FA1A 4RSZA 1U74B 1DW2A 5IY51 2DGEA 4LJIA 4DY9A 3H1LD 1CIGA 1YICA 1JDLA 1ZZHA 5CIEB 2PCCB 1NNOA 2V07A 2VHDA 3CX5D 4PD4D 4XYDB 2EXVA 1N15A 1U75B 2BH5X 2CXBA 3CYTI 2CE0A 5DFSA 1YNRA 1BGYD 1CNOA 2AIUA 4H0JA 1CRGA 1CXAA 3CXHD 1S6VB 5DF5A 3L73D 4AALA 1CSVA 1E2RA 3TGUD 4FA9A 2C1UA 1AKKA 1H32A 1QYZA 5CYTR 1CRHA 4D6TD 2D0SA 4UB8V 5EXQA 1ZRTD 3OA8B 1MG2D 5B6QA 3RLMA 1I55A 1DVHA 4AANA 1GJQA 1CHJA 1NMLA 1QN2A 1PPJD 1FCDC 1KB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E V;  2ORL A;  1FOC A;  3L70 D;  3RN1 A;  1YEB A;  1CSW A;  2MTA C;  2OZ1 B;  3H1H D;  2N3Y A;  1QL4 A;  3SJL A;  1COT A;  1GDV A;  1HJ3 A;  1C7M A;  1CIF A;  1MG3 D;  5CID B;  1KB9 D;  2YK3 A;  1CED A;  3ZCF A;  2B0Z B;  1BE3 D;  2YIU B;  2I8F A;  3HQ6 A;  1FJ0 A;  4FA4 A;  1GQ1 A;  3O20 A;  1RZ5 A;  3O1Y A;  1NIR A;  2GIW A;  1PP9 D;  5C0Z A;  1ETP A;  1N9C A;  1CHI A;  1FHB A;  3CU4 A;  3L72 D;  1NTK D;  4GYD A;  5E79 V;  1VYD A;  1C2R A;  3L71 D;  1KV9 A;  3RMZ A;  2C2C A;  2FRC A;  1OCD A;  3L4O A;  5KLI B;  3L74 D;  2IBZ D;  2B10 B;  4U3F D;  3SLE A;  3H1J D;  2DVH A;  3ORV A;  4AX3 A;  1IRV A;  2GB8 B;  1YCC A;  1S5L V;  1HRO A;  2BPB B;  1H31 B;  3MK7 B;  4WQC A;  1CSU A;  2N18 B;  3ZOX A;  4EIF A;  4EIE A;  1CTY A;  1DIQ C;  2D0W A;  5DJQ B;  1L9B C;  2QJP B;  1E8E A;  1CSX A;  4XXL A;  4O1Q A;  1CO6 A;  5GTH V;  2B11 B;  3HQ7 A;  1P84 D;  4IL6 V;  1I54 A;  3OCD B;  3PXS A;  1SQV D;  1C75 A;  2GC4 D;  1KIB A;  1YFC A;  2ZOO A;  2LIR A;  4L3H A;  1I5T A;  4NFG B;  3RN0 A;  2A06 D;  1NTM D;  3L75 D;  4K3I A;  451C A;  3DR0 A;  1A2S A;  2LIT A;  1A56 A;  2ZZS 1;  4V2K A;  1HZU A;  2N3B A;  1NMI A;  3SXT A;  155C A;  3VRD A;  1I6E A;  3PXW A;  2BCN B;  3ZOO A;  3O0R C;  5KKZ B;  3WFC C;  3ZBM A;  1L0N D;  4UB6 V;  1DT1 A;  1IZL 0;  1N50 A;  5CIH B;  1SQX D;  1SQB D;  1FI9 A;  5CIB B;  4Y5R A;  3SVW A;  1WVE C;  2JQR A;  1DW0 A;  1LC2 A;  1LC1 A;  1CCH A;  1CIH A;  4WQA A;  4O1W A;  3ZOW A;  2BGV X;  1CYC A;  3NBT A;  1MZ4 A;  5CIF B;  2GC7 D;  3C2C A;  1F1C A;  1A8C A;  1CXC A;  4MU8 A;  2C1V A;  3X39 A;  1H9X A;  4AAO A;  1J3S A;  5C9M A;  2FYU D;  1KYO W;  1KX2 A;  4FAN A;  4JCG A;  4KMG A;  4PJ0 V;  3SWS A;  3TYI A;  351C A;  1H9Y A;  1B7V A;  1L0L D;  1YEA A;  3DMI A;  1DW3 A;  1CRJ A;  1LMS A;  1WEJ F;  3VYM A;  2ZXY A;  3OA8 A;  3WFE C;  1CTJ A;  2C1D A;  1C6S A;  1EB7 A;  3HQ9 A;  4GED B;  5KAF V;  2HV4 A;  1BL9 A;  1QL3 A;  2MHM A;  1BCC D;  2QJK B;  1H1O A;  2JTI B;  1CIE A;  1EZV D;  1CYJ A;  1F1F A;  1I8P A;  2B4Z A;  5CIG B;  1H32 B;  4FB1 A;  3WC8 A;  2N18 C;  1CRC A;  3JBT B;  2C9X B;  3L4M A;  1M70 A;  1CC5 A;  5KLV D;  3H1I D;  5DJQ C;  3CX5 W;  4P4Q B;  1IO3 A;  4QAO A;  4L1Q A;  1NTZ D;  4L3G A;  3CXH W;  2CA3 B;  1GU2 A;  2ZON G;  5AUR A;  1C52 A;  3WFD C;  5GTI V;  1R0Q A;  1L9J C;  3PXT A;  1HH7 A;  3BCC D;  1GKS A;  1HJ4 A;  3DP5 A;  1LFM A;  3HQ8 A;  4WQ9 A;  4WQE A;  1AOQ A;  1AYG A;  4WQ7 A;  1CRI A;  3A9F A;  2C8S A;  3ZOY A;  4EIC A;  4WQ8 A;  2YCC A;  4WQD A;  3CWB D;  1K3G A;  1M60 A;  2L4D A;  1RAQ A;  1H33 A;  2BCC D;  3WFB C;  1GIW A;  4YE1 A;  1H31 A;  1CTZ A;  2C1D B;  4FA5 A;  3PH2 B;  3CP5 A;  3NWV A;  2QJY B;  1N90 A;  1HZV A;  5B66 V;  3A0B V;  1RZ6 A;  3A0H V;  1C6R A;  2YQB A;  1CRY A;  1K3H A;  1W2L A;  1FI7 A;  1RAP A;  1M6Z A;  2N9J A;  4PWA A;  1YTC A;  1HCM A;  3H1K D;  1CHH A;  2CE1 A;  3O5C A;  2ZBO A;  1FI3 A;  3OCD A;  1SQP D;  3VNW A;  2AXT V;  1DII C;  1YIQ A;  1I6D A;  2N9I A;  1DW1 A;  1C6O A;  1KX7 A;  5TIS V;  1NU1 D;  1IQC A;  1SQQ D;  1CCR A;  1IRW A;  1AOF A;  1E29 A;  2PAC A;  1HRC A;  1KYO D;  1DVV A;  4AAM A;  5CIC B;  1CYI A;  4FAV A;  2FWL A;  1LS9 A;  4N0K A;  4WQB A;  4H0K A;  2FYN B;  1HJ5 A;  3MK7 C;  2B12 B;  4Q5P A;  4EID A;  2XTS B;  2AI5 A;  1OAE A;  3M97 X;  1COR A;  3ZIY A;  1QKS A;  2OZ1 A;  5H2F V;  2V08 A;  2PCB B;  3WU2 V;  3KZI V;  1I8O A;  2BLF B;  1W5C T;  1C2N A;  5KAI V;  2CA4 B;  2BH4 X;  3WUI A;  3NBS A;  4J20 A;  4PW9 B;  1H33 B;  4FA1 A;  4RSZ A;  1U74 B;  1DW2 A;  5IY5 1;  2DGE A;  4LJI A;  4DY9 A;  3H1L D;  1CIG A;  1YIC A;  1JDL A;  1ZZH A;  5CIE B;  2PCC B;  1NNO A;  2V07 A;  2VHD A;  3CX5 D;  4PD4 D;  4XYD B;  2EXV A;  1N15 A;  1U75 B;  2BH5 X;  2CXB A;  3CYT I;  2CE0 A;  5DFS A;  1YNR A;  1BGY D;  1CNO A;  2AIU A;  4H0J A;  1CRG A;  1CXA A;  3CXH D;  1S6V B;  5DF5 A;  3L73 D;  4AAL A;  1CSV A;  1E2R A;  3TGU D;  4FA9 A;  2C1U A;  1AKK A;  1H32 A;  1QYZ A;  5CYT R;  1CRH A;  4D6T D;  2D0S A;  4UB8 V;  5EXQ A;  1ZRT D;  3OA8 B;  1MG2 D;  5B6Q A;  3RLM A;  1I55 A;  1DVH A;  4AAN A;  1GJQ A;  1CHJ A;  1NML A;  1QN2 A;  1PPJ D;  1FCD C;  1KB0 A; 
#chains in the Genus database with same CATH topology
 5B5E V;  2ORL A;  1FOC A;  3L70 D;  3RN1 A;  1YEB A;  1CSW A;  2MTA C;  2OZ1 B;  3H1H D;  2N3Y A;  1QL4 A;  3SJL A;  1COT A;  1GDV A;  1HJ3 A;  1C7M A;  1CIF A;  1MG3 D;  5CID B;  1KB9 D;  2YK3 A;  1CED A;  3ZCF A;  2B0Z B;  1BE3 D;  2YIU B;  2I8F A;  3HQ6 A;  1FJ0 A;  4FA4 A;  1GQ1 A;  3O20 A;  1RZ5 A;  3O1Y A;  1NIR A;  2GIW A;  1PP9 D;  5C0Z A;  1ETP A;  1N9C A;  1CHI A;  1FHB A;  3CU4 A;  3L72 D;  1NTK D;  4GYD A;  5E79 V;  1VYD A;  1C2R A;  3L71 D;  1KV9 A;  3RMZ A;  2C2C A;  2FRC A;  1OCD A;  3L4O A;  5KLI B;  3L74 D;  2IBZ D;  2B10 B;  4U3F D;  3SLE A;  3H1J D;  2DVH A;  3ORV A;  4AX3 A;  1IRV A;  2GB8 B;  1YCC A;  1S5L V;  1HRO A;  2BPB B;  1H31 B;  3MK7 B;  4WQC A;  1CSU A;  2N18 B;  3ZOX A;  4EIF A;  4EIE A;  1CTY A;  1DIQ C;  2D0W A;  5DJQ B;  1L9B C;  2QJP B;  1E8E A;  1CSX A;  4XXL A;  4O1Q A;  1CO6 A;  5GTH V;  2B11 B;  3HQ7 A;  1P84 D;  4IL6 V;  1I54 A;  3OCD B;  3PXS A;  1SQV D;  1C75 A;  2GC4 D;  1KIB A;  1YFC A;  2ZOO A;  2LIR A;  4L3H A;  1I5T A;  4NFG B;  3RN0 A;  2A06 D;  1NTM D;  3L75 D;  4K3I A;  451C A;  3DR0 A;  1A2S A;  2LIT A;  1A56 A;  2ZZS 1;  4V2K A;  1HZU A;  2N3B A;  1NMI A;  3SXT A;  155C A;  3VRD A;  1I6E A;  3PXW A;  2BCN B;  3ZOO A;  3O0R C;  5KKZ B;  3WFC C;  3ZBM A;  1L0N D;  4UB6 V;  1DT1 A;  1IZL 0;  1N50 A;  5CIH B;  1SQX D;  1SQB D;  1FI9 A;  5CIB B;  4Y5R A;  3SVW A;  1WVE C;  2JQR A;  1DW0 A;  1LC2 A;  1LC1 A;  1CCH A;  1CIH A;  4WQA A;  4O1W A;  3ZOW A;  2BGV X;  1CYC A;  3NBT A;  1MZ4 A;  5CIF B;  2GC7 D;  3C2C A;  1F1C A;  1A8C A;  1CXC A;  4MU8 A;  2C1V A;  3X39 A;  1H9X A;  4AAO A;  1J3S A;  5C9M A;  2FYU D;  1KYO W;  1KX2 A;  4FAN A;  4JCG A;  4KMG A;  4PJ0 V;  3SWS A;  3TYI A;  351C A;  1H9Y A;  1B7V A;  1L0L D;  1YEA A;  3DMI A;  1DW3 A;  1CRJ A;  1LMS A;  1WEJ F;  3VYM A;  2ZXY A;  3OA8 A;  3WFE C;  1CTJ A;  2C1D A;  1C6S A;  1EB7 A;  3HQ9 A;  4GED B;  5KAF V;  2HV4 A;  1BL9 A;  1QL3 A;  2MHM A;  1BCC D;  2QJK B;  1H1O A;  2JTI B;  1CIE A;  1EZV D;  1CYJ A;  1F1F A;  1I8P A;  2B4Z A;  5CIG B;  1H32 B;  4FB1 A;  3WC8 A;  2N18 C;  1CRC A;  3JBT B;  2C9X B;  3L4M A;  1M70 A;  1CC5 A;  5KLV D;  3H1I D;  3D0W A;  5DJQ C;  3CX5 W;  4P4Q B;  1IO3 A;  4QAO A;  4L1Q A;  1NTZ D;  4L3G A;  3CXH W;  2CA3 B;  1GU2 A;  2ZON G;  5AUR A;  1C52 A;  3WFD C;  5GTI V;  1R0Q A;  1L9J C;  3PXT A;  1HH7 A;  3BCC D;  1GKS A;  1HJ4 A;  3DP5 A;  1LFM A;  3HQ8 A;  4WQ9 A;  4WQE A;  1AOQ A;  1AYG A;  4WQ7 A;  1CRI A;  3A9F A;  2C8S A;  3ZOY A;  4EIC A;  4WQ8 A;  2YCC A;  4WQD A;  3CWB D;  1K3G A;  1M60 A;  2L4D A;  1RAQ A;  1H33 A;  2BCC D;  3WFB C;  1GIW A;  4YE1 A;  1H31 A;  1CTZ A;  2C1D B;  4FA5 A;  3PH2 B;  3CP5 A;  3NWV A;  2QJY B;  1N90 A;  1HZV A;  5B66 V;  3A0B V;  1RZ6 A;  3A0H V;  1C6R A;  2YQB A;  1CRY A;  1K3H A;  1W2L A;  1FI7 A;  1RAP A;  1M6Z A;  2N9J A;  4PWA A;  1YTC A;  1HCM A;  3H1K D;  1CHH A;  2CE1 A;  3O5C A;  2ZBO A;  1FI3 A;  3OCD A;  1SQP D;  3VNW A;  2AXT V;  1DII C;  1YIQ A;  1I6D A;  2N9I A;  1DW1 A;  1C6O A;  1KX7 A;  5TIS V;  1NU1 D;  1IQC A;  1SQQ D;  1CCR A;  1IRW A;  1AOF A;  1E29 A;  2PAC A;  1HRC A;  1KYO D;  1DVV A;  4AAM A;  5CIC B;  1CYI A;  4FAV A;  2FWL A;  1LS9 A;  4N0K A;  4WQB A;  4H0K A;  2FYN B;  1HJ5 A;  3MK7 C;  2B12 B;  4Q5P A;  4EID A;  2XTS B;  2AI5 A;  1OAE A;  3M97 X;  1COR A;  3ZIY A;  1QKS A;  2OZ1 A;  5H2F V;  2V08 A;  2PCB B;  3WU2 V;  3KZI V;  1I8O A;  2BLF B;  1W5C T;  1C2N A;  5KAI V;  2CA4 B;  2BH4 X;  3WUI A;  3NBS A;  4J20 A;  4PW9 B;  1H33 B;  4FA1 A;  4RSZ A;  1U74 B;  1DW2 A;  5IY5 1;  2DGE A;  4LJI A;  4DY9 A;  3H1L D;  1CIG A;  1YIC A;  1JDL A;  1ZZH A;  5CIE B;  2PCC B;  1NNO A;  2V07 A;  2VHD A;  3CX5 D;  4PD4 D;  4XYD B;  2EXV A;  1N15 A;  1U75 B;  2BH5 X;  2CXB A;  3CYT I;  2CE0 A;  5DFS A;  1YNR A;  1BGY D;  1CNO A;  2AIU A;  4H0J A;  1CRG A;  1CXA A;  3CXH D;  1S6V B;  5DF5 A;  3L73 D;  4AAL A;  1CSV A;  1E2R A;  3TGU D;  4FA9 A;  2C1U A;  1AKK A;  1H32 A;  1QYZ A;  5CYT R;  1CRH A;  4D6T D;  2D0S A;  4UB8 V;  5EXQ A;  1ZRT D;  3OA8 B;  1MG2 D;  5B6Q A;  3RLM A;  1I55 A;  1DVH A;  4AAN A;  1GJQ A;  1CHJ A;  1NML A;  1QN2 A;  1PPJ D;  1FCD C;  1KB0 A; 
#chains in the Genus database with same CATH homology
 5B5E V;  2ORL A;  1FOC A;  3L70 D;  3RN1 A;  1YEB A;  1CSW A;  2MTA C;  2OZ1 B;  3H1H D;  2N3Y A;  1QL4 A;  3SJL A;  1COT A;  1GDV A;  1HJ3 A;  1C7M A;  1CIF A;  1MG3 D;  5CID B;  1KB9 D;  2YK3 A;  1CED A;  3ZCF A;  2B0Z B;  1BE3 D;  2YIU B;  2I8F A;  3HQ6 A;  1FJ0 A;  4FA4 A;  1GQ1 A;  3O20 A;  1RZ5 A;  3O1Y A;  1NIR A;  2GIW A;  1PP9 D;  5C0Z A;  1ETP A;  1N9C A;  1CHI A;  1FHB A;  3CU4 A;  3L72 D;  1NTK D;  4GYD A;  5E79 V;  1VYD A;  1C2R A;  3L71 D;  1KV9 A;  3RMZ A;  2C2C A;  2FRC A;  1OCD A;  3L4O A;  5KLI B;  3L74 D;  2IBZ D;  2B10 B;  4U3F D;  3SLE A;  3H1J D;  2DVH A;  3ORV A;  4AX3 A;  1IRV A;  2GB8 B;  1YCC A;  1S5L V;  1HRO A;  2BPB B;  1H31 B;  3MK7 B;  4WQC A;  1CSU A;  2N18 B;  3ZOX A;  4EIF A;  4EIE A;  1CTY A;  1DIQ C;  2D0W A;  5DJQ B;  1L9B C;  2QJP B;  1E8E A;  1CSX A;  4XXL A;  4O1Q A;  1CO6 A;  5GTH V;  2B11 B;  3HQ7 A;  1P84 D;  4IL6 V;  1I54 A;  3OCD B;  3PXS A;  1SQV D;  1C75 A;  2GC4 D;  1KIB A;  1YFC A;  2ZOO A;  2LIR A;  4L3H A;  1I5T A;  4NFG B;  3RN0 A;  2A06 D;  1NTM D;  3L75 D;  4K3I A;  451C A;  3DR0 A;  1A2S A;  2LIT A;  1A56 A;  2ZZS 1;  4V2K A;  1HZU A;  2N3B A;  1NMI A;  3SXT A;  155C A;  3VRD A;  1I6E A;  3PXW A;  2BCN B;  3ZOO A;  3O0R C;  5KKZ B;  3WFC C;  3ZBM A;  1L0N D;  4UB6 V;  1DT1 A;  1IZL 0;  1N50 A;  5CIH B;  1SQX D;  1SQB D;  1FI9 A;  5CIB B;  4Y5R A;  3SVW A;  1WVE C;  2JQR A;  1DW0 A;  1LC2 A;  1LC1 A;  1CCH A;  1CIH A;  4WQA A;  4O1W A;  3ZOW A;  2BGV X;  1CYC A;  3NBT A;  1MZ4 A;  5CIF B;  2GC7 D;  3C2C A;  1F1C A;  1A8C A;  1CXC A;  4MU8 A;  2C1V A;  3X39 A;  1H9X A;  4AAO A;  1J3S A;  5C9M A;  2FYU D;  1KYO W;  1KX2 A;  4FAN A;  4JCG A;  4KMG A;  4PJ0 V;  3SWS A;  3TYI A;  351C A;  1H9Y A;  1B7V A;  1L0L D;  1YEA A;  3DMI A;  1DW3 A;  1CRJ A;  1LMS A;  1WEJ F;  3VYM A;  2ZXY A;  3OA8 A;  3WFE C;  1CTJ A;  2C1D A;  1C6S A;  1EB7 A;  3HQ9 A;  4GED B;  5KAF V;  2HV4 A;  1BL9 A;  1QL3 A;  2MHM A;  1BCC D;  2QJK B;  1H1O A;  2JTI B;  1CIE A;  1EZV D;  1CYJ A;  1F1F A;  1I8P A;  2B4Z A;  5CIG B;  1H32 B;  4FB1 A;  3WC8 A;  2N18 C;  1CRC A;  3JBT B;  2C9X B;  3L4M A;  1M70 A;  1CC5 A;  5KLV D;  3H1I D;  5DJQ C;  3CX5 W;  4P4Q B;  1IO3 A;  4QAO A;  4L1Q A;  1NTZ D;  4L3G A;  3CXH W;  2CA3 B;  1GU2 A;  2ZON G;  5AUR A;  1C52 A;  3WFD C;  5GTI V;  1R0Q A;  1L9J C;  3PXT A;  1HH7 A;  3BCC D;  1GKS A;  1HJ4 A;  3DP5 A;  1LFM A;  3HQ8 A;  4WQ9 A;  4WQE A;  1AOQ A;  1AYG A;  4WQ7 A;  1CRI A;  3A9F A;  2C8S A;  3ZOY A;  4EIC A;  4WQ8 A;  2YCC A;  4WQD A;  3CWB D;  1K3G A;  1M60 A;  2L4D A;  1RAQ A;  1H33 A;  2BCC D;  3WFB C;  1GIW A;  4YE1 A;  1H31 A;  1CTZ A;  2C1D B;  4FA5 A;  3PH2 B;  3CP5 A;  3NWV A;  2QJY B;  1N90 A;  1HZV A;  5B66 V;  3A0B V;  1RZ6 A;  3A0H V;  1C6R A;  2YQB A;  1CRY A;  1K3H A;  1W2L A;  1FI7 A;  1RAP A;  1M6Z A;  2N9J A;  4PWA A;  1YTC A;  1HCM A;  3H1K D;  1CHH A;  2CE1 A;  3O5C A;  2ZBO A;  1FI3 A;  3OCD A;  1SQP D;  3VNW A;  2AXT V;  1DII C;  1YIQ A;  1I6D A;  2N9I A;  1DW1 A;  1C6O A;  1KX7 A;  5TIS V;  1NU1 D;  1IQC A;  1SQQ D;  1CCR A;  1IRW A;  1AOF A;  1E29 A;  2PAC A;  1HRC A;  1KYO D;  1DVV A;  4AAM A;  5CIC B;  1CYI A;  4FAV A;  2FWL A;  1LS9 A;  4N0K A;  4WQB A;  4H0K A;  2FYN B;  1HJ5 A;  3MK7 C;  2B12 B;  4Q5P A;  4EID A;  2XTS B;  2AI5 A;  1OAE A;  3M97 X;  1COR A;  3ZIY A;  1QKS A;  2OZ1 A;  5H2F V;  2V08 A;  2PCB B;  3WU2 V;  3KZI V;  1I8O A;  2BLF B;  1W5C T;  1C2N A;  5KAI V;  2CA4 B;  2BH4 X;  3WUI A;  3NBS A;  4J20 A;  4PW9 B;  1H33 B;  4FA1 A;  4RSZ A;  1U74 B;  1DW2 A;  5IY5 1;  2DGE A;  4LJI A;  4DY9 A;  3H1L D;  1CIG A;  1YIC A;  1JDL A;  1ZZH A;  5CIE B;  2PCC B;  1NNO A;  2V07 A;  2VHD A;  3CX5 D;  4PD4 D;  4XYD B;  2EXV A;  1N15 A;  1U75 B;  2BH5 X;  2CXB A;  3CYT I;  2CE0 A;  5DFS A;  1YNR A;  1BGY D;  1CNO A;  2AIU A;  4H0J A;  1CRG A;  1CXA A;  3CXH D;  1S6V B;  5DF5 A;  3L73 D;  4AAL A;  1CSV A;  1E2R A;  3TGU D;  4FA9 A;  2C1U A;  1AKK A;  1H32 A;  1QYZ A;  5CYT R;  1CRH A;  4D6T D;  2D0S A;  4UB8 V;  5EXQ A;  1ZRT D;  3OA8 B;  1MG2 D;  5B6Q A;  3RLM A;  1I55 A;  1DVH A;  4AAN A;  1GJQ A;  1CHJ A;  1NML A;  1QN2 A;  1PPJ D;  1FCD C;  1KB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...