2LISA

High resolution structure of the red abalone lysin monomer
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
131
structure length
131
Chain Sequence
HYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMAYFYDFLKDKNMIPKYLPYMEEINRMRPADVPVKYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.35 and 2.07 A resolution structures of the red abalone sperm lysin monomer and dimer reveal features involved in receptor binding.
pubmed doi rcsb
molecule tags Cell adhesion
molecule keywords SPERM LYSIN
total genus 48
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01303 Egg_lysin Egg lysin (Sperm-lysin)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.150.10 Mainly Alpha Up-down Bundle Lysin Fertilization protein 2lisA00
2LISA 2LYNA 3LYNA 1LYNA 1GAKA 1LISA
chains in the Genus database with same CATH superfamily
2LYNA 3CMNA 1E1RA 2F43A 3OAAA 1COWA 1LYNA 2WSSA 4Z1MA 1H8EA 1LISA 3OFNA 2JJ2A 1H8HA 1OHHA 2V7QA 4XD7A 4YXWA 2LISA 2XNDA 2QE7A 4TT3A 2JJ1A 5DN6A 1KMHA 1MABA 4ASUA 1W0JA 3OE7A 1BMFA 1E1QA 1FX0A 2JIZA 2W6IA 2XOKA 2JDIA 3LYNA 3OEHA 2HLDA 1E79A 3FKSA 1W0KA 1NBMA 5CDFA 3ZIAA 4TSFA 3OEEA 2R9VA 2CK3A 1GAKA 2WPDA 1EFRA 2W6JA 5FL7A 1SKYB
chains in the Genus database with same CATH topology
2LISA 2LYNA 3LYNA 1LYNA 1GAKA 1LISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIS A;  2LYN A;  3LYN A;  1LYN A;  1GAK A;  1LIS A; 
#chains in the Genus database with same CATH topology
 2LYN A;  3CMN A;  1E1R A;  2F43 A;  3OAA A;  1COW A;  1LYN A;  2WSS A;  4Z1M A;  1H8E A;  1LIS A;  3OFN A;  2JJ2 A;  1H8H A;  1OHH A;  2V7Q A;  4XD7 A;  4YXW A;  2LIS A;  2XND A;  2QE7 A;  4TT3 A;  2JJ1 A;  5DN6 A;  1KMH A;  1MAB A;  4ASU A;  1W0J A;  3OE7 A;  1BMF A;  1E1Q A;  1FX0 A;  2JIZ A;  2W6I A;  2XOK A;  2JDI A;  3LYN A;  3OEH A;  2HLD A;  1E79 A;  3FKS A;  1W0K A;  1NBM A;  5CDF A;  3ZIA A;  4TSF A;  3OEE A;  2R9V A;  2CK3 A;  1GAK A;  2WPD A;  1EFR A;  2W6J A;  5FL7 A;  1SKY B; 
#chains in the Genus database with same CATH homology
 2LIS A;  2LYN A;  3LYN A;  1LYN A;  1GAK A;  1LIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...