2LIZA

Nmr solution structure of c-terminal domain of sars-cov main protease in 2.5m urea
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
b'DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3C-like proteinase
publication title NMR solution structure of C-terminal domain of SARS-CoV main protease in 2.5M urea
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 37
structure length 120
sequence length 120
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2lizA00
3TLOA 5C3NA 2A5KA 3AW1A 3VB6A 2Z9KA 3V3MA 2Q6FA 2ZU5A 4TWWA 4YOJA 3TITA 2GZ8A 1Z1JA 2Z3DA 2Q6DA 3TNSA 5B6OA 3ATWA 4XFQA 3IWMA 2PWXA 2Z94A 3VB3A 5GWZA 2GZ7A 4MDSA 2ZU2A 4HI3A 3F9FA 4YLUA 2A5IA 5HYOA 3FZDA 1LVOA 3SNDA 3VB4A 3D23A 3EA7A 2H2ZA 3SZNA 3M3VA 2ZU4A 2A5AA 3SNBA 4TWYA 2GT8A 2V6NA 1UK3A 1UJ1A 2C3SA 2ALVA 5C5OA 3TNTA 2GT7A 2GTBA 3EA8A 3SN8A 1P9SA 3VB7A 3SNCA 3TIUA 3EBNA 2QCYA 3E91A 4WMEA 3F9HA 3D62A 2DUCA 4WY3A 5EU8A 3VB5A 4YO9A 1UK2A 3EAJA 2AMQA 2VJ1A 2HOBA 2Z9LA 2BX4A 1P9UA 2BX3A 2Z3CA 2AMDA 3AW0A 2YNAA 3EA9A 4YOIA 3SNAA 2LIZA 2QC2A 3M3SA 4F49A 2GX4A 2Z3EA 4WMFA 1UK4A 3F9GA 2D2DA 2Q6GA 4YOGA 2K7XA 2Z9GA 2Z9JA 4ZROA 1WOFA 3AVZA 4WMDA 4RSPA 2GZ9A 4ZUHA 1Z1IA 2QIQA 3M3TA 3SNEA 5C5NA 1Q2WA 2YNBA 2AMPA 2OP9A 3F9EA
chains in the Genus database with same CATH superfamily
3TLOA 5C3NA 2A5KA 3AW1A 3VB6A 2Z9KA 3V3MA 2Q6FA 2ZU5A 4TWWA 4YOJA 3TITA 2GZ8A 1Z1JA 2Z3DA 2Q6DA 3TNSA 5B6OA 3ATWA 4XFQA 3IWMA 2PWXA 2Z94A 3VB3A 5GWZA 2GZ7A 4MDSA 2ZU2A 4HI3A 3F9FA 4YLUA 2A5IA 5HYOA 3FZDA 1LVOA 3SNDA 3VB4A 3D23A 3EA7A 2H2ZA 3SZNA 3M3VA 2ZU4A 2A5AA 3SNBA 4TWYA 2GT8A 2V6NA 1UK3A 1UJ1A 2C3SA 2ALVA 5C5OA 3TNTA 2GT7A 2GTBA 3EA8A 3SN8A 1P9SA 3VB7A 3SNCA 3TIUA 3EBNA 2QCYA 3E91A 4WMEA 3F9HA 3D62A 2DUCA 4WY3A 5EU8A 3VB5A 4YO9A 1UK2A 3EAJA 2AMQA 2VJ1A 2HOBA 2Z9LA 2BX4A 1P9UA 2BX3A 2Z3CA 2AMDA 3AW0A 2YNAA 3EA9A 4YOIA 3SNAA 2LIZA 2QC2A 3M3SA 4F49A 2GX4A 2Z3EA 4WMFA 1UK4A 3F9GA 2D2DA 2Q6GA 4YOGA 2K7XA 2Z9GA 2Z9JA 4ZROA 1WOFA 3AVZA 4WMDA 4RSPA 2GZ9A 4ZUHA 1Z1IA 2QIQA 3M3TA 3SNEA 5C5NA 1Q2WA 2YNBA 2AMPA 2OP9A 3F9EA
chains in the Genus database with same CATH topology
3TLOA 5C3NA 2A5KA 3AW1A 3VB6A 2Z9KA 3V3MA 2Q6FA 2ZU5A 4TWWA 4YOJA 3TITA 2GZ8A 1Z1JA 2Z3DA 2Q6DA 3TNSA 5B6OA 3ATWA 4XFQA 3IWMA 2PWXA 2Z94A 3VB3A 5GWZA 2GZ7A 4MDSA 2ZU2A 4HI3A 3F9FA 4YLUA 2A5IA 5HYOA 3FZDA 1LVOA 3SNDA 3VB4A 3D23A 3EA7A 2H2ZA 3SZNA 3M3VA 2ZU4A 2A5AA 3SNBA 4TWYA 2GT8A 2V6NA 1UK3A 1UJ1A 2C3SA 2ALVA 5C5OA 3TNTA 2GT7A 2GTBA 3EA8A 3SN8A 1P9SA 3VB7A 3SNCA 3TIUA 3EBNA 2QCYA 3E91A 4WMEA 3F9HA 3D62A 2DUCA 4WY3A 5EU8A 3VB5A 4YO9A 1UK2A 3EAJA 2AMQA 2VJ1A 2HOBA 2Z9LA 2BX4A 1P9UA 2BX3A 2Z3CA 2AMDA 3AW0A 2YNAA 3EA9A 4YOIA 3SNAA 2LIZA 2QC2A 3M3SA 4F49A 2GX4A 2Z3EA 4WMFA 1UK4A 3F9GA 2D2DA 2Q6GA 4YOGA 2K7XA 2Z9GA 2Z9JA 4ZROA 1WOFA 3AVZA 4WMDA 4RSPA 2GZ9A 4ZUHA 1Z1IA 2QIQA 3M3TA 3SNEA 5C5NA 1Q2WA 2YNBA 2AMPA 2OP9A 3F9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLO A;  5C3N A;  2A5K A;  3AW1 A;  3VB6 A;  2Z9K A;  3V3M A;  2Q6F A;  2ZU5 A;  4TWW A;  4YOJ A;  3TIT A;  2GZ8 A;  1Z1J A;  2Z3D A;  2Q6D A;  3TNS A;  5B6O A;  3ATW A;  4XFQ A;  3IWM A;  2PWX A;  2Z94 A;  3VB3 A;  5GWZ A;  2GZ7 A;  4MDS A;  2ZU2 A;  4HI3 A;  3F9F A;  4YLU A;  2A5I A;  5HYO A;  3FZD A;  1LVO A;  3SND A;  3VB4 A;  3D23 A;  3EA7 A;  2H2Z A;  3SZN A;  3M3V A;  2ZU4 A;  2A5A A;  3SNB A;  4TWY A;  2GT8 A;  2V6N A;  1UK3 A;  1UJ1 A;  2C3S A;  2ALV A;  5C5O A;  3TNT A;  2GT7 A;  2GTB A;  3EA8 A;  3SN8 A;  1P9S A;  3VB7 A;  3SNC A;  3TIU A;  3EBN A;  2QCY A;  3E91 A;  4WME A;  3F9H A;  3D62 A;  2DUC A;  4WY3 A;  5EU8 A;  3VB5 A;  4YO9 A;  1UK2 A;  3EAJ A;  2AMQ A;  2VJ1 A;  2HOB A;  2Z9L A;  2BX4 A;  1P9U A;  2BX3 A;  2Z3C A;  2AMD A;  3AW0 A;  2YNA A;  3EA9 A;  4YOI A;  3SNA A;  2LIZ A;  2QC2 A;  3M3S A;  4F49 A;  2GX4 A;  2Z3E A;  4WMF A;  1UK4 A;  3F9G A;  2D2D A;  2Q6G A;  4YOG A;  2K7X A;  2Z9G A;  2Z9J A;  4ZRO A;  1WOF A;  3AVZ A;  4WMD A;  4RSP A;  2GZ9 A;  4ZUH A;  1Z1I A;  2QIQ A;  3M3T A;  3SNE A;  5C5N A;  1Q2W A;  2YNB A;  2AMP A;  2OP9 A;  3F9E A; 
#chains in the Genus database with same CATH topology
 3TLO A;  5C3N A;  2A5K A;  3AW1 A;  3VB6 A;  2Z9K A;  3V3M A;  2Q6F A;  2ZU5 A;  4TWW A;  4YOJ A;  3TIT A;  2GZ8 A;  1Z1J A;  2Z3D A;  2Q6D A;  3TNS A;  5B6O A;  3ATW A;  4XFQ A;  3IWM A;  2PWX A;  2Z94 A;  3VB3 A;  5GWZ A;  2GZ7 A;  4MDS A;  2ZU2 A;  4HI3 A;  3F9F A;  4YLU A;  2A5I A;  5HYO A;  3FZD A;  1LVO A;  3SND A;  3VB4 A;  3D23 A;  3EA7 A;  2H2Z A;  3SZN A;  3M3V A;  2ZU4 A;  2A5A A;  3SNB A;  4TWY A;  2GT8 A;  2V6N A;  1UK3 A;  1UJ1 A;  2C3S A;  2ALV A;  5C5O A;  3TNT A;  2GT7 A;  2GTB A;  3EA8 A;  3SN8 A;  1P9S A;  3VB7 A;  3SNC A;  3TIU A;  3EBN A;  2QCY A;  3E91 A;  4WME A;  3F9H A;  3D62 A;  2DUC A;  4WY3 A;  5EU8 A;  3VB5 A;  4YO9 A;  1UK2 A;  3EAJ A;  2AMQ A;  2VJ1 A;  2HOB A;  2Z9L A;  2BX4 A;  1P9U A;  2BX3 A;  2Z3C A;  2AMD A;  3AW0 A;  2YNA A;  3EA9 A;  4YOI A;  3SNA A;  2LIZ A;  2QC2 A;  3M3S A;  4F49 A;  2GX4 A;  2Z3E A;  4WMF A;  1UK4 A;  3F9G A;  2D2D A;  2Q6G A;  4YOG A;  2K7X A;  2Z9G A;  2Z9J A;  4ZRO A;  1WOF A;  3AVZ A;  4WMD A;  4RSP A;  2GZ9 A;  4ZUH A;  1Z1I A;  2QIQ A;  3M3T A;  3SNE A;  5C5N A;  1Q2W A;  2YNB A;  2AMP A;  2OP9 A;  3F9E A; 
#chains in the Genus database with same CATH homology
 3TLO A;  5C3N A;  2A5K A;  3AW1 A;  3VB6 A;  2Z9K A;  3V3M A;  2Q6F A;  2ZU5 A;  4TWW A;  4YOJ A;  3TIT A;  2GZ8 A;  1Z1J A;  2Z3D A;  2Q6D A;  3TNS A;  5B6O A;  3ATW A;  4XFQ A;  3IWM A;  2PWX A;  2Z94 A;  3VB3 A;  5GWZ A;  2GZ7 A;  4MDS A;  2ZU2 A;  4HI3 A;  3F9F A;  4YLU A;  2A5I A;  5HYO A;  3FZD A;  1LVO A;  3SND A;  3VB4 A;  3D23 A;  3EA7 A;  2H2Z A;  3SZN A;  3M3V A;  2ZU4 A;  2A5A A;  3SNB A;  4TWY A;  2GT8 A;  2V6N A;  1UK3 A;  1UJ1 A;  2C3S A;  2ALV A;  5C5O A;  3TNT A;  2GT7 A;  2GTB A;  3EA8 A;  3SN8 A;  1P9S A;  3VB7 A;  3SNC A;  3TIU A;  3EBN A;  2QCY A;  3E91 A;  4WME A;  3F9H A;  3D62 A;  2DUC A;  4WY3 A;  5EU8 A;  3VB5 A;  4YO9 A;  1UK2 A;  3EAJ A;  2AMQ A;  2VJ1 A;  2HOB A;  2Z9L A;  2BX4 A;  1P9U A;  2BX3 A;  2Z3C A;  2AMD A;  3AW0 A;  2YNA A;  3EA9 A;  4YOI A;  3SNA A;  2LIZ A;  2QC2 A;  3M3S A;  4F49 A;  2GX4 A;  2Z3E A;  4WMF A;  1UK4 A;  3F9G A;  2D2D A;  2Q6G A;  4YOG A;  2K7X A;  2Z9G A;  2Z9J A;  4ZRO A;  1WOF A;  3AVZ A;  4WMD A;  4RSP A;  2GZ9 A;  4ZUH A;  1Z1I A;  2QIQ A;  3M3T A;  3SNE A;  5C5N A;  1Q2W A;  2YNB A;  2AMP A;  2OP9 A;  3F9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...