2LJ0A

The third sh3 domain of r85fl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Basis for the Recognition of Ataxin-7 PRR with R85FL SH3 Domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj0A00
1SHFA 1RLPC 4D8DA 1S1NA 1AWXA 3UATA 1ZUUA 1X2QA 1CSKA 3O5ZA 4A63B 4AFSC 2DJQA 4J9BA 2LQWA 1HD3A 1V1CA 4J9GA 1AWJA 2K2MA 2J6OA 2O31A 1WXUA 2X3XD 3H0FA 4Z8AA 1NYGA 1H8KA 3CQTA 2LJ1A 4RTYA 1EFNA 3PVLA 1CKAA 1X43A 4DEXA 3EG3A 2PNIA 4QT7A 2FPDA 1UG1A 2HBWA 4HXJA 1WX6A 4OMOA 4GLMA 1Z9ZA 1MV3A 3I9QA 1J3TA 1M3AA 4HCKA 5ECAA 5IXFA 1KSWA 3M0UA 2EGCA 2JMAA 2ED0A 2OAWA 2D8HA 1B3QA 1GCQA 3QWYA 4J9IA 2ABLA 4RTVA 1JXOA 1HJDA 4GBQA 1AZEA 3M0SA 1UUEA 4KRTA 2A37A 2EVRA 4F14A 2RQTA 1M30A 2D1XA 1KIKA 1PHTA 2X3WD 4Y92A 1VYUA 2FRYA 4JJCA 1UDLA 2GNCA 5IHIA 2JTEA 4WCIA 1ZUKA 1G2BA 1T0HA 2JW4A 4F16A 2RQVA 2IIMA 2KROA 3SHWA 3UF4A 1JO8A 2PTKA 2C0IA 1A0NB 1JQQA 1N5ZA 4HVVA 1VYTA 2RMOA 3THKA 2RN8A 2C0OA 1M3CA 1UJ0A 2OI3A 3C0CA 1W70A 2YUNA 2CH4W 2K9GA 1GCPA 2KXCA 1BK2A 2DRKA 2EYYA 3R6NA 2FRWA 2H8HA 1GRIA 2RQRA 2O88A 1OPKA 1NYFA 4RTWA 2BZ8A 1BU1A 2KRNA 2KYMA 1K1ZA 2JXBA 2J7IA 2O2OA 3UA6A 1ZSGA 4J9DA 1AEYA 3I5RA 2LJ0A 1M3BA 2A36A 2V1RA 1WXBA 1UJYA 4ORZA 1ZLMA 2JM8A 3VS5A 1ABQA 1ZUYA 2KT8A 1MUZA 5FW9A 1WLPB 3QWXX 2YUQA 2L3PA 2HDAA 4AFQC 4AG1C 2AKLA 2VKNA 4OMNA 1WDXA 2MIOA 4JZ4A 2LMJA 4J9HA 3PE0A 2YT6A 1JU5C 4J9EA 3EGUA 2M0YA 1RI9A 3TSZA 3REBB 2HSPA 4OMMA 4JJDA 1FMKA 2AZSA 1E6GA 2EGEA 4K11A 1JEGA 2K7AA 2JS0A 2J06A 2G6FX 2M51A 2DE0X 2KR3A 2LNHB 5IH2A 1PKTA 1GFCA 2DVJA 1T3SA 5I11A 3M0QA 1G83A 2AK5A 2EYWA 1SPKA 3H41A 1K0XA 4AG2C 1NEGA 2LJ3A 2D8JA 1NEBA 2FG0A 2DLPA 1PRLC 3EG2A 2B86A 1WFWA 2DL4A 4EIKA 2K79A 2GTJA 2SEMA 2EYZA 5FWBA 2NWMA 2DM1A 2J6KA 3VRZA 4LUEA 1QKWA 1X6GA 4CC2A 1AWWA 2EW3A 2RF0A 4J9FA 2J6FA 4LN2A 4CC7A 2CDTA 2JS2A 1OV3A 2KBTA 2KE9A 1YWOA 2J05A 1KJWA 2F2WA 4OMPA 2RPNA 3VS3A 2CSQA 2EBPA 4AFUC 2KEAA 5GJVB 1WYXA 1X27A 2CT3A 2ED1A 4E6RA 1W6XA 2CUBA 1NLPC 2DRMA 3GBQA 2CT4A 1PWTA 2QDLA 2A28A 4RUGA 2ESWA 2MCNA 4OMLA 2ECZA 3VS1A 2RNAA 3PVQA 1T3LA 2FO0A 2BZXA 3VRYA 1NLOC 1LCKA 2BZYA 2ROTA 2DL7A 2W0ZA 5IXBA 1UE9A 2EQIA 2KRMA 1B07A 2DF6A 1I1JA 4LNPA 2L0AA 2VWFA 4R0KA 1YCSB 1BB9A 4RTUA 2AKKA 1OPLA 1UTIA 1GBRA 1ABOA 2ROLA 1YNZA 3EG1A 2LX7A 1VYVA 5EC7A 1QCFA 2A08A 2SRCA 4J9CA 3EHRA 2LZ6B 1SRLA 3SEMA 3REAB 3I5SA 2AZVA 2K6DA 1TG0A 3LH5A 1W1FA 4RTZA 2DA9A 1ZX6A 1GBQA 3IQLA 5IHNA 2DBMA 3VS7A 3NMZC 3H0HA 3ZL7C 1HSQA 2LP5A 1TUDA 2LCSA 2KT1A 1GL5A 1FYNA 1RLQC 2F2XA 3NHNA 1QLYA 2KRSA 3NGPA 2BTTA 4CC3A 1XOVA 4FSSA 2L2PA 4ESRA 1ARKA 2RQWA 1UGVA 1U5SA 3TSWA 1AVZC 1H92A 2EPDA 2ENMA 2F2VA 2GTOA 4IIMA 1JXMA 1QKXA 3M0PA 1I07A 1KFZA 2YUPA 4JPBW 1E6HA 2DMOA 2DL5A 3UA7A 3RBBB 2CSIA 2KGTA 1K9AA 2O9SA 4HVUA 5HCKA 4AFZC 3RNJA 2P4RA 2DYBA 1WIEA 2GGRA 2C0TA 3NPFA 2EGAA 3ULRB 2D0NA 2HCKA 1UHCA 2DNUA 2CH4A 1OOTA 1U06A 2RQUA 1X6BA 1AOJA 1K0SA 1Y57A 4LE9A 1M8MA 2HEQA 4LUDA 2DL8A 2L3QA 2DL3A 3M0TA 1PRMC 4CC4B 1VA7A 2JM9A 2I0NA 1BBZA 1OEBA 1K76A 2O9VA 3A98A 1UECA 3VS6A 5I22A 4ZNXA 1IO6A 1Y0MA 4HVWA 4Z89A 2FEIA 4F17A 1YWPA 5L23A 1QWEA 3M0RA 4JZ3A 1AZGB 2DX1A 4DEYA 2CREA 2DILA 1NM7A 3U23A 4IIOA 2FPEA 1YP5A 4X1VA 2GQIA 1ZBJA 2JT4A 2NUZA 4Z88A 1WA7A 4RTXA 2MOXA 2DBKA 3I35A 2JMCA 1AWOA 1T0JA 1QWFA 1X2KA 1NG2A 1CKBA 2K3BA 1M27C 1Z9QA 2KXDA 4RTTA 1K4US 2KYBA 1WI7A 1YN8A 2E5KA 3KFVA 1PNJA 1H3HA 2YDLA 2W10A 4OMQA 3EHQA 3H0IA 2CUDA 1GCQC 2OJ2A 2EYXA 2LQNA 3JV3A 2GBQA 2YUOA 5FWCA 3VS4A 1UHFA 3TVTA 3FJ5A 4D8KA 1TUCA 2V1QA 2EKHA 1SEMA 1GFDA 1U3OA 2VVKA 1SHGA 2L3SA 2FPFA 1SRMA 1RUWA 1E7OA 1SSHA 3VS0A 4M4ZA 4JJBA 1PKSA 3EG0A 2PZ1A 5GJWB 2XMFA 1X69A 1WXTA 2KNBB 1MV0B 1UFFA 2YSQA 5IHKA 3VS2A 1AD5A 1I0CA
chains in the Genus database with same CATH superfamily
4XTYA 4E47A 1KD1R 1VIEA 2ZZDA 1YJNA 3A1PA 1RL2A 3JSCA 1ZUUA 2DJQA 3DB3A 3QZ5B 1V1CA 3M4GA 2ZPIB 4PFPA 2O31A 2GCXA 2HQEA 2X3XD 4M7DC 1IRXA 4LD6A 3CQTA 2LJ1A 2QTXA 1YJ9A 2HNIA 1VQ9A 2PNIA 2FPDA 2PUKB 1WX6A 2CYZB 1Z9ZA 3I9QA 1M3AA 4HCKA 1HXDA 2KVQG 5DY9A 4QVCA 5IXFA 1K9MU 2FZGB 1B34B 3HPWA 3PIPA 1Y96A 3FJPA 2DKGA 3CCLQ 1UEBA 2EQUA 1KQSS 1IZ6A 3LYIA 5EG2A 2RB6A 3M0SA 4KRTA 2DERA 2D1XA 5FU7B 4N4IA 2X3WD 1VYUA 3E9FA 3INZA 1VQKT 3CCQA 2HBPA 4BY6B 2RHXA 1VQ9T 5GAN6 1ZUKA 2E3HA 3TREA 1T0HA 2JW4A 4F16A 4GY5A 3CMET 1NZ9A 2KROA 3SHWA 1JO8A 1N27A 1N5ZA 4KT0E 4QKUA 3SWNC 2RN8A 2C0OA 1M3CA 3GNFB 4FYYB 1GXIE 2NYSA 2YUNA 2CH4W 1IB8A 2K9GA 1GCPA 2DRKA 2DXCA 4WTOB 2ZGWA 1OPKA 4Y91A 4ZN1A 4RTWA 3RR6A 2XK0A 3J80E 1BU1A 3CC4Q 4OMFB 1WQ7A 2WSFE 1K1ZA 2JXBA 3UA6A 1VQPA 1VQ9Q 1ZSGA 4J9DA 1ZSZA 3I5RA 3CCJQ 1M3BA 3VUZA 2A36A 1WXBA 2JN0A 4C92D 1ZLMA 4XK8E 1ABQA 4M77E 3QWXX 2YUQA 5LJ5g 2HDAA 1H641 2VXEA 4OMNA 3MJXA 3E2UA 1RI0A 1WJSA 1ZSZB 4KGZB 4ZGDB 1QVGP 4J9EA 3G71A 1N8RU 2KI7A 1MNDA 4NS5A 3C12A 4IUPA 3ME9A 5LJ3j 3UDCA 5GAMg 4PJOE 2MYSA 1AHJB 3UT1A 2QASA 2EGEA 2K7AA 1D1AA 2BE7D 3RIRA 4LDXA 2G6FX 4P5NA 2DE0X 3CMAA 2LNHB 1VQPT 2OTJT 3OB9A 3M4YA 1MMDA 4M78D 1TU0B 4J7IA 1Q86R 2BKDN 5LJ5d 3S3MA 1QVPA 1S72T 3MO8A 2LJ3A 2VXFA 2D8JA 3QG1A 2FG0A 2JOYA 2VB6A 2DLPA 2HQHA 5A0GA 4EIKA 1NE8A 1QVGS 5GMKi 2HSEB 2FZKB 2EYZA 2DM1A 3VRZA 5CK9A 5LJ3h 2V8KA 1QKWA 5KYWB 2RA2A 1K9MR 2J6FA 4C8QD 3L1AA 3OMGA 2LQKA 4ME7A 3CCUT 2JS2A 2KBTA 2RPNA 3Q1JA 3V7RA 1XJWB 4QQ6A 5LJ5f 2E64A 1M2VA 5CVIA 1WYXA 1TXQA 2CT3A 1NLPC 2DRMA 2CZ6B 2M02A 1YIJT 3GBQA 3TCJA 2A0FB 5CKDA 1RADB 1QP2A 3A8HB 2EFIA 4BI3A 3EG9A 5GANe 1KD1C 3F70A 2XDBA 2RJEA 1NLOC 4OF1A 1D0YA 3CC2T 2W0ZA 1I4K1 3SWNA 4B6MA 3CCST 4A4GA 1UGQB 4J8OA 1YJNQ 4LNPA 4JUVA 4M78E 4R0KA 3M56A 4F7UG 3CCQQ 3VJPA 2AKKA 1QVFA 3QJYA 1GBRA 2KY9A 3UWNA 3EG1A 2WSCE 2RK2A 5J39A 3EFOB 2RD1A 3EHRA 3X28B 2E1HA 2OTLA 4PLIA 3L2RA 2BIVA 2QG9B 2K6DA 8ATCB 2ZCFB 1VQLA 1W1FA 5KE2A 2QQRA 2DA9A 2EJGA 3IQLA 1G5VA 3HRTA 1M1KU 3JB9G 3M54A 1G3TA 4BACA 2VC8A 3ZL7C 1JJ2S 2LCSA 5GAOq 1WJQA 5CQXA 2KRSA 2BTTA 1XOVA 2E3IA 1OULA 2K57A 2RQWA 3QHSA 1RAEB 3BY7A 3TSWA 2XD0A 1OZ2A 2ENMA 2GTOA 3CCVQ 2M16A 3QYHB 3CCLA 4C0FA 1WHKA 5KYXB 5I2MA 4QVDA 1E6HA 5A0LA 4PJOA 4C5HA 3KUFA 3OYLA 2OTLQ 2FYKA 5LJ3d 1VQNQ 3NPFA 2C0TA 3FLGA 1IGUA 3ULRB 2HCKA 3L2UA 2CH4A 2HD0A 3OMCA 4M75B 4E7KA 3CD6T 2NUPA 1OOTA 2H3JA 2GFUA 5LJ5h 3EGDA 3M5AA 2AIRB 2LTOA 1VIFA 2DL8A 2HZYA 1WHLA 1IXDA 2X4XA 3JCMW 2RI5A 3M0TA 2RM4A 2F69A 5GMKl 1W2BP 1BBZA 5GAN7 3A8LB 2A7YA 1UECA 1QVGA 3VS6A 4KGXB 4ZNXA 5LJ3g 3HHTB 4ELYC 4Z89A 4C92F 1QWEA 3CCRQ 3BFMA 7AT1B 3CXCA 3JCMb 5C0MA 4C0ZA 3R6OA 2DILA 2O4XB 3U23A 4IIOA 1YP5A 3J81E 2JT4A 3CCSQ 3G1JA 1PCXA 1HYOA 2QI2A 1QMCA 3CCVA 3VYGA 1AWOA 1T0JA 1QWFA 1Q7YU 3CCVT 2KAFA 1B34A 3CCEA 1WHJA 1NG2A 4PJOD 2K3BA 2KXDA 4RTTA 1PG5B 5GAMh 3QSUA 2MI6A 3MP6A 2ZPBB 4A4HA 3KFVA 1Q95G 4OMQA 3H0IA 4QQGA 2LDMA 2OJ2A 4BE2A 2LQNA 2X9HA 3RDVA 5FWCA 4J6WA 1UHFA 2EKHA 3JCMf 1SEMA 4BE1A 2VVKA 4XTUA 3OYAA 4JRIA 2FPFA 1SRMA 4X9CA 1E7OA 2KSSA 3VS0A 1PKSA 1K73C 1ZQ1A 2CP2A 3JB9J 2MMPA 3MCAB 2YSQA 5LJ3e 1KC8U 2K5FA 1VQMQ 1TS9A 2VASA 4JS5A 1M27C 3DKMA 5D6XA 4C5EA 4D8DA 2FHDA 2G3RA 3OBYA 3MHXA 2YWWA 3O5ZA 5GAN4 3MP8A 4J9GA 1K8AU 2X4JA 3C4SA 2J6OA 1WXUA 1LVKA 4M75F 4Z8AA 5CKFA 4C8QF 4RTYA 1EFNA 1WHHA 4LDWA 1Q7YC 4DEXA 3EG3A 2DYIA 1UG1A 4HXJA 3L2ZA 1VQ8A 3QYGB 3CC2Q 3L2WA 1J3TA 2DD4A 2QEXA 5ECAA 1KSWA 3MEUA 4DOVA 2EGCA 2OTJQ 4M7DE 2JMAA 2ED0A 2K5IA 2OAWA 4IUQA 2MF2A 1VQMT 4J9IA 2ABLA 1K73U 2QAZA 4RTVA 4F14A 2DTIA 1KIKA 2EQKA 4Y92A 4JJCA 4DOWA 5GMKm 2RK1A 1WNLA 2F5TX 5DLOA 5IHIA 2JTEA 4WCIA 5J3BA 3JCMP 2COYA 1VOMA 1M2OA 5L8RE 3CD6Q 1TOVA 2C0IA 1A0NB 4PJOG 1VQ7T 3KBGA 2RMOA 3THKA 5CKEA 2P0QA 2JVVA 3EFSA 2OAUA 2OI3A 1W70A 2KXCA 3R6NA 2H8HA 2O88A 4PNOA 4IUVA 4DBFA 2KK4A 3G71T 4XU0A 1JBMA 3RKWA 4BDYA 1K73R 1MGQA 2FVUA 4FM4B 1OI1A 3JCMe 4M7AE 2JTMA 2HAXA 1BYMA 2F1LA 4ORZA 3QDFA 2JM8A 4M77A 3VS5A 2KT8A 5FW9A 2DAQA 1M1GA 2YRVA 4X9DA 4AG1C 2MIOA 3EG9B 4JZ4A 2LMJA 1YJWQ 1X75C 2KQWA 1O75A 3DB4A 4RCBA 1TTHB 4J9HA 1JU5C 1YCYA 3EGUA 2RO0A 4M78A 1RI9A 3KXTA 4JJDA 2XKOC 3SWNB 2AZSA 1ACMB 1M2VB 5LJ5e 4K11A 2D9TA 3LWHA 2KR3A 1YJNT 4BE0A 5IH2A 4FU6A 2K4YA 1T3SA 5I11A 3M0QA 3GP8A 1M90C 1JB0E 2YHTA 1G83A 2K3YA 2AK5A 4EMKC 2M9UA 2LC4A 1NEGA 3PIOA 1YHQQ 1NEBA 4JLGA 4EMKA 4C92C 3TEEA 1YI2Q 1YI2A 2DL4A 1VQPQ 2K79A 2ATCB 2SEMA 2NWMA 2J6KA 2RJDA 4HKEA 4LUEA 2LRQA 4CC2A 1AWWA 3CCEQ 1R0BG 2RF0A 3ASKA 2DXBA 4LN2A 2CDTA 2WSEE 2R57A 2KE9A 4HCZA 4BUGA 4ZTFA 1Q7YR 4LDVA 5GANd 1PD0A 3VS3A 2CSQA 2L3RA 2DK3A 4AFUC 1VQKQ 2KEAA 4MZTA 5GJVB 1OX9A 2ED1A 2OTJA 1W6XA 4OVAA 3V7CA 1M90R 5GAN3 3FDRA 2BE9B 4PL6A 2CT4A 2PVGB 2EAYA 2RHIA 4RUGA 2ESWA 2MCNA 4M7AF 1JJ2P 5KYUB 3PVQA 1T3LA 4OP0A 2BZXA 3VRYA 3CCMA 4M7DF 2VGMA 3A5ZB 2LQ8A 1M5Q1 3X25B 3DLLA 3PT9A 5IXBA 4ANJA 1UE9A 3CEYA 4QVZA 2DF6A 3EGDB 3PNWC 5HKCA 1I1JA 3MKDA 2COZA 4RCCA 2VWFA 3V7SA 4RTUA 4M75E 1UTIA 1VQ4T 2ROLA 1YNZA 2JUFA 3N5BB 2QEXQ 2A08A 2K3XA 3SDZA 3OYEA 3V8JA 5HY6A 2SRCA 4OB0B 1M4ZA 2V26A 1NPPA 4FW1A 3JB9D 2VV5A 4M78C 2WACA 3I5SA 2AZVA 3CC7A 3CBPA 3GOXA 4BI4A 1ZX6A 3CPWA 2O01E 3PMTA 2R58A 3NMZC 3EH2A 2O4XA 1HSQA 2LP5A 2EKOA 2ZPHB 1GL5A 1FYNA 2F2XA 1YJ9Q 4M7DD 2MWPA 4IKFA 4CC3A 1EX4A 2L2PA 3WVDB 1VQ8T 1UGVA 2LX9A 3M55A 1G3WA 1VQNT 1AVZC 3S3NA 4KUDK 1VQNA 1V29B 3CCLT 1JXMA 1QKXA 2ZPFB 1X01A 4C0DC 1MMGA 1KFZA 3E19A 1VQ5A 4FYXB 1RAIB 2DL5A 3QKJA 3OYKA 1K9AA 4AFZC 2XHCA 2P4RA 2DYBA 1M8VA 3S6WA 2GGRA 1VQOA 1FX7A 4LXCA 1JJ2A 2EQJA 3G6EQ 2RQUA 4M78B 1X6BA 3HRUA 1AOJA 3OS0A 1K0SA 2E10A 2OX7A 4LE9A 1M8MA 3RESA 4C8QC 4LUDA 3EFRA 2L3QA 2DL3A 3X20B 1JRIA 2P84A 3BDUA 4PFZA 2QYZA 4CC4B 1VA7A 2DTOA 2I0NA 5I2SA 1K76A 4BI8B 4M7AB 3A98A 3HKSA 4DBQA 3CCJT 5I22A 4E2FB 2FEIA 3META 1U1TA 4FYVB 4M78F 5KE3A 2P0PA 1O9SA 1YWPA 3DLMA 3RKXA 3M0RA 3URGA 4JZ3A 4UC4A 4DEYA 3ZFJA 3G4ST 3CMAT 4X1VA 1W2BA 4M77F 1ZBJA 3LX7A 2NUZA 4MMLA 4Z88A 3CMEQ 2QK0A 2F5KA 3S3OA 4VUBA 2DBKA 3I35A 5D6WA 3G7ZA 3JCMQ 4A4KA 5HK0A 1CKBA 1Z9QA 1RACB 2QA4T 3GLXA 1H3HA 2E6NA 2W10A 2KDSA 3EHQA 1D1BA 4C92G 2CUDA 2NUPB 2DEQA 5GAMd 1GCQC 4E7IA 3RUXA 3JV3A 2GBQA 2K2VA 3TVTA 3FJ5A 4MMKA 3V8LA 1YHQT 3H8ZA 3NTHA 2QQ9A 3C95A 2DXUA 4M7DB 1Q86U 3E1SA 1KHCA 4PJOB 2IG0A 3HSBA 4LDYA 4KBMB 3GF5A 2JJ9A 1X69A 1N8RC 1YFNA 2KNBB 1NPRA 3HFOA 3O8VA 2RH2A 3UPUA 1K8AR 4FT2A 4KH0B 3VS2A 4XU1A 1I0CA 3CBOA 1Y71A 1SHFA 4BB7A 3OY9A 3G6ET 1OU9A 3JCMJ 3OSSC 4A63B 4AFSC 3QZ9B 4M77B 4JJNK 1AWJA 1KC8R 3H0FA 5CO7A 1C6VX 3JCMV 3LGLA 1H8KA 1VQMA 2FL7A 5FU6C 3J7AF 4B9WA 4ZGJB 4QT7A 4C5IA 1C0MA 3PMIA 5FRMA 3SD4A 4GLMA 1MV3A 1Y96B 4N0AA 3CXCP 1G8XA 3FIFA 2D8HA 1U8RA 1GCQA 4Z02A 1WHMA 1JXOA 2LCLA 4GBQA 1F1BB 2RQTA 3JCMg 3QPHA 4E7SA 3CCRT 1PHTA 4RMOA 2H3EB 3EGXA 2FRYA 4F04B 4J7FA 1UDLA 2GNCA 5KYYA 2R5AA 1G2BA 4IURA 3I56T 1WZOA 4BD3A 4KUIA 1AT1B 3UF4A 2PTKA 4CRIA 1BKBA 1JQQA 1XNIA 4HVVA 2QA4Q 2JTFA 5GMKj 2CZ1B 4XAXB 1UJ0A 1WHGA 3C0CA 2QQAA 2CP3A 3HP9A 2E65A 1YI2T 2Y4XA 4ELZC 1D1CA 2RQRA 3VKIA 3OYCA 1NJIU 1Q82C 3CMAQ 1NYFA 4M77G 3I56A 1QW1A 2YRCA 2BZ8A 2KRNA 4M75C 3OYDA 1SF9A 1VQKA 4FIBA 4M75A 5CIUA 4IUTA 1AEYA 4PFOA 2LJ0A 2E5QA 2LT1A 2V1RA 1UJYA 1K9MC 5FU7C 4PJOF 1MUZA 1Q81R 1WLPB 3P8BB 1FMWA 4AFQC 2AKLA 2VKNA 2CS7A 1WDXA 3HL8A 3M59A 1VQ5T 2X4WA 2CZ0B 3PE0A 2YT6A 3CPWS 2PVDB 4NL3A 3PTAA 1NJIR 3TQ7P 3REBB 4OMMA 2AHJB 1KD1U 1BCMA 1FMKA 1YITQ 3BDLA 1YITA 1OZ3A 2QGFB 2JZ2A 1VQLQ 5FRNA 4DA4A 1ZHIA 1N6AA 2J06A 3ER0A 1PKTA 2DZ9A 5CKHA 2RHYA 1D09B 1OYXA 4PLLA 3PGGA 4A4FA 1XQHA 1SPKA 1N9SA 3H41A 4AG2C 5GAN5 3OYMA 1TWBA 4KGVB 1PRLC 3FC3A 3CCJA 4M7DA 1P92A 4C8QG 4J5YA 2CP6A 3L2QA 5FU6B 1W2BS 2JNGA 4KULA 5FWBA 4JDSA 5HK3A 4FT4A 1X6GA 3WXMB 3ZBDA 2L5QA 3CCMQ 4M75D 2L89A 3QJ6A 1OV3A 2K5LA 2VYTA 3CMEA 1YWOA 2RJFA 1KJWA 2EBPA 5KYNA 4PJNA 1VQ7Q 1KQ2A 2CUBA 3CCET 4FW2A 1LJOA 5AT1B 3OW2A 5LL6S 3OS5A 4PJOC 4EPCA 1M1KC 2PUOB 1U1SA 4OMLA 3VS1A 5GANj 4KH1B 1BI3A 2XDDA 3FB9A 1LCKA 1MHNA 3MEVA 2DL7A 3EH1A 1BI0A 4XQ3A 4EMGA 4D6WA 2EQIA 1EZZB 2MPXC 3MEWA 3JCMX 1PSEA 1IREB 4A54A 2DEUA 2D6FA 3I55Q 1Q81U 1BB9A 1ABOA 2PVOB 2L8DA 3ZEHA 1VYVA 5EC7A 5KH6A 2XU8A 4GLKA 2CZ7B 4J9CA 2EQMA 1Q86C 3SEMA 1SRLA 4M7AG 3EFOA 3REAB 1TG0A 3LH5A 2V8JA 4RTZA 1OQKA 3CC2A 4YTLA 1D0ZA 2DBMA 2ZPEB 4E7LA 1TUDA 2KT1A 1RLQC 3HTRA 1BIAA 3L42A 1W4SA 2CGHA 4II1A 4F7UF 2XG8D 3OYIA 5GAOm 1UB4A 4PJMA 2R5MA 2CP7A 1U5SA 4CI0C 2QEXT 4DQ2A 2EPDA 1WPYA 3M0PA 1Q81C 5KCOA 4FCYA 1I07A 1UGRB 1M1FA 3M53A 5GAOn 2DMOA 1C1AA 1NBEB 3UA7A 3RBBB 2CSIA 1TSFA 2HMAA 1N8RR 1WIEA 5I21A 4L6V5 3AT1B 2KMTA 2DNUA 2HKNA 1YIJA 3VU3C 4HCCA 4C8QB 3RKYA 1U06A 2GF7A 1XTDA 4JLIA 1Q82R 1Y57A 4AT1B 4BDZA 2GFAA 3OW2P 5KYWA 4XTZA 1KHIA 3MP1A 1PRMC 3JAME 5KYXA 1RABB 4J83A 1WQWA 2O9VA 5A2QE 2EJ9A 2MK5A 1V76A 4HVWA 4B9XA 4F17A 3JCMh 4BY6C 5L23A 2D0QB 3LH0A 6AT1B 2RJCA 4RG8A 3VUBA 1D0XA 3TU4K 4XTVA 5M9OA 1NJIC 2YRDA 3HRSA 3RERA 2CREA 2RHZA 1NM7A 2COWA 2HL5C 1K8AC 5KYUA 3CCMT 4O6JA 3OYBA 2AT1B 4RTXA 3M58A 4M7AD 3RMSA 3OYNA 2JMCA 4FSXA 4LDUA 2RI2A 1X2KA 4ATOA 1RAFB 3FEOA 5CR2A 1BCOA 2EWNA 2NUTA 1QVFP 1YN8A 2E5KA 1PNJA 2DD5A 5GANh 2V8IA 2HL3A 5GANg 4F7UE 4OGCA 3CXCS 2QQSA 2YUOA 4XTXA 5CQYA 2M0OA 4D8KA 2V1QA 3MPUB 1GFDA 4ZGEB 3LGFA 1BI2A 4MZPA 4M4ZA 4JJBA 3EG0A 2DO3A 1RAAB 1N9RA 2HQXA 2XMFA 4TVRA 1WXTA 1UFFA 5IHKA 4PJLA 4ZTJA 4O5VA 1WJRA 1PC0A 1H3ZA 3I55A 4F7UA 1KQSA 1RLPC 1S1NA 1AWXA 3UATA 1YJWA 1X2QA 2CKKA 1CSKA 4J9BA 2LQWA 1HD3A 3OS2A 3OYHA 5FROA 2K2MA 2XI9A 1M90U 3A8OB 2GQVA 5GANf 1NYGA 1MMNA 3PVLA 1CKAA 1X43A 1HK9A 4A53A 1KQ1A 2HBWA 1YBYA 1SKUB 1KG1A 2RHUA 4M7AA 4PKCC 4OMOA 2I2LA 3OYJA 3GPLA 3CCQT 1VQ6T 2X51A 2DETA 2B8AA 3M0UA 2LVMA 4M7AC 1DJ7B 1B3QA 3QWYA 3PFSA 1KQSP 4ZN3A 1HJDA 1AZEA 1QP3A 1UUEA 2A37A 2EVRA 3RMQA 1M30A 4MDWA 5CKBA 1KC8C 2M1HA 1VQ6A 5KCHA 5GMKe 1I5OB 4HA8A 3AHUA 4C5GA 1M9SA 2E12A 1I5LA 3JRZA 2RQVA 5CAIA 4L5GA 2IIMA 3H6ZA 4OB2B 2QGGA 1VYTA 1PSFA 4OB3B 5J26A 1B7TA 1VQ4A 1RAGB 5GAMf 2X35A 2YLBA 1TUGB 4PJJA 5GAOp 1BK2A 2EYYA 3H9NA 2FRWA 3I55T 1GRIA 3T9NA 5IN1A 1MMAA 2X4YA 1QCNA 1Y7XA 2XIDA 2KYMA 4QW2A 2NLUA 3M57A 2J7IA 1G3YA 2O2OA 2DZCA 2YXYA 2E41A 1IGQA 3EAEA 3QDRB 2DTHA 1OU8A 1LPLA 1ZUYA 2HKQB 4FL6A 3JB9F 2L3PA 5IAYA 4EMHA 1PD1A 3SB2A 3BW1A 1YIJQ 1BI1A 3OQ5A 2Y4YA 2M0YA 3TSZA 4XTWA 4A4EA 2HSPA 4OB1B 3NTKA 2P4TA 4Q5WA 4HCBA 2LNVA 1E6GA 1IHWA 3OYYA 3GIBA 5DM7R 5DLQE 1JEGA 2QXFA 4R55A 2IPOB 2JS0A 3CC7Q 2EYQA 1VQ5Q 1FWZA 2M51A 4JS4A 1GFCA 2DVJA 4IUUA 4F7UB 2EYWA 5AYFA 4QQDA 1K0XA 5C6SA 3OW2S 3HFNA 2DJZA 5GAN2 4X34A 3EG2A 3P8DA 2B86A 1WFWA 2PU9B 4NL2A 2GTJA 2XDPA 3X26B 3QUIA 1ZA2B 4N0AC 2EW3A 3LW5E 4J9FA 1YITT 4N4GA 2BUDA 1OX8A 1VQ6Q 4CC7A 3CC4A 4N4HA 3NFCA 1LOJA 2J05A 4L59A 2F2WA 4OMPA 5GAN8 1Y07A 3JB9I 1R77A 3C94A 2Z0WA 2EIFA 5GAMe 3JCMc 1X27A 2E4HA 4E6RA 3EGXB 2MAMA 2LCCA 2MWOA 2XICA 5LJ3f 4EMKB 4M77C 3I56Q 1VQOT 3SFMA 1PWTA 2QDLA 2A28A 2DVEA 3CPFA 3CBMA 2ZPGB 4LD9K 3LWIA 4C92B 2ECZA 2RNAA 3G4SA 3E9GA 1FXXA 2FO0A 1X6OA 3GNGA 4HT9A 2BZYA 3WVEB 2ROTA 2FZCB 3JB9H 2KRMA 5GAMj 1B07A 2OTLT 1PM3A 3CC4T 5GMKh 4C92E 5IT9E 2A3LA 4C0GA 1VUBA 2L0AA 3QO3A 1YCSB 4C8QE 9ATCB 1EIFA 1OPLA 1YHQA 4AMCA 3OYGA 2LX7A 2QTVA 1VQ7A 2DFUA 2CP5A 4HT8A 1Q82U 1QCFA 1RAHB 4J6XA 3FRNA 2E70A 4PK4A 5CCAA 1I81A 1ZSZC 2LZ6B 3OS1A 1D3BB 5D6YA 2QA4A 5LJ5j 1QVFS 2YLCA 4DBHA 4DBRA 2C06A 4M7DG 1TH7A 4WF2A 1GBQA 5IHNA 3CD6A 3X24B 3VS7A 4MDXA 1G3SA 3H0HA 1MNEA 2IVWA 4JRPA 1FMVA 2DIGA 4OGEA 3NHNA 1QLYA 3NGPA 2CP0A 4RKUE 4JRQA 4FSSA 1SSFA 4R56A 3D7SB 4ESRA 1ARKA 3P8HA 1H92A 2F2VA 4IIMA 3A8MB 2YUPA 3CCUA 4JPBW 4J6YA 5D7UA 3JCMd 2KGTA 2O9SA 4M77D 4HVUA 5HCKA 4M78G 3RNJA 2DPPB 3V8KA 2EGAA 2RI3A 2QDYB 5KYYB 2D0NA 1UHCA 2DXTA 3G71Q 8AT1B 2PQWA 3L2VA 2QQBA 4FYWB 1VQLT 2HEQA 4V2SA 1VQ4Q 4RG2A 3BE3A 2NUTB 4C0DB 1IHVA 1BIBA 3OBWA 2LT4A 1R8OB 3QIIA 4MZMA 2JM9A 3VV0A 1OEBA 1IO6A 1Y0MA 2DIQA 3G6EA 1S72Q 1S72A 3CCSA 1AZGB 4NOYA 2DX1A 4XU3A 1LNXA 3CPWP 4EDUA 1SG5A 5A0DA 2VUBA 3LLRA 2FPEA 2GQIA 1ZBXA 1UGSB 3QBYA 4C92A 1KK7A 3OSVA 1WA7A 4JRKA 2P0KA 3CCRA 2MOXA 1ZA1B 1QCOA 3M9QA 3OYFA 5GAOl 2E6ZA 2FB7A 1M1KR 1K4US 3G4SQ 2ZAEA 2KYBA 1WI7A 5GAOr 3OA6A 5FLXE 3VYHB 4E7HA 1I8FA 2YDLA 2Y90A 4C8QA 2EYXA 3NTIA 4XU2A 3A8GB 1WGSA 3VS4A 1QQJA 4M75G 1TUCA 1YJ9T 1U3OA 1SHGA 2L3SA 1R0CB 4E7ZA 3CCUQ 1D3BA 1RUWA 1SSHA 1YJWT 1VQOQ 1VQ8Q 2VGNA 3MEAA 5GJWB 2PZ1A 3QXEB 4Y28E 1MV0B 3CC7T 1UGPB 2EJFA 4E7JA 1AD5A
chains in the Genus database with same CATH topology
1SHFA 1RLPC 4D8DA 1S1NA 1AWXA 3UATA 1ZUUA 1X2QA 1CSKA 3O5ZA 4A63B 4AFSC 2DJQA 4J9BA 2LQWA 1HD3A 1V1CA 4J9GA 1AWJA 2K2MA 2J6OA 2O31A 1WXUA 2X3XD 3H0FA 4Z8AA 1NYGA 1H8KA 3CQTA 2LJ1A 4RTYA 1EFNA 3PVLA 1CKAA 1X43A 4DEXA 3EG3A 2PNIA 4QT7A 2FPDA 1UG1A 2HBWA 4HXJA 1WX6A 4OMOA 4GLMA 1Z9ZA 1MV3A 3I9QA 1J3TA 1M3AA 4HCKA 5ECAA 5IXFA 1KSWA 3M0UA 2EGCA 2JMAA 2ED0A 2OAWA 2D8HA 1B3QA 1GCQA 3QWYA 4J9IA 2ABLA 4RTVA 1JXOA 1HJDA 4GBQA 1AZEA 3M0SA 1UUEA 4KRTA 2A37A 2EVRA 4F14A 2RQTA 1M30A 2D1XA 1KIKA 1PHTA 2X3WD 4Y92A 1VYUA 2FRYA 4JJCA 1UDLA 2GNCA 5IHIA 2JTEA 4WCIA 1ZUKA 1G2BA 1T0HA 2JW4A 4F16A 2RQVA 2IIMA 2KROA 3SHWA 3UF4A 1JO8A 2PTKA 2C0IA 1A0NB 1JQQA 1N5ZA 4HVVA 1VYTA 2RMOA 3THKA 2RN8A 2C0OA 1M3CA 1UJ0A 2OI3A 3C0CA 1W70A 2YUNA 2CH4W 2K9GA 1GCPA 2KXCA 1BK2A 2DRKA 2EYYA 3R6NA 2FRWA 2H8HA 1GRIA 2RQRA 2O88A 1OPKA 1NYFA 4RTWA 2BZ8A 1BU1A 2KRNA 2KYMA 1K1ZA 2JXBA 2J7IA 2O2OA 3UA6A 1ZSGA 4J9DA 1AEYA 3I5RA 2LJ0A 1M3BA 2A36A 2V1RA 1WXBA 1UJYA 4ORZA 1ZLMA 2JM8A 3VS5A 1ABQA 1ZUYA 2KT8A 1MUZA 5FW9A 1WLPB 3QWXX 2YUQA 2L3PA 2HDAA 4AFQC 4AG1C 2AKLA 2VKNA 4OMNA 1WDXA 2MIOA 4JZ4A 2LMJA 4J9HA 3PE0A 2YT6A 1JU5C 4J9EA 3EGUA 2M0YA 1RI9A 3TSZA 3REBB 2HSPA 4OMMA 4JJDA 1FMKA 2AZSA 1E6GA 2EGEA 4K11A 1JEGA 2K7AA 2JS0A 2J06A 2G6FX 2M51A 2DE0X 2KR3A 2LNHB 5IH2A 1PKTA 1GFCA 2DVJA 1T3SA 5I11A 3M0QA 1G83A 2AK5A 2EYWA 1SPKA 3H41A 1K0XA 4AG2C 1NEGA 2LJ3A 2D8JA 1NEBA 2FG0A 2DLPA 1PRLC 3EG2A 2B86A 1WFWA 2DL4A 4EIKA 2K79A 2GTJA 2SEMA 2EYZA 5FWBA 2NWMA 2DM1A 2J6KA 3VRZA 4LUEA 1QKWA 1X6GA 4CC2A 1AWWA 2EW3A 2RF0A 4J9FA 2J6FA 4LN2A 4CC7A 2CDTA 2JS2A 1OV3A 2KBTA 2KE9A 1YWOA 2J05A 1KJWA 2F2WA 4OMPA 2RPNA 3VS3A 2CSQA 2EBPA 4AFUC 2KEAA 5GJVB 1WYXA 1X27A 2CT3A 2ED1A 4E6RA 1W6XA 2CUBA 1NLPC 2DRMA 3GBQA 2CT4A 1PWTA 2QDLA 2A28A 4RUGA 2ESWA 2MCNA 4OMLA 2ECZA 3VS1A 2RNAA 3PVQA 1T3LA 2FO0A 2BZXA 3VRYA 1NLOC 1LCKA 2BZYA 2ROTA 2DL7A 2W0ZA 5IXBA 1UE9A 2EQIA 2KRMA 1B07A 2DF6A 1I1JA 4LNPA 2L0AA 2VWFA 4R0KA 1YCSB 1BB9A 4RTUA 2AKKA 1OPLA 1UTIA 1GBRA 1ABOA 2ROLA 1YNZA 3EG1A 2LX7A 1VYVA 5EC7A 1QCFA 2A08A 2SRCA 4J9CA 3EHRA 2LZ6B 1SRLA 3SEMA 3REAB 3I5SA 2AZVA 2K6DA 1TG0A 3LH5A 1W1FA 4RTZA 2DA9A 1ZX6A 1GBQA 3IQLA 5IHNA 2DBMA 3VS7A 3NMZC 3H0HA 3ZL7C 1HSQA 2LP5A 1TUDA 2LCSA 2KT1A 1GL5A 1FYNA 1RLQC 2F2XA 3NHNA 1QLYA 2KRSA 3NGPA 2BTTA 4CC3A 1XOVA 4FSSA 2L2PA 4ESRA 1ARKA 2RQWA 1UGVA 1U5SA 3TSWA 1AVZC 1H92A 2EPDA 2ENMA 2F2VA 2GTOA 4IIMA 1JXMA 1QKXA 3M0PA 1I07A 1KFZA 2YUPA 4JPBW 1E6HA 2DMOA 2DL5A 3UA7A 3RBBB 2CSIA 2KGTA 1K9AA 2O9SA 4HVUA 5HCKA 4AFZC 3RNJA 2P4RA 2DYBA 1WIEA 2GGRA 2C0TA 3NPFA 2EGAA 3ULRB 2D0NA 2HCKA 1UHCA 2DNUA 2CH4A 1OOTA 1U06A 2RQUA 1X6BA 1AOJA 1K0SA 1Y57A 4LE9A 1M8MA 2HEQA 4LUDA 2DL8A 2L3QA 2DL3A 3M0TA 1PRMC 4CC4B 1VA7A 2JM9A 2I0NA 1BBZA 1OEBA 1K76A 2O9VA 3A98A 1UECA 3VS6A 5I22A 4ZNXA 1IO6A 1Y0MA 4HVWA 4Z89A 2FEIA 4F17A 1YWPA 5L23A 1QWEA 3M0RA 4JZ3A 1AZGB 2DX1A 4DEYA 2CREA 2DILA 1NM7A 3U23A 4IIOA 2FPEA 1YP5A 4X1VA 2GQIA 1ZBJA 2JT4A 2NUZA 4Z88A 1WA7A 4RTXA 2MOXA 2DBKA 3I35A 2JMCA 1AWOA 1T0JA 1QWFA 1X2KA 1NG2A 1CKBA 2K3BA 1M27C 1Z9QA 2KXDA 4RTTA 1K4US 2KYBA 1WI7A 1YN8A 2E5KA 3KFVA 1PNJA 1H3HA 2YDLA 2W10A 4OMQA 3EHQA 3H0IA 2CUDA 1GCQC 2OJ2A 2EYXA 2LQNA 3JV3A 2GBQA 2YUOA 5FWCA 3VS4A 1UHFA 3TVTA 3FJ5A 4D8KA 1TUCA 2V1QA 2EKHA 1SEMA 1GFDA 1U3OA 2VVKA 1SHGA 2L3SA 2FPFA 1SRMA 1RUWA 1E7OA 1SSHA 3VS0A 4M4ZA 4JJBA 1PKSA 3EG0A 2PZ1A 5GJWB 2XMFA 1X69A 1WXTA 2KNBB 1MV0B 1UFFA 2YSQA 5IHKA 3VS2A 1AD5A 1I0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHF A;  1RLP C;  4D8D A;  1S1N A;  1AWX A;  3UAT A;  1ZUU A;  1X2Q A;  1CSK A;  3O5Z A;  4A63 B;  4AFS C;  2DJQ A;  4J9B A;  2LQW A;  1HD3 A;  1V1C A;  4J9G A;  1AWJ A;  2K2M A;  2J6O A;  2O31 A;  1WXU A;  2X3X D;  3H0F A;  4Z8A A;  1NYG A;  1H8K A;  3CQT A;  2LJ1 A;  4RTY A;  1EFN A;  3PVL A;  1CKA A;  1X43 A;  4DEX A;  3EG3 A;  2PNI A;  4QT7 A;  2FPD A;  1UG1 A;  2HBW A;  4HXJ A;  1WX6 A;  4OMO A;  4GLM A;  1Z9Z A;  1MV3 A;  3I9Q A;  1J3T A;  1M3A A;  4HCK A;  5ECA A;  5IXF A;  1KSW A;  3M0U A;  2EGC A;  2JMA A;  2ED0 A;  2OAW A;  2D8H A;  1B3Q A;  1GCQ A;  3QWY A;  4J9I A;  2ABL A;  4RTV A;  1JXO A;  1HJD A;  4GBQ A;  1AZE A;  3M0S A;  1UUE A;  4KRT A;  2A37 A;  2EVR A;  4F14 A;  2RQT A;  1M30 A;  2D1X A;  1KIK A;  1PHT A;  2X3W D;  4Y92 A;  1VYU A;  2FRY A;  4JJC A;  1UDL A;  2GNC A;  5IHI A;  2JTE A;  4WCI A;  1ZUK A;  1G2B A;  1T0H A;  2JW4 A;  4F16 A;  2RQV A;  2IIM A;  2KRO A;  3SHW A;  3UF4 A;  1JO8 A;  2PTK A;  2C0I A;  1A0N B;  1JQQ A;  1N5Z A;  4HVV A;  1VYT A;  2RMO A;  3THK A;  2RN8 A;  2C0O A;  1M3C A;  1UJ0 A;  2OI3 A;  3C0C A;  1W70 A;  2YUN A;  2CH4 W;  2K9G A;  1GCP A;  2KXC A;  1BK2 A;  2DRK A;  2EYY A;  3R6N A;  2FRW A;  2H8H A;  1GRI A;  2RQR A;  2O88 A;  1OPK A;  1NYF A;  4RTW A;  2BZ8 A;  1BU1 A;  2KRN A;  2KYM A;  1K1Z A;  2JXB A;  2J7I A;  2O2O A;  3UA6 A;  1ZSG A;  4J9D A;  1AEY A;  3I5R A;  2LJ0 A;  1M3B A;  2A36 A;  2V1R A;  1WXB A;  1UJY A;  4ORZ A;  1ZLM A;  2JM8 A;  3VS5 A;  1ABQ A;  1ZUY A;  2KT8 A;  1MUZ A;  5FW9 A;  1WLP B;  3QWX X;  2YUQ A;  2L3P A;  2HDA A;  4AFQ C;  4AG1 C;  2AKL A;  2VKN A;  4OMN A;  1WDX A;  2MIO A;  4JZ4 A;  2LMJ A;  4J9H A;  3PE0 A;  2YT6 A;  1JU5 C;  4J9E A;  3EGU A;  2M0Y A;  1RI9 A;  3TSZ A;  3REB B;  2HSP A;  4OMM A;  4JJD A;  1FMK A;  2AZS A;  1E6G A;  2EGE A;  4K11 A;  1JEG A;  2K7A A;  2JS0 A;  2J06 A;  2G6F X;  2M51 A;  2DE0 X;  2KR3 A;  2LNH B;  5IH2 A;  1PKT A;  1GFC A;  2DVJ A;  1T3S A;  5I11 A;  3M0Q A;  1G83 A;  2AK5 A;  2EYW A;  1SPK A;  3H41 A;  1K0X A;  4AG2 C;  1NEG A;  2LJ3 A;  2D8J A;  1NEB A;  2FG0 A;  2DLP A;  1PRL C;  3EG2 A;  2B86 A;  1WFW A;  2DL4 A;  4EIK A;  2K79 A;  2GTJ A;  2SEM A;  2EYZ A;  5FWB A;  2NWM A;  2DM1 A;  2J6K A;  3VRZ A;  4LUE A;  1QKW A;  1X6G A;  4CC2 A;  1AWW A;  2EW3 A;  2RF0 A;  4J9F A;  2J6F A;  4LN2 A;  4CC7 A;  2CDT A;  2JS2 A;  1OV3 A;  2KBT A;  2KE9 A;  1YWO A;  2J05 A;  1KJW A;  2F2W A;  4OMP A;  2RPN A;  3VS3 A;  2CSQ A;  2EBP A;  4AFU C;  2KEA A;  5GJV B;  1WYX A;  1X27 A;  2CT3 A;  2ED1 A;  4E6R A;  1W6X A;  2CUB A;  1NLP C;  2DRM A;  3GBQ A;  2CT4 A;  1PWT A;  2QDL A;  2A28 A;  4RUG A;  2ESW A;  2MCN A;  4OML A;  2ECZ A;  3VS1 A;  2RNA A;  3PVQ A;  1T3L A;  2FO0 A;  2BZX A;  3VRY A;  1NLO C;  1LCK A;  2BZY A;  2ROT A;  2DL7 A;  2W0Z A;  5IXB A;  1UE9 A;  2EQI A;  2KRM A;  1B07 A;  2DF6 A;  1I1J A;  4LNP A;  2L0A A;  2VWF A;  4R0K A;  1YCS B;  1BB9 A;  4RTU A;  2AKK A;  1OPL A;  1UTI A;  1GBR A;  1ABO A;  2ROL A;  1YNZ A;  3EG1 A;  2LX7 A;  1VYV A;  5EC7 A;  1QCF A;  2A08 A;  2SRC A;  4J9C A;  3EHR A;  2LZ6 B;  1SRL A;  3SEM A;  3REA B;  3I5S A;  2AZV A;  2K6D A;  1TG0 A;  3LH5 A;  1W1F A;  4RTZ A;  2DA9 A;  1ZX6 A;  1GBQ A;  3IQL A;  5IHN A;  2DBM A;  3VS7 A;  3NMZ C;  3H0H A;  3ZL7 C;  1HSQ A;  2LP5 A;  1TUD A;  2LCS A;  2KT1 A;  1GL5 A;  1FYN A;  1RLQ C;  2F2X A;  3NHN A;  1QLY A;  2KRS A;  3NGP A;  2BTT A;  4CC3 A;  1XOV A;  4FSS A;  2L2P A;  4ESR A;  1ARK A;  2RQW A;  1UGV A;  1U5S A;  3TSW A;  1AVZ C;  1H92 A;  2EPD A;  2ENM A;  2F2V A;  2GTO A;  4IIM A;  1JXM A;  1QKX A;  3M0P A;  1I07 A;  1KFZ A;  2YUP A;  4JPB W;  1E6H A;  2DMO A;  2DL5 A;  3UA7 A;  3RBB B;  2CSI A;  2KGT A;  1K9A A;  2O9S A;  4HVU A;  5HCK A;  4AFZ C;  3RNJ A;  2P4R A;  2DYB A;  1WIE A;  2GGR A;  2C0T A;  3NPF A;  2EGA A;  3ULR B;  2D0N A;  2HCK A;  1UHC A;  2DNU A;  2CH4 A;  1OOT A;  1U06 A;  2RQU A;  1X6B A;  1AOJ A;  1K0S A;  1Y57 A;  4LE9 A;  1M8M A;  2HEQ A;  4LUD A;  2DL8 A;  2L3Q A;  2DL3 A;  3M0T A;  1PRM C;  4CC4 B;  1VA7 A;  2JM9 A;  2I0N A;  1BBZ A;  1OEB A;  1K76 A;  2O9V A;  3A98 A;  1UEC A;  3VS6 A;  5I22 A;  4ZNX A;  1IO6 A;  1Y0M A;  4HVW A;  4Z89 A;  2FEI A;  4F17 A;  1YWP A;  5L23 A;  1QWE A;  3M0R A;  4JZ3 A;  1AZG B;  2DX1 A;  4DEY A;  2CRE A;  2DIL A;  1NM7 A;  3U23 A;  4IIO A;  2FPE A;  1YP5 A;  4X1V A;  2GQI A;  1ZBJ A;  2JT4 A;  2NUZ A;  4Z88 A;  1WA7 A;  4RTX A;  2MOX A;  2DBK A;  3I35 A;  2JMC A;  1AWO A;  1T0J A;  1QWF A;  1X2K A;  1NG2 A;  1CKB A;  2K3B A;  1M27 C;  1Z9Q A;  2KXD A;  4RTT A;  1K4U S;  2KYB A;  1WI7 A;  1YN8 A;  2E5K A;  3KFV A;  1PNJ A;  1H3H A;  2YDL A;  2W10 A;  4OMQ A;  3EHQ A;  3H0I A;  2CUD A;  1GCQ C;  2OJ2 A;  2EYX A;  2LQN A;  3JV3 A;  2GBQ A;  2YUO A;  5FWC A;  3VS4 A;  1UHF A;  3TVT A;  3FJ5 A;  4D8K A;  1TUC A;  2V1Q A;  2EKH A;  1SEM A;  1GFD A;  1U3O A;  2VVK A;  1SHG A;  2L3S A;  2FPF A;  1SRM A;  1RUW A;  1E7O A;  1SSH A;  3VS0 A;  4M4Z A;  4JJB A;  1PKS A;  3EG0 A;  2PZ1 A;  5GJW B;  2XMF A;  1X69 A;  1WXT A;  2KNB B;  1MV0 B;  1UFF A;  2YSQ A;  5IHK A;  3VS2 A;  1AD5 A;  1I0C A; 
#chains in the Genus database with same CATH topology
 4XTY A;  4E47 A;  1KD1 R;  1VIE A;  2ZZD A;  1YJN A;  3A1P A;  1RL2 A;  3JSC A;  1ZUU A;  2DJQ A;  3DB3 A;  3QZ5 B;  1V1C A;  3M4G A;  2ZPI B;  4PFP A;  2O31 A;  2GCX A;  2HQE A;  2X3X D;  4M7D C;  1IRX A;  4LD6 A;  3CQT A;  2LJ1 A;  2QTX A;  1YJ9 A;  2HNI A;  1VQ9 A;  2PNI A;  2FPD A;  2PUK B;  1WX6 A;  2CYZ B;  1Z9Z A;  3I9Q A;  1M3A A;  4HCK A;  1HXD A;  2KVQ G;  5DY9 A;  4QVC A;  5IXF A;  1K9M U;  2FZG B;  1B34 B;  3HPW A;  3PIP A;  1Y96 A;  3FJP A;  2DKG A;  3CCL Q;  1UEB A;  2EQU A;  1KQS S;  1IZ6 A;  3LYI A;  5EG2 A;  2RB6 A;  3M0S A;  4KRT A;  2DER A;  2D1X A;  5FU7 B;  4N4I A;  2X3W D;  1VYU A;  3E9F A;  3INZ A;  1VQK T;  3CCQ A;  2HBP A;  4BY6 B;  2RHX A;  1VQ9 T;  5GAN 6;  1ZUK A;  2E3H A;  3TRE A;  1T0H A;  2JW4 A;  4F16 A;  4GY5 A;  3CME T;  1NZ9 A;  2KRO A;  3SHW A;  1JO8 A;  1N27 A;  1N5Z A;  4KT0 E;  4QKU A;  3SWN C;  2RN8 A;  2C0O A;  1M3C A;  3GNF B;  4FYY B;  1GXI E;  2NYS A;  2YUN A;  2CH4 W;  1IB8 A;  2K9G A;  1GCP A;  2DRK A;  2DXC A;  4WTO B;  2ZGW A;  1OPK A;  4Y91 A;  4ZN1 A;  4RTW A;  3RR6 A;  2XK0 A;  3J80 E;  1BU1 A;  3CC4 Q;  4OMF B;  1WQ7 A;  2WSF E;  1K1Z A;  2JXB A;  3UA6 A;  1VQP A;  1VQ9 Q;  1ZSG A;  4J9D A;  1ZSZ A;  3I5R A;  3CCJ Q;  1M3B A;  3VUZ A;  2A36 A;  1WXB A;  2JN0 A;  4C92 D;  1ZLM A;  4XK8 E;  1ABQ A;  4M77 E;  3QWX X;  2YUQ A;  5LJ5 g;  2HDA A;  1H64 1;  2VXE A;  4OMN A;  3MJX A;  3E2U A;  1RI0 A;  1WJS A;  1ZSZ B;  4KGZ B;  4ZGD B;  1QVG P;  4J9E A;  3G71 A;  1N8R U;  2KI7 A;  1MND A;  4NS5 A;  3C12 A;  4IUP A;  3ME9 A;  5LJ3 j;  3UDC A;  5GAM g;  4PJO E;  2MYS A;  1AHJ B;  3UT1 A;  2QAS A;  2EGE A;  2K7A A;  1D1A A;  2BE7 D;  3RIR A;  4LDX A;  2G6F X;  4P5N A;  2DE0 X;  3CMA A;  2LNH B;  1VQP T;  2OTJ T;  3OB9 A;  3M4Y A;  1MMD A;  4M78 D;  1TU0 B;  4J7I A;  1Q86 R;  2BKD N;  5LJ5 d;  3S3M A;  1QVP A;  1S72 T;  3MO8 A;  2LJ3 A;  2VXF A;  2D8J A;  3QG1 A;  2FG0 A;  2JOY A;  2VB6 A;  2DLP A;  2HQH A;  5A0G A;  4EIK A;  1NE8 A;  1QVG S;  5GMK i;  2HSE B;  2FZK B;  2EYZ A;  2DM1 A;  3VRZ A;  5CK9 A;  5LJ3 h;  2V8K A;  1QKW A;  5KYW B;  2RA2 A;  1K9M R;  2J6F A;  4C8Q D;  3L1A A;  3OMG A;  2LQK A;  4ME7 A;  3CCU T;  2JS2 A;  2KBT A;  2RPN A;  3Q1J A;  3V7R A;  1XJW B;  4QQ6 A;  5LJ5 f;  2E64 A;  1M2V A;  5CVI A;  1WYX A;  1TXQ A;  2CT3 A;  1NLP C;  2DRM A;  2CZ6 B;  2M02 A;  1YIJ T;  3GBQ A;  3TCJ A;  2A0F B;  5CKD A;  1RAD B;  1QP2 A;  3A8H B;  2EFI A;  4BI3 A;  3EG9 A;  5GAN e;  1KD1 C;  3F70 A;  2XDB A;  2RJE A;  1NLO C;  4OF1 A;  1D0Y A;  3CC2 T;  2W0Z A;  1I4K 1;  3SWN A;  4B6M A;  3CCS T;  4A4G A;  1UGQ B;  4J8O A;  1YJN Q;  4LNP A;  4JUV A;  4M78 E;  4R0K A;  3M56 A;  4F7U G;  3CCQ Q;  3VJP A;  2AKK A;  1QVF A;  3QJY A;  1GBR A;  2KY9 A;  3UWN A;  3EG1 A;  2WSC E;  2RK2 A;  5J39 A;  3EFO B;  2RD1 A;  3EHR A;  3X28 B;  2E1H A;  2OTL A;  4PLI A;  3L2R A;  2BIV A;  2QG9 B;  2K6D A;  8ATC B;  2ZCF B;  1VQL A;  1W1F A;  5KE2 A;  2QQR A;  2DA9 A;  2EJG A;  3IQL A;  1G5V A;  3HRT A;  1M1K U;  3JB9 G;  3M54 A;  1G3T A;  4BAC A;  2VC8 A;  3ZL7 C;  1JJ2 S;  2LCS A;  5GAO q;  1WJQ A;  5CQX A;  2KRS A;  2BTT A;  1XOV A;  2E3I A;  1OUL A;  2K57 A;  2RQW A;  3QHS A;  1RAE B;  3BY7 A;  3TSW A;  2XD0 A;  1OZ2 A;  2ENM A;  2GTO A;  3CCV Q;  2M16 A;  3QYH B;  3CCL A;  4C0F A;  1WHK A;  5KYX B;  5I2M A;  4QVD A;  1E6H A;  5A0L A;  4PJO A;  4C5H A;  3KUF A;  3OYL A;  2OTL Q;  2FYK A;  5LJ3 d;  1VQN Q;  3NPF A;  2C0T A;  3FLG A;  1IGU A;  3ULR B;  2HCK A;  3L2U A;  2CH4 A;  2HD0 A;  3OMC A;  4M75 B;  4E7K A;  3CD6 T;  2NUP A;  1OOT A;  2H3J A;  2GFU A;  5LJ5 h;  3EGD A;  3M5A A;  2AIR B;  2LTO A;  1VIF A;  2DL8 A;  2HZY A;  1WHL A;  1IXD A;  2X4X A;  3JCM W;  2RI5 A;  3M0T A;  2RM4 A;  2F69 A;  5GMK l;  1W2B P;  1BBZ A;  5GAN 7;  3A8L B;  2A7Y A;  1UEC A;  1QVG A;  3VS6 A;  4KGX B;  4ZNX A;  5LJ3 g;  3HHT B;  4ELY C;  4Z89 A;  4C92 F;  1QWE A;  3CCR Q;  3BFM A;  7AT1 B;  3CXC A;  3JCM b;  5C0M A;  4C0Z A;  3R6O A;  2DIL A;  2O4X B;  3U23 A;  4IIO A;  1YP5 A;  3J81 E;  2JT4 A;  3CCS Q;  3G1J A;  1PCX A;  1HYO A;  2QI2 A;  1QMC A;  3CCV A;  3VYG A;  1AWO A;  1T0J A;  1QWF A;  1Q7Y U;  3CCV T;  2KAF A;  1B34 A;  3CCE A;  1WHJ A;  1NG2 A;  4PJO D;  2K3B A;  2KXD A;  4RTT A;  1PG5 B;  5GAM h;  3QSU A;  2MI6 A;  3MP6 A;  2ZPB B;  4A4H A;  3KFV A;  1Q95 G;  4OMQ A;  3H0I A;  4QQG A;  2LDM A;  2OJ2 A;  4BE2 A;  2LQN A;  2X9H A;  3RDV A;  5FWC A;  4J6W A;  1UHF A;  2EKH A;  3JCM f;  1SEM A;  4BE1 A;  2VVK A;  4XTU A;  3OYA A;  4JRI A;  2FPF A;  1SRM A;  4X9C A;  1E7O A;  2KSS A;  3VS0 A;  1PKS A;  1K73 C;  1ZQ1 A;  2CP2 A;  3JB9 J;  2MMP A;  3MCA B;  2YSQ A;  5LJ3 e;  1KC8 U;  2K5F A;  1VQM Q;  1TS9 A;  2VAS A;  4JS5 A;  1M27 C;  3DKM A;  5D6X A;  4C5E A;  4D8D A;  2FHD A;  2G3R A;  3OBY A;  3MHX A;  2YWW A;  3O5Z A;  5GAN 4;  3MP8 A;  4J9G A;  1K8A U;  2X4J A;  3C4S A;  2J6O A;  1WXU A;  1LVK A;  4M75 F;  4Z8A A;  5CKF A;  4C8Q F;  4RTY A;  1EFN A;  1WHH A;  4LDW A;  1Q7Y C;  4DEX A;  3EG3 A;  2DYI A;  1UG1 A;  4HXJ A;  3L2Z A;  1VQ8 A;  3QYG B;  3CC2 Q;  3L2W A;  1J3T A;  2DD4 A;  2QEX A;  5ECA A;  1KSW A;  3MEU A;  4DOV A;  2EGC A;  2OTJ Q;  4M7D E;  2JMA A;  2ED0 A;  2K5I A;  2OAW A;  4IUQ A;  2MF2 A;  1VQM T;  4J9I A;  2ABL A;  1K73 U;  2QAZ A;  4RTV A;  4F14 A;  2DTI A;  1KIK A;  2EQK A;  4Y92 A;  4JJC A;  4DOW A;  5GMK m;  2RK1 A;  1WNL A;  2F5T X;  5DLO A;  5IHI A;  2JTE A;  4WCI A;  5J3B A;  3JCM P;  2COY A;  1VOM A;  1M2O A;  5L8R E;  3CD6 Q;  1TOV A;  2C0I A;  1A0N B;  4PJO G;  1VQ7 T;  3KBG A;  2RMO A;  3THK A;  5CKE A;  2P0Q A;  2JVV A;  3EFS A;  2OAU A;  2OI3 A;  1W70 A;  2KXC A;  3R6N A;  2H8H A;  2O88 A;  4PNO A;  4IUV A;  4DBF A;  2KK4 A;  3G71 T;  4XU0 A;  1JBM A;  3RKW A;  4BDY A;  1K73 R;  1MGQ A;  2FVU A;  4FM4 B;  1OI1 A;  3JCM e;  4M7A E;  2JTM A;  2HAX A;  1BYM A;  2F1L A;  4ORZ A;  3QDF A;  2JM8 A;  4M77 A;  3VS5 A;  2KT8 A;  5FW9 A;  2DAQ A;  1M1G A;  2YRV A;  4X9D A;  4AG1 C;  2MIO A;  3EG9 B;  4JZ4 A;  2LMJ A;  1YJW Q;  1X75 C;  2KQW A;  1O75 A;  3DB4 A;  4RCB A;  1TTH B;  4J9H A;  1JU5 C;  1YCY A;  3EGU A;  2RO0 A;  4M78 A;  1RI9 A;  3KXT A;  4JJD A;  2XKO C;  3SWN B;  2AZS A;  1ACM B;  1M2V B;  5LJ5 e;  4K11 A;  2D9T A;  3LWH A;  2KR3 A;  1YJN T;  4BE0 A;  5IH2 A;  4FU6 A;  2K4Y A;  1T3S A;  5I11 A;  3M0Q A;  3GP8 A;  1M90 C;  1JB0 E;  2YHT A;  1G83 A;  2K3Y A;  2AK5 A;  4EMK C;  2M9U A;  2LC4 A;  1NEG A;  3PIO A;  1YHQ Q;  1NEB A;  4JLG A;  4EMK A;  4C92 C;  3TEE A;  1YI2 Q;  1YI2 A;  2DL4 A;  1VQP Q;  2K79 A;  2ATC B;  2SEM A;  2NWM A;  2J6K A;  2RJD A;  4HKE A;  4LUE A;  2LRQ A;  4CC2 A;  1AWW A;  3CCE Q;  1R0B G;  2RF0 A;  3ASK A;  2DXB A;  4LN2 A;  2CDT A;  2WSE E;  2R57 A;  2KE9 A;  4HCZ A;  4BUG A;  4ZTF A;  1Q7Y R;  4LDV A;  5GAN d;  1PD0 A;  3VS3 A;  2CSQ A;  2L3R A;  2DK3 A;  4AFU C;  1VQK Q;  2KEA A;  4MZT A;  5GJV B;  1OX9 A;  2ED1 A;  2OTJ A;  1W6X A;  4OVA A;  3V7C A;  1M90 R;  5GAN 3;  3FDR A;  2BE9 B;  4PL6 A;  2CT4 A;  2PVG B;  2EAY A;  2RHI A;  4RUG A;  2ESW A;  2MCN A;  4M7A F;  1JJ2 P;  5KYU B;  3PVQ A;  1T3L A;  4OP0 A;  2BZX A;  3VRY A;  3CCM A;  4M7D F;  2VGM A;  3A5Z B;  2LQ8 A;  1M5Q 1;  3X25 B;  3DLL A;  3PT9 A;  5IXB A;  4ANJ A;  1UE9 A;  3CEY A;  4QVZ A;  2DF6 A;  3EGD B;  3PNW C;  5HKC A;  1I1J A;  3MKD A;  2COZ A;  4RCC A;  2VWF A;  3V7S A;  4RTU A;  4M75 E;  1UTI A;  1VQ4 T;  2ROL A;  1YNZ A;  2JUF A;  3N5B B;  2QEX Q;  2A08 A;  2K3X A;  3SDZ A;  3OYE A;  3V8J A;  5HY6 A;  2SRC A;  4OB0 B;  1M4Z A;  2V26 A;  1NPP A;  4FW1 A;  3JB9 D;  2VV5 A;  4M78 C;  2WAC A;  3I5S A;  2AZV A;  3CC7 A;  3CBP A;  3GOX A;  4BI4 A;  1ZX6 A;  3CPW A;  2O01 E;  3PMT A;  2R58 A;  3NMZ C;  3EH2 A;  2O4X A;  1HSQ A;  2LP5 A;  2EKO A;  2ZPH B;  1GL5 A;  1FYN A;  2F2X A;  1YJ9 Q;  4M7D D;  2MWP A;  4IKF A;  4CC3 A;  1EX4 A;  2L2P A;  3WVD B;  1VQ8 T;  1UGV A;  2LX9 A;  3M55 A;  1G3W A;  1VQN T;  1AVZ C;  3S3N A;  4KUD K;  1VQN A;  1V29 B;  3CCL T;  1JXM A;  1QKX A;  2ZPF B;  1X01 A;  4C0D C;  1MMG A;  1KFZ A;  3E19 A;  1VQ5 A;  4FYX B;  1RAI B;  2DL5 A;  3QKJ A;  3OYK A;  1K9A A;  4AFZ C;  2XHC A;  2P4R A;  2DYB A;  1M8V A;  3S6W A;  2GGR A;  1VQO A;  1FX7 A;  4LXC A;  1JJ2 A;  2EQJ A;  3G6E Q;  2RQU A;  4M78 B;  1X6B A;  3HRU A;  1AOJ A;  3OS0 A;  1K0S A;  2E10 A;  2OX7 A;  4LE9 A;  1M8M A;  3RES A;  4C8Q C;  4LUD A;  3EFR A;  2L3Q A;  2DL3 A;  3X20 B;  1JRI A;  2P84 A;  3BDU A;  4PFZ A;  2QYZ A;  4CC4 B;  1VA7 A;  2DTO A;  2I0N A;  5I2S A;  1K76 A;  4BI8 B;  4M7A B;  3A98 A;  3HKS A;  4DBQ A;  3CCJ T;  5I22 A;  4E2F B;  2FEI A;  3MET A;  1U1T A;  4FYV B;  4M78 F;  5KE3 A;  2P0P A;  1O9S A;  1YWP A;  3DLM A;  3RKX A;  3M0R A;  3URG A;  4JZ3 A;  4UC4 A;  4DEY A;  3ZFJ A;  3G4S T;  3CMA T;  4X1V A;  1W2B A;  4M77 F;  1ZBJ A;  3LX7 A;  2NUZ A;  4MML A;  4Z88 A;  3CME Q;  2QK0 A;  2F5K A;  3S3O A;  4VUB A;  2DBK A;  3I35 A;  5D6W A;  3G7Z A;  3JCM Q;  4A4K A;  5HK0 A;  1CKB A;  1Z9Q A;  1RAC B;  2QA4 T;  3GLX A;  1H3H A;  2E6N A;  2W10 A;  2KDS A;  3EHQ A;  1D1B A;  4C92 G;  2CUD A;  2NUP B;  2DEQ A;  5GAM d;  1GCQ C;  4E7I A;  3RUX A;  3JV3 A;  2GBQ A;  2K2V A;  3TVT A;  3FJ5 A;  4MMK A;  3V8L A;  1YHQ T;  3H8Z A;  3NTH A;  2QQ9 A;  3C95 A;  2DXU A;  4M7D B;  1Q86 U;  3E1S A;  1KHC A;  4PJO B;  2IG0 A;  3HSB A;  4LDY A;  4KBM B;  3GF5 A;  2JJ9 A;  1X69 A;  1N8R C;  1YFN A;  2KNB B;  1NPR A;  3HFO A;  3O8V A;  2RH2 A;  3UPU A;  1K8A R;  4FT2 A;  4KH0 B;  3VS2 A;  4XU1 A;  1I0C A;  3CBO A;  1Y71 A;  1SHF A;  4BB7 A;  3OY9 A;  3G6E T;  1OU9 A;  3JCM J;  3OSS C;  4A63 B;  4AFS C;  3QZ9 B;  4M77 B;  4JJN K;  1AWJ A;  1KC8 R;  3H0F A;  5CO7 A;  1C6V X;  3JCM V;  3LGL A;  1H8K A;  1VQM A;  2FL7 A;  5FU6 C;  3J7A F;  4B9W A;  4ZGJ B;  4QT7 A;  4C5I A;  1C0M A;  3PMI A;  5FRM A;  3SD4 A;  4GLM A;  1MV3 A;  1Y96 B;  4N0A A;  3CXC P;  1G8X A;  3FIF A;  2D8H A;  1U8R A;  1GCQ A;  4Z02 A;  1WHM A;  1JXO A;  2LCL A;  4GBQ A;  1F1B B;  2RQT A;  3JCM g;  3QPH A;  4E7S A;  3CCR T;  1PHT A;  4RMO A;  2H3E B;  3EGX A;  2FRY A;  4F04 B;  4J7F A;  1UDL A;  2GNC A;  5KYY A;  2R5A A;  1G2B A;  4IUR A;  3I56 T;  1WZO A;  4BD3 A;  4KUI A;  1AT1 B;  3UF4 A;  2PTK A;  4CRI A;  1BKB A;  1JQQ A;  1XNI A;  4HVV A;  2QA4 Q;  2JTF A;  5GMK j;  2CZ1 B;  4XAX B;  1UJ0 A;  1WHG A;  3C0C A;  2QQA A;  2CP3 A;  3HP9 A;  2E65 A;  1YI2 T;  2Y4X A;  4ELZ C;  1D1C A;  2RQR A;  3VKI A;  3OYC A;  1NJI U;  1Q82 C;  3CMA Q;  1NYF A;  4M77 G;  3I56 A;  1QW1 A;  2YRC A;  2BZ8 A;  2KRN A;  4M75 C;  3OYD A;  1SF9 A;  1VQK A;  4FIB A;  4M75 A;  5CIU A;  4IUT A;  1AEY A;  4PFO A;  2LJ0 A;  2E5Q A;  2LT1 A;  2V1R A;  1UJY A;  1K9M C;  5FU7 C;  4PJO F;  1MUZ A;  1Q81 R;  1WLP B;  3P8B B;  1FMW A;  4AFQ C;  2AKL A;  2VKN A;  2CS7 A;  1WDX A;  3HL8 A;  3M59 A;  1VQ5 T;  2X4W A;  2CZ0 B;  3PE0 A;  2YT6 A;  3CPW S;  2PVD B;  4NL3 A;  3PTA A;  1NJI R;  3TQ7 P;  3REB B;  4OMM A;  2AHJ B;  1KD1 U;  1BCM A;  1FMK A;  1YIT Q;  3BDL A;  1YIT A;  1OZ3 A;  2QGF B;  2JZ2 A;  1VQL Q;  5FRN A;  4DA4 A;  1ZHI A;  1N6A A;  2J06 A;  3ER0 A;  1PKT A;  2DZ9 A;  5CKH A;  2RHY A;  1D09 B;  1OYX A;  4PLL A;  3PGG A;  4A4F A;  1XQH A;  1SPK A;  1N9S A;  3H41 A;  4AG2 C;  5GAN 5;  3OYM A;  1TWB A;  4KGV B;  1PRL C;  3FC3 A;  3CCJ A;  4M7D A;  1P92 A;  4C8Q G;  4J5Y A;  2CP6 A;  3L2Q A;  5FU6 B;  1W2B S;  2JNG A;  4KUL A;  5FWB A;  4JDS A;  5HK3 A;  4FT4 A;  1X6G A;  3WXM B;  3ZBD A;  2L5Q A;  3CCM Q;  4M75 D;  2L89 A;  3QJ6 A;  1OV3 A;  2K5L A;  2VYT A;  3CME A;  1YWO A;  2RJF A;  1KJW A;  2EBP A;  5KYN A;  4PJN A;  1VQ7 Q;  1KQ2 A;  2CUB A;  3CCE T;  4FW2 A;  1LJO A;  5AT1 B;  3OW2 A;  5LL6 S;  3OS5 A;  4PJO C;  4EPC A;  1M1K C;  2PUO B;  1U1S A;  4OML A;  3VS1 A;  5GAN j;  4KH1 B;  1BI3 A;  2XDD A;  3FB9 A;  1LCK A;  1MHN A;  3MEV A;  2DL7 A;  3EH1 A;  1BI0 A;  4XQ3 A;  4EMG A;  4D6W A;  2EQI A;  1EZZ B;  2MPX C;  3MEW A;  3JCM X;  1PSE A;  1IRE B;  4A54 A;  2DEU A;  2D6F A;  3I55 Q;  1Q81 U;  1BB9 A;  1ABO A;  2PVO B;  2L8D A;  3ZEH A;  1VYV A;  5EC7 A;  5KH6 A;  2XU8 A;  4GLK A;  2CZ7 B;  4J9C A;  2EQM A;  1Q86 C;  3SEM A;  1SRL A;  4M7A G;  3EFO A;  3REA B;  1TG0 A;  3LH5 A;  2V8J A;  4RTZ A;  1OQK A;  3CC2 A;  4YTL A;  1D0Z A;  2DBM A;  2ZPE B;  4E7L A;  1TUD A;  2KT1 A;  1RLQ C;  3HTR A;  1BIA A;  3L42 A;  1W4S A;  2CGH A;  4II1 A;  4F7U F;  2XG8 D;  3OYI A;  5GAO m;  1UB4 A;  4PJM A;  2R5M A;  2CP7 A;  1U5S A;  4CI0 C;  2QEX T;  4DQ2 A;  2EPD A;  1WPY A;  3M0P A;  1Q81 C;  5KCO A;  4FCY A;  1I07 A;  1UGR B;  1M1F A;  3M53 A;  5GAO n;  2DMO A;  1C1A A;  1NBE B;  3UA7 A;  3RBB B;  2CSI A;  1TSF A;  2HMA A;  1N8R R;  1WIE A;  5I21 A;  4L6V 5;  3AT1 B;  2KMT A;  2DNU A;  2HKN A;  1YIJ A;  3VU3 C;  4HCC A;  4C8Q B;  3RKY A;  1U06 A;  2GF7 A;  1XTD A;  4JLI A;  1Q82 R;  1Y57 A;  4AT1 B;  4BDZ A;  2GFA A;  3OW2 P;  5KYW A;  4XTZ A;  1KHI A;  3MP1 A;  1PRM C;  3JAM E;  5KYX A;  1RAB B;  4J83 A;  1WQW A;  2O9V A;  5A2Q E;  2EJ9 A;  2MK5 A;  1V76 A;  4HVW A;  4B9X A;  4F17 A;  3JCM h;  4BY6 C;  5L23 A;  2D0Q B;  3LH0 A;  6AT1 B;  2RJC A;  4RG8 A;  3VUB A;  1D0X A;  3TU4 K;  4XTV A;  5M9O A;  1NJI C;  2YRD A;  3HRS A;  3RER A;  2CRE A;  2RHZ A;  1NM7 A;  2COW A;  2HL5 C;  1K8A C;  5KYU A;  3CCM T;  4O6J A;  3OYB A;  2AT1 B;  4RTX A;  3M58 A;  4M7A D;  3RMS A;  3OYN A;  2JMC A;  4FSX A;  4LDU A;  2RI2 A;  1X2K A;  4ATO A;  1RAF B;  3FEO A;  5CR2 A;  1BCO A;  2EWN A;  2NUT A;  1QVF P;  1YN8 A;  2E5K A;  1PNJ A;  2DD5 A;  5GAN h;  2V8I A;  2HL3 A;  5GAN g;  4F7U E;  4OGC A;  3CXC S;  2QQS A;  2YUO A;  4XTX A;  5CQY A;  2M0O A;  4D8K A;  2V1Q A;  3MPU B;  1GFD A;  4ZGE B;  3LGF A;  1BI2 A;  4MZP A;  4M4Z A;  4JJB A;  3EG0 A;  2DO3 A;  1RAA B;  1N9R A;  2HQX A;  2XMF A;  4TVR A;  1WXT A;  1UFF A;  5IHK A;  4PJL A;  4ZTJ A;  4O5V A;  1WJR A;  1PC0 A;  1H3Z A;  3I55 A;  4F7U A;  1KQS A;  1RLP C;  1S1N A;  1AWX A;  3UAT A;  1YJW A;  1X2Q A;  2CKK A;  1CSK A;  4J9B A;  2LQW A;  1HD3 A;  3OS2 A;  3OYH A;  5FRO A;  2K2M A;  2XI9 A;  1M90 U;  3A8O B;  2GQV A;  5GAN f;  1NYG A;  1MMN A;  3PVL A;  1CKA A;  1X43 A;  1HK9 A;  4A53 A;  1KQ1 A;  2HBW A;  1YBY A;  1SKU B;  1KG1 A;  2RHU A;  4M7A A;  4PKC C;  4OMO A;  2I2L A;  3OYJ A;  3GPL A;  3CCQ T;  1VQ6 T;  2X51 A;  2DET A;  2B8A A;  3M0U A;  2LVM A;  4M7A C;  1DJ7 B;  1B3Q A;  3QWY A;  3PFS A;  1KQS P;  4ZN3 A;  1HJD A;  1AZE A;  1QP3 A;  1UUE A;  2A37 A;  2EVR A;  3RMQ A;  1M30 A;  4MDW A;  5CKB A;  1KC8 C;  2M1H A;  1VQ6 A;  5KCH A;  5GMK e;  1I5O B;  4HA8 A;  3AHU A;  4C5G A;  1M9S A;  2E12 A;  1I5L A;  3JRZ A;  2RQV A;  5CAI A;  4L5G A;  2IIM A;  3H6Z A;  4OB2 B;  2QGG A;  1VYT A;  1PSF A;  4OB3 B;  5J26 A;  1B7T A;  1VQ4 A;  1RAG B;  5GAM f;  2X35 A;  2YLB A;  1TUG B;  4PJJ A;  5GAO p;  1BK2 A;  2EYY A;  3H9N A;  2FRW A;  3I55 T;  1GRI A;  3T9N A;  5IN1 A;  1MMA A;  2X4Y A;  1QCN A;  1Y7X A;  2XID A;  2KYM A;  4QW2 A;  2NLU A;  3M57 A;  2J7I A;  1G3Y A;  2O2O A;  2DZC A;  2YXY A;  2E41 A;  1IGQ A;  3EAE A;  3QDR B;  2DTH A;  1OU8 A;  1LPL A;  1ZUY A;  2HKQ B;  4FL6 A;  3JB9 F;  2L3P A;  5IAY A;  4EMH A;  1PD1 A;  3SB2 A;  3BW1 A;  1YIJ Q;  1BI1 A;  3OQ5 A;  2Y4Y A;  2M0Y A;  3TSZ A;  4XTW A;  4A4E A;  2HSP A;  4OB1 B;  3NTK A;  2P4T A;  4Q5W A;  4HCB A;  2LNV A;  1E6G A;  1IHW A;  3OYY A;  3GIB A;  5DM7 R;  5DLQ E;  1JEG A;  2QXF A;  4R55 A;  2IPO B;  2JS0 A;  3CC7 Q;  2EYQ A;  1VQ5 Q;  1FWZ A;  2M51 A;  4JS4 A;  1GFC A;  2DVJ A;  4IUU A;  4F7U B;  2EYW A;  5AYF A;  4QQD A;  1K0X A;  5C6S A;  3OW2 S;  3HFN A;  2DJZ A;  5GAN 2;  4X34 A;  3EG2 A;  3P8D A;  2B86 A;  1WFW A;  2PU9 B;  4NL2 A;  2GTJ A;  2XDP A;  3X26 B;  3QUI A;  1ZA2 B;  4N0A C;  2EW3 A;  3LW5 E;  4J9F A;  1YIT T;  4N4G A;  2BUD A;  1OX8 A;  1VQ6 Q;  4CC7 A;  3CC4 A;  4N4H A;  3NFC A;  1LOJ A;  2J05 A;  4L59 A;  2F2W A;  4OMP A;  5GAN 8;  1Y07 A;  3JB9 I;  1R77 A;  3C94 A;  2Z0W A;  2EIF A;  5GAM e;  3JCM c;  1X27 A;  2E4H A;  4E6R A;  3EGX B;  2MAM A;  2LCC A;  2MWO A;  2XIC A;  5LJ3 f;  4EMK B;  4M77 C;  3I56 Q;  1VQO T;  3SFM A;  1PWT A;  2QDL A;  2A28 A;  2DVE A;  3CPF A;  3CBM A;  2ZPG B;  4LD9 K;  3LWI A;  4C92 B;  2ECZ A;  2RNA A;  3G4S A;  3E9G A;  1FXX A;  2FO0 A;  1X6O A;  3GNG A;  4HT9 A;  2BZY A;  3WVE B;  2ROT A;  2FZC B;  3JB9 H;  2KRM A;  5GAM j;  1B07 A;  2OTL T;  1PM3 A;  3CC4 T;  5GMK h;  4C92 E;  5IT9 E;  2A3L A;  4C0G A;  1VUB A;  2L0A A;  3QO3 A;  1YCS B;  4C8Q E;  9ATC B;  1EIF A;  1OPL A;  1YHQ A;  4AMC A;  3OYG A;  2LX7 A;  2QTV A;  1VQ7 A;  2DFU A;  2CP5 A;  4HT8 A;  1Q82 U;  1QCF A;  1RAH B;  4J6X A;  3FRN A;  2E70 A;  4PK4 A;  5CCA A;  1I81 A;  1ZSZ C;  2LZ6 B;  3OS1 A;  1D3B B;  5D6Y A;  2QA4 A;  5LJ5 j;  1QVF S;  2YLC A;  4DBH A;  4DBR A;  2C06 A;  4M7D G;  1TH7 A;  4WF2 A;  1GBQ A;  5IHN A;  3CD6 A;  3X24 B;  3VS7 A;  4MDX A;  1G3S A;  3H0H A;  1MNE A;  2IVW A;  4JRP A;  1FMV A;  2DIG A;  4OGE A;  3NHN A;  1QLY A;  3NGP A;  2CP0 A;  4RKU E;  4JRQ A;  4FSS A;  1SSF A;  4R56 A;  3D7S B;  4ESR A;  1ARK A;  3P8H A;  1H92 A;  2F2V A;  4IIM A;  3A8M B;  2YUP A;  3CCU A;  4JPB W;  4J6Y A;  5D7U A;  3JCM d;  2KGT A;  2O9S A;  4M77 D;  4HVU A;  5HCK A;  4M78 G;  3RNJ A;  2DPP B;  3V8K A;  2EGA A;  2RI3 A;  2QDY B;  5KYY B;  2D0N A;  1UHC A;  2DXT A;  3G71 Q;  8AT1 B;  2PQW A;  3L2V A;  2QQB A;  4FYW B;  1VQL T;  2HEQ A;  4V2S A;  1VQ4 Q;  4RG2 A;  3BE3 A;  2NUT B;  4C0D B;  1IHV A;  1BIB A;  3OBW A;  2LT4 A;  1R8O B;  3QII A;  4MZM A;  2JM9 A;  3VV0 A;  1OEB A;  1IO6 A;  1Y0M A;  2DIQ A;  3G6E A;  1S72 Q;  1S72 A;  3CCS A;  1AZG B;  4NOY A;  2DX1 A;  4XU3 A;  1LNX A;  3CPW P;  4EDU A;  1SG5 A;  5A0D A;  2VUB A;  3LLR A;  2FPE A;  2GQI A;  1ZBX A;  1UGS B;  3QBY A;  4C92 A;  1KK7 A;  3OSV A;  1WA7 A;  4JRK A;  2P0K A;  3CCR A;  2MOX A;  1ZA1 B;  1QCO A;  3M9Q A;  3OYF A;  5GAO l;  2E6Z A;  2FB7 A;  1M1K R;  1K4U S;  3G4S Q;  2ZAE A;  2KYB A;  1WI7 A;  5GAO r;  3OA6 A;  5FLX E;  3VYH B;  4E7H A;  1I8F A;  2YDL A;  2Y90 A;  4C8Q A;  2EYX A;  3NTI A;  4XU2 A;  3A8G B;  1WGS A;  3VS4 A;  1QQJ A;  4M75 G;  1TUC A;  1YJ9 T;  1U3O A;  1SHG A;  2L3S A;  1R0C B;  4E7Z A;  3CCU Q;  1D3B A;  1RUW A;  1SSH A;  1YJW T;  1VQO Q;  1VQ8 Q;  2VGN A;  3MEA A;  5GJW B;  2PZ1 A;  3QXE B;  4Y28 E;  1MV0 B;  3CC7 T;  1UGP B;  2EJF A;  4E7J A;  1AD5 A; 
#chains in the Genus database with same CATH homology
 1SHF A;  1RLP C;  4D8D A;  1S1N A;  1AWX A;  3UAT A;  1ZUU A;  1X2Q A;  1CSK A;  3O5Z A;  4A63 B;  4AFS C;  2DJQ A;  4J9B A;  2LQW A;  1HD3 A;  1V1C A;  4J9G A;  1AWJ A;  2K2M A;  2J6O A;  2O31 A;  1WXU A;  2X3X D;  3H0F A;  4Z8A A;  1NYG A;  1H8K A;  3CQT A;  2LJ1 A;  4RTY A;  1EFN A;  3PVL A;  1CKA A;  1X43 A;  4DEX A;  3EG3 A;  2PNI A;  4QT7 A;  2FPD A;  1UG1 A;  2HBW A;  4HXJ A;  1WX6 A;  4OMO A;  4GLM A;  1Z9Z A;  1MV3 A;  3I9Q A;  1J3T A;  1M3A A;  4HCK A;  5ECA A;  5IXF A;  1KSW A;  3M0U A;  2EGC A;  2JMA A;  2ED0 A;  2OAW A;  2D8H A;  1B3Q A;  1GCQ A;  3QWY A;  4J9I A;  2ABL A;  4RTV A;  1JXO A;  1HJD A;  4GBQ A;  1AZE A;  3M0S A;  1UUE A;  4KRT A;  2A37 A;  2EVR A;  4F14 A;  2RQT A;  1M30 A;  2D1X A;  1KIK A;  1PHT A;  2X3W D;  4Y92 A;  1VYU A;  2FRY A;  4JJC A;  1UDL A;  2GNC A;  5IHI A;  2JTE A;  4WCI A;  1ZUK A;  1G2B A;  1T0H A;  2JW4 A;  4F16 A;  2RQV A;  2IIM A;  2KRO A;  3SHW A;  3UF4 A;  1JO8 A;  2PTK A;  2C0I A;  1A0N B;  1JQQ A;  1N5Z A;  4HVV A;  1VYT A;  2RMO A;  3THK A;  2RN8 A;  2C0O A;  1M3C A;  1UJ0 A;  2OI3 A;  3C0C A;  1W70 A;  2YUN A;  2CH4 W;  2K9G A;  1GCP A;  2KXC A;  1BK2 A;  2DRK A;  2EYY A;  3R6N A;  2FRW A;  2H8H A;  1GRI A;  2RQR A;  2O88 A;  1OPK A;  1NYF A;  4RTW A;  2BZ8 A;  1BU1 A;  2KRN A;  2KYM A;  1K1Z A;  2JXB A;  2J7I A;  2O2O A;  3UA6 A;  1ZSG A;  4J9D A;  1AEY A;  3I5R A;  2LJ0 A;  1M3B A;  2A36 A;  2V1R A;  1WXB A;  1UJY A;  4ORZ A;  1ZLM A;  2JM8 A;  3VS5 A;  1ABQ A;  1ZUY A;  2KT8 A;  1MUZ A;  5FW9 A;  1WLP B;  3QWX X;  2YUQ A;  2L3P A;  2HDA A;  4AFQ C;  4AG1 C;  2AKL A;  2VKN A;  4OMN A;  1WDX A;  2MIO A;  4JZ4 A;  2LMJ A;  4J9H A;  3PE0 A;  2YT6 A;  1JU5 C;  4J9E A;  3EGU A;  2M0Y A;  1RI9 A;  3TSZ A;  3REB B;  2HSP A;  4OMM A;  4JJD A;  1FMK A;  2AZS A;  1E6G A;  2EGE A;  4K11 A;  1JEG A;  2K7A A;  2JS0 A;  2J06 A;  2G6F X;  2M51 A;  2DE0 X;  2KR3 A;  2LNH B;  5IH2 A;  1PKT A;  1GFC A;  2DVJ A;  1T3S A;  5I11 A;  3M0Q A;  1G83 A;  2AK5 A;  2EYW A;  1SPK A;  3H41 A;  1K0X A;  4AG2 C;  1NEG A;  2LJ3 A;  2D8J A;  1NEB A;  2FG0 A;  2DLP A;  1PRL C;  3EG2 A;  2B86 A;  1WFW A;  2DL4 A;  4EIK A;  2K79 A;  2GTJ A;  2SEM A;  2EYZ A;  5FWB A;  2NWM A;  2DM1 A;  2J6K A;  3VRZ A;  4LUE A;  1QKW A;  1X6G A;  4CC2 A;  1AWW A;  2EW3 A;  2RF0 A;  4J9F A;  2J6F A;  4LN2 A;  4CC7 A;  2CDT A;  2JS2 A;  1OV3 A;  2KBT A;  2KE9 A;  1YWO A;  2J05 A;  1KJW A;  2F2W A;  4OMP A;  2RPN A;  3VS3 A;  2CSQ A;  2EBP A;  4AFU C;  2KEA A;  5GJV B;  1WYX A;  1X27 A;  2CT3 A;  2ED1 A;  4E6R A;  1W6X A;  2CUB A;  1NLP C;  2DRM A;  3GBQ A;  2CT4 A;  1PWT A;  2QDL A;  2A28 A;  4RUG A;  2ESW A;  2MCN A;  4OML A;  2ECZ A;  3VS1 A;  2RNA A;  3PVQ A;  1T3L A;  2FO0 A;  2BZX A;  3VRY A;  1NLO C;  1LCK A;  2BZY A;  2ROT A;  2DL7 A;  2W0Z A;  5IXB A;  1UE9 A;  2EQI A;  2KRM A;  1B07 A;  2DF6 A;  1I1J A;  4LNP A;  2L0A A;  2VWF A;  4R0K A;  1YCS B;  1BB9 A;  4RTU A;  2AKK A;  1OPL A;  1UTI A;  1GBR A;  1ABO A;  2ROL A;  1YNZ A;  3EG1 A;  2LX7 A;  1VYV A;  5EC7 A;  1QCF A;  2A08 A;  2SRC A;  4J9C A;  3EHR A;  2LZ6 B;  1SRL A;  3SEM A;  3REA B;  3I5S A;  2AZV A;  2K6D A;  1TG0 A;  3LH5 A;  1W1F A;  4RTZ A;  2DA9 A;  1ZX6 A;  1GBQ A;  3IQL A;  5IHN A;  2DBM A;  3VS7 A;  3NMZ C;  3H0H A;  3ZL7 C;  1HSQ A;  2LP5 A;  1TUD A;  2LCS A;  2KT1 A;  1GL5 A;  1FYN A;  1RLQ C;  2F2X A;  3NHN A;  1QLY A;  2KRS A;  3NGP A;  2BTT A;  4CC3 A;  1XOV A;  4FSS A;  2L2P A;  4ESR A;  1ARK A;  2RQW A;  1UGV A;  1U5S A;  3TSW A;  1AVZ C;  1H92 A;  2EPD A;  2ENM A;  2F2V A;  2GTO A;  4IIM A;  1JXM A;  1QKX A;  3M0P A;  1I07 A;  1KFZ A;  2YUP A;  4JPB W;  1E6H A;  2DMO A;  2DL5 A;  3UA7 A;  3RBB B;  2CSI A;  2KGT A;  1K9A A;  2O9S A;  4HVU A;  5HCK A;  4AFZ C;  3RNJ A;  2P4R A;  2DYB A;  1WIE A;  2GGR A;  2C0T A;  3NPF A;  2EGA A;  3ULR B;  2D0N A;  2HCK A;  1UHC A;  2DNU A;  2CH4 A;  1OOT A;  1U06 A;  2RQU A;  1X6B A;  1AOJ A;  1K0S A;  1Y57 A;  4LE9 A;  1M8M A;  2HEQ A;  4LUD A;  2DL8 A;  2L3Q A;  2DL3 A;  3M0T A;  1PRM C;  4CC4 B;  1VA7 A;  2JM9 A;  2I0N A;  1BBZ A;  1OEB A;  1K76 A;  2O9V A;  3A98 A;  1UEC A;  3VS6 A;  5I22 A;  4ZNX A;  1IO6 A;  1Y0M A;  4HVW A;  4Z89 A;  2FEI A;  4F17 A;  1YWP A;  5L23 A;  1QWE A;  3M0R A;  4JZ3 A;  1AZG B;  2DX1 A;  4DEY A;  2CRE A;  2DIL A;  1NM7 A;  3U23 A;  4IIO A;  2FPE A;  1YP5 A;  4X1V A;  2GQI A;  1ZBJ A;  2JT4 A;  2NUZ A;  4Z88 A;  1WA7 A;  4RTX A;  2MOX A;  2DBK A;  3I35 A;  2JMC A;  1AWO A;  1T0J A;  1QWF A;  1X2K A;  1NG2 A;  1CKB A;  2K3B A;  1M27 C;  1Z9Q A;  2KXD A;  4RTT A;  1K4U S;  2KYB A;  1WI7 A;  1YN8 A;  2E5K A;  3KFV A;  1PNJ A;  1H3H A;  2YDL A;  2W10 A;  4OMQ A;  3EHQ A;  3H0I A;  2CUD A;  1GCQ C;  2OJ2 A;  2EYX A;  2LQN A;  3JV3 A;  2GBQ A;  2YUO A;  5FWC A;  3VS4 A;  1UHF A;  3TVT A;  3FJ5 A;  4D8K A;  1TUC A;  2V1Q A;  2EKH A;  1SEM A;  1GFD A;  1U3O A;  2VVK A;  1SHG A;  2L3S A;  2FPF A;  1SRM A;  1RUW A;  1E7O A;  1SSH A;  3VS0 A;  4M4Z A;  4JJB A;  1PKS A;  3EG0 A;  2PZ1 A;  5GJW B;  2XMF A;  1X69 A;  1WXT A;  2KNB B;  1MV0 B;  1UFF A;  2YSQ A;  5IHK A;  3VS2 A;  1AD5 A;  1I0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...