2LJ0A

The third sh3 domain of r85fl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structure Basis for the Recognition of Ataxin-7 PRR with R85FL SH3 Domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj0A00
3EG0A 1X43A 2LQWA 2BZXA 2DL3A 3M0SA 1PRMC 2A36A 4D8KA 1T0HA 2K6DA 2A28A 3REAB 1U5SA 3H0FA 2RNAA 2KT1A 2MOXA 2DM1A 2ED1A 1G83A 2G6FX 1T3SA 2GNCA 2RQTA 2RF0A 1NLOC 3NPFA 4OMLA 2L2PA 2DE0X 1OPKA 1E6GA 1WLPB 1Z9ZA 4JZ3A 3TSWA 3UATA 1GCQC 1WXTA 1NG2A 2ECZA 2FPEA 1ZUUA 1GBRA 2FPFA 2D1XA 2YUQA 2LZ6B 2J06A 2QDLA 2YT6A 3NGPA 1VYTA 5IXBA 3PE0A 4JPBW 2KBTA 1GRIA 2FG0A 2J6FA 4QT7A 1UJYA 1KFZA 1SHGA 2D0NA 2KXCA 1BU1A 1YWPA 1GL5A 2LCSA 3VS0A 2FRYA 1OV3A 1M3CA 1YP5A 2O9VA 3ULRB 1SHFA 1SPKA 2RN8A 4CC7A 2GTJA 1ABOA 1UDLA 1WXBA 2DYBA 2PNIA 1XOVA 4LUDA 2NUZA 1TG0A 1KSWA 1FYNA 2DILA 2OI3A 1YNZA 2HSPA 2JS0A 1CKAA 2M51A 1WI7A 4F16A 2AZSA 4Y92A 3VS3A 4RTXA 2NWMA 2BZYA 4LN2A 3VS6A 4LE9A 3RNJA 2GTOA 1CSKA 1PKSA 3UA6A 2RPNA 3RBBB 3M0PA 3VS4A 4RTTA 4HCKA 1HJDA 1T3LA 1BBZA 1K76A 3CQTA 4J9EA 2MCNA 1PNJA 2K2MA 5ECAA 5HCKA 2YDLA 5I11A 2DVJA 1ABQA 3VS7A 2XMFA 1UE9A 1OOTA 2JT4A 2CUDA 1W6XA 2YUPA 1AZEA 2AKKA 2RQRA 4AFSC 2EW3A 3O5ZA 1CKBA 1Z9QA 4J9GA 1YN8A 3UA7A 1UJ0A 4JZ4A 1YWOA 1M3AA 2F2XA 1FMKA 4AFUC 4FSSA 1AOJA 2RMOA 1SRLA 1K0SA 4OMOA 2EVRA 3H41A 1NEGA 2B86A 1KIKA 3R6NA 2LJ0A 4Z8AA 2KYMA 4Z89A 1UHCA 4RTVA 1S1NA 1Y57A 3KFVA 1W70A 2KR3A 2LJ3A 1K1ZA 2KT8A 4ZNXA 5FWCA 2D8JA 1B07A 5EC7A 1X6BA 2ROTA 3VRYA 4M4ZA 1MUZA 1HD3A 2KRSA 2VVKA 4CC4B 1QWFA 1ZLMA 2JTEA 1AZGB 1B3QA 2K79A 1NYGA 1WDXA 2JS2A 3C0CA 2F2VA 2ABLA 2CSIA 4X1VA 1NYFA 4OMMA 2W0ZA 4GBQA 2KXDA 3UF4A 1RLQC 1TUCA 2HBWA 2KGTA 2A37A 2RQWA 2F2WA 2H8HA 1AEYA 2AZVA 2HEQA 1X2KA 2LNHB 4AG2C 3IQLA 3U23A 4AG1C 4J9CA 5IHNA 1ZUKA 2DBMA 2L3SA 4RTWA 1OEBA 4RUGA 1JU5C 4LUEA 1GCQA 2CH4A 2KEAA 2CH4W 2V1RA 2HCKA 3M0UA 2DL5A 3EHRA 1VYVA 2CREA 1PRLC 1AWOA 2D8HA 4R0KA 5GJVB 3NHNA 2L3PA 5FW9A 1RUWA 2EGCA 2ESWA 2J7IA 2JM9A 2DRMA 4JJCA 4HVWA 3QWYA 1M3BA 4WCIA 2EYWA 1GBQA 3A98A 4OMPA 4CC3A 3PVLA 3VS5A 1U06A 2FEIA 1OPLA 4J9IA 3EG1A 3LH5A 1JQQA 1SSHA 2CDTA 1SRMA 2X3XD 2YSQA 5GJWB 4OMNA 1WXUA 2MIOA 4A63B 3VRZA 3I5RA 4AFZC 1AWXA 4JJDA 1I1JA 1ZBJA 2CUBA 5L23A 2A08A 1QCFA 1TUDA 3QWXX 2JM8A 2SEMA 2DA9A 1JXOA 1X27A 2LP5A 1GFDA 4J9BA 1ZX6A 1W1FA 2JXBA 1E7OA 2EGEA 3M0RA 3M0QA 1BB9A 1AD5A 1UTIA 2KROA 2RQUA 3GBQA 1JO8A 2EBPA 2K3BA 2ROLA 2AK5A 2EQIA 2YUNA 4D8DA 2LQNA 1UG1A 1QKXA 1UECA 2EKHA 3H0HA 1WIEA 2SRCA 2DX1A 2IIMA 1A0NB 2KE9A 4IIOA 2O9SA 5IHKA 1Y0MA 2J6OA 3PVQA 4RTZA 3TVTA 4GLMA 1ARKA 1M8MA 1V1CA 2M0YA 3EG2A 1UGVA 3NMZC 2DJQA 1WA7A 2KRMA 4E6RA 1U3OA 1UFFA 3EGUA 1UHFA 1M30A 3I35A 1AWJA 1JXMA 1X2QA 2GBQA 4AFQC 4OMQA 1I0CA 2VKNA 2I0NA 1WYXA 4J9HA 4DEYA 3EHQA 2OJ2A 2DRKA 3M0TA 1T0JA 2DF6A 2V1QA 1IO6A 1G2BA 1PHTA 2OAWA 3SHWA 1PKTA 2HDAA 2EYZA 1NLPC 4DEXA 2ED0A 4F14A 2VWFA 2DBKA 4J9DA 2DMOA 1UUEA 1KJWA 1LCKA 2FO0A 4IIMA 1PWTA 1I07A 2BTTA 2JMCA 1QWEA 2ENMA 3H0IA 3THKA 4EIKA 2LJ1A 2DLPA 2P4RA 2CSQA 3ZL7C 2L0AA 3FJ5A 4ESRA 2AKLA 2C0IA 1VA7A 2K7AA 2FRWA 1AVZC 2L3QA 1X6GA 2EYXA 4LNPA 1WFWA 1GCPA 3TSZA 3I5SA 2C0TA 1X69A 1ZSGA 4K11A 1H8KA 3VS1A 2GQIA 2EPDA 5IHIA 1HSQA 1EFNA 2O2OA 2J6KA 5IXFA 2JW4A 1QKWA 4F17A 2KNBB 3REBB 1GFCA 5I22A 2DL4A 2E5KA 1SEMA 2LX7A 4HXJA 1QLYA 2EYYA 4KRTA 1WX6A 1K4US 2RQVA 4RTUA 1NM7A 2X3WD 1H3HA 2PTKA 1M27C 5IH2A 1VYUA 2C0OA 4ORZA 3JV3A 1RI9A 2DL7A 2J05A 2LMJA 2DL8A 3VS2A 1YCSB 4HVVA 3SEMA 1NEBA 2CT4A 1MV0B 2KYBA 4Z88A 5FWBA 2DNUA 1H92A 3I9QA 2JMAA 2PZ1A 4RTYA 2O31A 1BK2A 2GGRA 1K0XA 2FPDA 1N5ZA 4CC2A 1AWWA 4JJBA 1E6HA 2YUOA 1RLPC 4HVUA 2BZ8A 1K9AA 4J9FA 2W10A 2CT3A 2EGAA 1J3TA 2K9GA 2O88A 1ZUYA 2KRNA 1JEGA 1MV3A 3EG3A
chains in the Genus database with same CATH superfamily
1IREB 4FT2A 1VQOA 3DLLA 2ZGWA 5GAOq 2KMTA 1NBEB 4ZGEB 1WHMA 4D8KA 2DETA 1GXIE 3CC2A 2X4JA 1YFNA 1YJ9A 2OTJT 1YI2T 5DM7R 2RF0A 3PFSA 1O9SA 1XJWB 3FLGA 3H9NA 2DE0X 4JRQA 3OW2S 1M2OA 9ATCB 1GBRA 3CPWP 2CP2A 2FPFA 4OF1A 2ATCB 4MMKA 2YUQA 1YJNT 3JCMd 2LZ6B 1IB8A 3A8HB 1ACMB 1HK9A 2DFUA 3OYKA 1QVFS 3LLRA 4M78A 2KXCA 4FSXA 1G3SA 1GL5A 5LL6S 1KD1R 2MF2A 2LCSA 3VS0A 2FRYA 1OV3A 2DTIA 2H3JA 2FHDA 2O9VA 5DLQE 3CCVT 1SHFA 3CEYA 1N8RC 1NPPA 4F7UA 1ABOA 2DYBA 1XOVA 2WACA 3QHSA 4FIBA 4M7AD 1YNZA 4LXCA 4C5IA 1Q82U 2HSEB 3QKJA 1WI7A 4E7JA 3CC4A 3NTKA 4RTXA 2VUBA 1MMGA 2QTXA 3UA6A 1PKSA 3RBBB 3LX7A 4RTTA 3SDZA 1T3LA 1BBZA 4J9EA 4M7DE 4IURA 4FYWB 1PNJA 2K2MA 5I11A 5GANh 2DVJA 3VS7A 4JS4A 2Y4YA 5GANg 2QQSA 4M7DG 2AKKA 4M7DA 1BIBA 4AFSC 4C0DC 1B7TA 1M90R 2KAFA 3O5ZA 3CCUQ 3E9FA 1VQMQ 1VQPT 1Z9QA 4J9GA 2QG9B 1I5OB 5LJ5e 1K9MU 1H3ZA 3META 5GAN8 4J83A 4YTLA 4E7ZA 1M3AA 2EYQA 4QQDA 2F2XA 2L8DA 4TVRA 4AFUC 2RMOA 2DEUA 1UB4A 5DY9A 3TU4K 4OMOA 2EVRA 3H41A 1NEGA 4N4GA 2X4WA 2LJ0A 3H8ZA 4R55A 1NJIC 4C5GA 3NFCA 4N0AA 4Z89A 2E6ZA 3V8JA 1Y57A 2FYKA 3KFVA 4WF2A 1W70A 5FU7B 2DAQA 1ZQ1A 2LJ3A 1BI3A 4ZNXA 1EZZB 2CKKA 3L42A 2ROTA 4M7AF 2M16A 1MUZA 2KRSA 2VVKA 3SWNB 4CC4B 1NYGA 3KBGA 1M1KU 3C0CA 2F2VA 2CSIA 1NYFA 1LJOA 4OB0B 4OMMA 3SB2A 1VQ7Q 2W0ZA 3JB9I 3HL8A 4MDWA 2KSSA 4JRPA 1MMDA 3UF4A 2DXBA 2HBWA 4LDYA 3I55A 1G3TA 3VUBA 3CC2Q 3J80E 3URGA 2HEQA 2EWNA 2LNHB 3RUXA 1MMNA 4PJOB 3CCSA 3RDVA 4J9CA 4EPCA 4FYYB 1X75C 2RD1A 4KBMB 3G6EQ 1JU5C 4B6MA 3GLXA 3VU3C 1OU9A 5CQXA 2CH4W 2V1RA 3PIPA 3M0UA 2JZ2A 3OY9A 2X4YA 1PRLC 2WSCE 2D8HA 3V8KA 1Q82R 3NHNA 2QI2A 2D9TA 4FT4A 4ZN1A 2DEQA 4HT9A 4ELZC 1LPLA 1DJ7B 2JM9A 2VASA 2EQKA 2EJFA 1K73U 1GBQA 3A98A 3VS5A 5KYXA 1OPLA 5IT9E 3EH2A 3LH5A 3WVEB 1VQLA 1SSHA 2CDTA 1SRMA 3LWHA 4OMNA 1FWZA 1WXUA 4A63B 1JJ2P 1UGRB 1VQ6A 3I5RA 2QQBA 4JJDA 1I1JA 4P5NA 3UWNA 3ER0A 3CCUT 1VQMT 2YLCA 2JM8A 3FIFA 4A4KA 4KH0B 1KQ1A 1MNDA 3VV0A 4EMKC 1ZX6A 2JXBA 2WSEE 3OYIA 1TOVA 3M0RA 2F5TX 3SWNA 1OZ3A 2P0PA 3QPHA 1RAGB 1ZSZC 1YJWT 1UTIA 2GF7A 2RQUA 2EBPA 2O4XB 4DBRA 2PU9B 3ME9A 3FB9A 2EQIA 3PNWC 1BI0A 1UG1A 1VQ4A 4KH1B 1QKXA 3JCMe 4MZTA 2DIGA 3H0HA 4Q5WA 1WQWA 4M78F 4RKUE 2DD5A 2IIMA 2O9SA 3CXCP 4XTUA 5IHKA 1Y0MA 3TVTA 4RTZA 4PJOA 3CCQT 3RMSA 1M1KR 1VQ9T 4XTZA 5FROA 1VUBA 5LJ3g 3JAME 4E6RA 4F7UF 2E12A 2QA4A 3EGUA 2QXFA 1M30A 1N8RU 2GBQA 2A7YA 4C8QC 4AFQC 1M90C 1VQ7T 1BIAA 2HQXA 2VKNA 4QQ6A 3C12A 2XIDA 1WYXA 1VQOT 5GANd 1QVGS 4XU1A 4KUDK 4BDYA 3CC2T 1M2VB 5CKFA 3QXEB 2DF6A 1YJ9T 1G2BA 3OYHA 3QIIA 3I56A 2EYZA 3CBPA 3DB3A 1Y96B 2VWFA 2DBKA 2XKOC 1ZSZB 3QJ6A 5GAMj 2WSFE 1KJWA 2FO0A 3JCMc 1QWEA 2P84A 1WHLA 1FMWA 2X4XA 4C92B 2DLPA 5FU6B 1VQNQ 3I55Q 1RAIB 2AKLA 4PK4A 5D6XA 2L3QA 1AVZC 2ZAEA 3E19A 3HFOA 1GCPA 3HRUA 2RHXA 1X69A 3CCSQ 2QGGA 1ZSGA 3VS1A 1YHQA 2EPDA 5IHIA 1HSQA 2E65A 2XHCA 2J6KA 2O4XA 3CCRQ 2HD0A 2XDDA 1QKWA 4BI4A 1WJSA 1NJIU 3EGXB 4C8QB 4BI8B 1M1FA 1OQKA 5KE3A 2CP3A 4CI0C 5HK3A 4J7IA 1BCOA 4M77C 3CC4T 2EJGA 2QEXA 4BE0A 2LRQA 2X3WD 1H3HA 2PTKA 2NUTA 2Y4XA 4QW2A 2MI6A 4BD3A 2CT4A 1MV0B 4Z88A 1H92A 3GNGA 1BI2A 2M1HA 2F5KA 2FPDA 1I5LA 1TUGB 1HYOA 4HA8A 3ZBDA 2M0OA 4HVUA 2W10A 3CMAA 3L2WA 4EMKA 4XTVA 1VQ8A 1ZUYA 3LH0A 1Y96A 1N8RR 1ZSZA 1MV3A 5LJ5j 4Z02A 2LQWA 1Q81C 1T0HA 1U5SA 1VQ4Q 2O01E 2HL3A 4HCBA 1FMVA 3L2UA 4A4HA 2QK0A 3GP8A 4JRKA 4OMLA 2P0QA 1RABB 1WLPB 1Z9ZA 4JZ3A 4OB3B 3CMEA 5D6WA 1UGQB 2BIVA 2ECZA 1ZUUA 1R8OB 1V76A 2J06A 2QDLA 2QA4Q 2CZ7B 5GAN5 4JPBW 3EGXA 2J6FA 1UJYA 4BB7A 3E9GA 4Y91A 4C8QA 3HP9A 2D0NA 4E7HA 3OYAA 3CC7A 3OA6A 2E1HA 2KVQG 2RH2A 3CCVQ 1M3CA 1YP5A 3JCMf 3S3NA 1SPKA 2DK3A 4M7AE 4CC7A 2KY9A 2DTOA 2L5QA 3CCST 5CAIA 3M54A 1M1GA 1R0CB 1TG0A 2D6FA 1NJIR 2HKQB 4E7SA 2OI3A 4ELYC 1VQ5A 5FLXE 2HSPA 2JS0A 5LJ3d 2E3IA 4E7LA 2AZSA 1D1CA 4II1A 4PNOA 2BZYA 5A0LA 1VIEA 4IKFA 2XD0A 2PVGB 2RPNA 3VS4A 3M5AA 4XAXB 1K76A 4PJOF 5D6YA 4FU6A 3J81E 5ECAA 1RL2A 1TS9A 2IG0A 2XICA 1ABQA 3OW2A 3INZA 4FYXB 1M8VA 3L2ZA 1W6XA 4ATOA 3VJPA 1AZEA 1VQLT 3P8BB 2EW3A 4XTXA 4CRIA 3X28B 1TU0B 4XU2A 1VQ6T 1M90U 3UA7A 5GAOm 3C4SA 1UJ0A 4DBHA 1N6AA 1QVFA 1YWOA 2K4YA 2BE9B 1FMKA 4M77G 2LT1A 5GANe 3OYYA 4M77A 1KIKA 1ZA1B 4Z8AA 2KYMA 3PMTA 1WHJA 4RTVA 3CCEA 5GMKi 2X51A 3JCMV 1WPYA 4M7DB 1NZ9A 4XQ3A 3TCJA 3RKWA 2KR3A 3M58A 2KT8A 5FWCA 5J26A 1VQ4T 3MEAA 3M9QA 5EC7A 3VRYA 2CZ6B 3MEVA 4QVCA 4M4ZA 2OTLA 4LDXA 1WDXA 2VB6A 2ABLA 2E70A 3MP8A 5KYNA 2HAXA 4C92D 1VQ8Q 2XI9A 4LDVA 1RAHB 2RJFA 2KXDA 2QA4T 2CP5A 4PFOA 2A37A 3S3MA 1C0MA 4XU3A 3LYIA 3G1JA 2A0FB 3PIOA 3OYNA 1XQHA 1VQKA 3JCMP 1ZUKA 2DBMA 4C0GA 1YITA 3OYJA 5GAN6 4RUGA 3FDRA 3HHTB 2KEAA 2PVDB 3MKDA 3LGLA 1K8AC 5KYUB 1UGPB 1MNEA 1VYVA 3RKYA 1AWOA 3I56T 3OS1A 4R0KA 3GF5A 3G71A 2E10A 5FW9A 4JJNK 3JB9F 2ESWA 4JUVA 2J7IA 4DA4A 3PT9A 2PQWA 3X25B 1C1AA 4CC3A 3PVLA 5I21A 2FEIA 1WQ7A 8AT1B 1JQQA 4JS5A 2HL5C 1PC0A 2K5LA 3VRZA 1YHQT 2LDMA 4M75D 1TTHB 3V8LA 2CYZB 5GAN2 1ZBJA 4X9CA 4C92F 3FEOA 4AMCA 3QWXX 2RHUA 2SEMA 1JXOA 5FRNA 3OYFA 2LP5A 1GFDA 4J9BA 7AT1B 1ZA2B 1E7OA 2VXEA 2FZGB 4KUIA 1BB9A 1YJWQ 3OBYA 5KYXB 2AHJB 2QEXT 3OYDA 2K5IA 3V7CA 1PD1A 3OQ5A 5I2MA 4A4FA 2YUNA 5GAN7 4PJMA 2RHZA 4AT1B 2CZ0B 2MWOA 2C06A 2KDSA 5GAMh 3RERA 1PSFA 3CCJA 1A0NB 2JTFA 3MP6A 4BE1A 4IIOA 5GAMg 1N9SA 3CCQQ 1I4K1 2E64A 1ARKA 2E5QA 1M8MA 1OULA 2A3LA 1V1CA 3EG2A 3QG1A 1VQ9Q 2JVVA 4IUVA 1D1AA 3OYEA 3EAEA 1UFFA 3AHUA 4BDZA 3CMAT 5AYFA 3LW5E 5KYUA 1JXMA 2K57A 1X2QA 2DJZA 1PG5B 2FZCB 2MWPA 5KE2A 1VQ8T 2NYSA 1I0CA 1KQSS 3VYHB 1VQOQ 5GMKe 2YRDA 4C0DB 3KXTA 2OJ2A 5LJ3e 4M75F 3QSUA 1YJ9Q 1N9RA 1M4ZA 1IO6A 1PHTA 3OYLA 3G4SA 2OTLQ 3SHWA 4Y28E 3HSBA 3CMET 2DMOA 1UUEA 2BE7D 5GANf 4M78D 2COYA 2EAYA 4R56A 3J7AF 3H0IA 4J6WA 1U8RA 3SD4A 1D0ZA 3L2VA 2E41A 4ESRA 3FC3A 1SSFA 3QDRB 1X6GA 2EYXA 4LNPA 1WFWA 3C94A 5GAN3 2RM4A 3I5SA 3CC7T 1LNXA 4IUTA 3PGGA 1VQKQ 1FXXA 4K11A 1RADB 2G3RA 3O8VA 1YITQ 1O75A 2O2OA 5IXFA 1W2BA 2KNBB 1YCYA 3REBB 3A8GB 1GFCA 5HKCA 1Q81R 2DL4A 2K3XA 1EIFA 1SEMA 4HXJA 5LJ5h 1VQ5T 2M9UA 4GY5A 3CC4Q 5LJ5g 4RTUA 1QVGA 4D6WA 3MCAB 2COWA 3BY7A 1NM7A 2XK0A 2C0OA 3EFOB 2DXCA 4ORZA 4M7DD 3PTAA 3OW2P 2EQUA 1YIJA 3VS2A 1YCSB 4HVVA 3A8MB 2QQAA 5FWBA 4PLIA 3I9QA 3GNFB 2HNIA 2PUKB 4RTYA 1BK2A 3JSCA 2GGRA 2YRCA 4CC2A 4OGEA 1UEBA 1QVFP 1G3WA 4ZTFA 1K9AA 5CIUA 2CT3A 2PVOB 3ZFJA 3GOXA 5GAOn 2PUOB 2K9GA 2O88A 1W2BS 1IRXA 4A4EA 2NUTB 2DPPB 4XK8E 1VOMA 1JEGA 1TH7A 3EG3A 3BDUA 4IUPA 2BZXA 2F69A 2DL3A 2B8AA 3M0SA 2A36A 2BKDN 2FL7A 1X01A 2DZCA 2K6DA 4ZTJA 1BYMA 3H0FA 2MOXA 2ED1A 3CCET 1G83A 1T3SA 1AT1B 3H6ZA 5HK0A 2CS7A 3ZEHA 2GNCA 2RQTA 1NLOC 1QP3A 3NPFA 3CCJQ 2L2PA 2XU8A 1P92A 1E6GA 1TWBA 4ME7A 4PKCC 3S3OA 3UATA 1GCQC 1WXTA 5CCAA 1QQJA 4DOWA 5A0GA 2KK4A 1VIFA 4EMKB 2LCLA 2OTLT 2D1XA 1Q86C 3NGPA 2DD4A 5KYYA 1VYTA 5CKEA 1R0BG 4BUGA 2KBTA 4M7AC 1D1BA 4QT7A 2P4TA 1KFZA 4M7DF 3A1PA 1BU1A 5L8RE 3S6WA 3JCMX 2RJEA 3ULRB 2JNGA 3HPWA 1SKUB 2HMAA 2RN8A 2F1LA 1KC8C 2ZPFB 2GTJA 2DVEA 1UDLA 2ZPHB 1WXBA 2L3RA 3G4SQ 2PNIA 5GAMd 1VQKT 4LUDA 3MP1A 3EFOA 1RI0A 5KCHA 1YITT 4OVAA 1FYNA 1OZ2A 1KQ2A 1Q95G 2JJ9A 2M51A 4Y92A 3VS3A 4LN2A 1WJRA 2AT1B 1CSKA 3CPWS 1WGSA 3G71T 3M0PA 4N4IA 3CQTA 2NUPA 2CP6A 5A2QE 2ZPEB 3VKIA 2YDLA 2IVWA 5LJ3f 2R5AA 1OOTA 2QGFB 2YUPA 1KHIA 1VQLQ 3CD6A 4EDUA 4KGZB 1VQ6Q 3P8DA 1YN8A 3F70A 5GAOl 1M9SA 2QASA 2H3EB 2DXTA 3CBMA 4XU0A 3DKMA 4FSSA 1AOJA 2VV5A 3QO3A 3QZ5B 1K0SA 3GPLA 2B86A 2X35A 5M9OA 3OYGA 3PMIA 3BE3A 4L59A 3FRNA 1S1NA 2LC4A 1YIJQ 4J7FA 1K8AR 2ZPGB 1Y07A 4PJOD 3A8LB 2ZCFB 4BACA 1X6BA 2K3YA 1HD3A 1Y71A 1ZLMA 3CCJT 2JTEA 1AZGB 4B9WA 1NE8A 4M77B 3M59A 5GMKm 2DTHA 4C0FA 4X1VA 5I2SA 1HXDA 1RAEB 1TUCA 2GFAA 2KGTA 5D7UA 3P8HA 2RQWA 2YLBA 2F2WA 2H8HA 3UDCA 1MHNA 1X2KA 2P0KA 5GAOr 4AG2C 4AG1C 4A4GA 2GQVA 5IHNA 2E6NA 4NOYA 4E2FB 3EFSA 1OEBA 1MMAA 3G7ZA 4LUEA 3JCMQ 1GCQA 2CH4A 1LOJA 1QCNA 2M02A 2MYSA 2ZZDA 2HCKA 1SF9A 2QQ9A 5GMKj 3G4ST 3I56Q 1IGUA 3M4YA 5LJ3j 1TXQA 1U1SA 4M7AG 5CVIA 4M7AA 1RUWA 2EGCA 2GCXA 2HZYA 2R5MA 1IZ6A 2K5FA 4QVDA 2DRMA 4JJCA 3QWYA 3WVDB 3WXMB 4M75E 3CCMA 4J9IA 2XG8D 2X3XD 2YSQA 2RJCA 4XTYA 1W2BP 1ZBXA 3OMGA 1YHQQ 3QBYA 4AFZC 4M75G 1AWXA 3E2UA 2CUBA 5IN1A 1QCOA 1QCFA 2DA9A 3OYMA 1IXDA 1PM3A 1OYXA 1W1FA 3TQ7P 5CKBA 3M0QA 3QDFA 1QVGP 5GAN4 3NTHA 3MO8A 2RHYA 2V26A 3CPFA 5FRMA 2KROA 2QEXQ 3TEEA 3DLMA 2K3BA 5KH6A 4MDXA 2AK5A 1SG5A 3JB9D 4D8DA 2LQNA 3RKXA 1UECA 2EKHA 1YIJT 1Q86U 3CD6Q 1K73C 2LT4A 1WIEA 1LVKA 2SRCA 2DX1A 2KI7A 1IHWA 3PVQA 4GLMA 2V8KA 3C95A 4LD9K 3OS5A 3NMZC 3MJXA 1WA7A 2KRMA 3OMCA 1U3OA 3CMAQ 2HKNA 2L89A 1KC8U 3NTIA 5HY6A 2RB6A 3L2QA 1W4SA 4OMQA 1IGQA 5GAMe 4OMFB 3L2RA 1H641 4J9HA 4NL2A 4X34A 3BDLA 4C5EA 3EFRA 3QYGB 2DRKA 3M0TA 5J39A 3G6EA 1T0JA 2JUFA 3JCMW 2V1QA 2MMPA 4M78E 5KCOA 3ASKA 1YBYA 2V8JA 1NLPC 3CMEQ 4F14A 2VC8A 1LCKA 4FM4B 4IIMA 1PWTA 2BTTA 3T9NA 2JMCA 4C8QD 4M78G 2ENMA 6AT1B 3THKA 4EMGA 4F7UE 4LDWA 2LJ1A 3CXCS 2EQMA 2JOYA 2P4RA 3Q1JA 1Y7XA 3FJ5A 2C0IA 1I8FA 2K7AA 4O5VA 2FRWA 4F7UG 3CC7Q 3OB9A 4J6YA 2RHIA 3JB9H 1H8KA 2LQKA 2GQIA 1Q7YC 1WHKA 2E4HA 4LDUA 5FU7C 4DBFA 4F17A 1BCMA 1C6VX 2YHTA 3OS2A 5I22A 4ZN3A 1KQSA 1VQ5Q 2R57A 3SWNC 1Q81U 2EYYA 2VGMA 4KRTA 4MMLA 5A0DA 4HCCA 1TSFA 2VYTA 1QW1A 3OSVA 3M53A 5KYWB 1M27C 2DERA 1VYUA 3CCMQ 1NPRA 3JV3A 1RI9A 4PJNA 3X20B 3SEMA 1NEBA 2KYBA 1KK7A 2JMAA 1Q86R 1WHGA 3HKSA 2PZ1A 4PJOC 1K0XA 1N5ZA 2RI3A 4F04B 3CD6T 1AWWA 2Z0WA 4JJBA 1QMCA 4C8QF 1E6HA 3OBWA 4M77D 1RLPC 2CZ1B 2BZ8A 4J9FA 2EGAA 2DYIA 1KC8R 3EG0A 1X43A 3BW1A 3QJYA 4ZGDB 2FVUA 4OB2B 2OAUA 4B9XA 1PRMC 2LNVA 4JDSA 2A28A 3REAB 2FB7A 1IHVA 2RNAA 2KT1A 3CCEQ 2EJ9A 2DM1A 1WZOA 2G6FX 2QQRA 4PFPA 4RG2A 3OYCA 1OPKA 3TSWA 1NG2A 1D0YA 2AIRB 1WHHA 2FPEA 3BFMA 1S72A 1OX8A 1D3BB 2YT6A 1RAFB 3D7SB 1VQNA 5IXBA 3PE0A 4E47A 4EMHA 4FW2A 4ZGJB 1KHCA 1GRIA 2FG0A 3RR6A 1SHGA 4DOVA 1YWPA 3M57A 1JB0E 2Y90A 4GLKA 3FJPA 4L5GA 4PL6A 3CCRA 2QTVA 4JRIA 4N4HA 5KYWA 2CP0A 4PJLA 4M77F 2NUZA 4WTOB 2EFIA 1JRIA 1G8XA 4X9DA 5CKDA 2YWWA 5KYYB 1KSWA 5CQYA 2LTOA 2DILA 4IUUA 3MEUA 1CKAA 3EGDB 4F16A 4ANJA 1D0XA 2NWMA 4BY6C 3VS6A 4LE9A 4A53A 3RNJA 2GTOA 3G71Q 4O6JA 4HCKA 5GAMf 1HJDA 2XDBA 4V2SA 2MCNA 1QP2A 2VXFA 5HCKA 3VUZA 2XMFA 4JLIA 2JTMA 1UE9A 3A8OB 2JT4A 2CUDA 3CCMT 3TREA 4FCYA 4NL3A 4J6XA 2RQRA 4QVZA 1K9MR 2DO3A 1KD1C 1CKBA 4JZ4A 4NS5A 4RG8A 3SFMA 3V7RA 3N5BB 3CCLA 5J3BA 2EKOA 1SRLA 2NUPB 3OSSC 1B34B 4C5HA 2D0QB 3R6NA 1PCXA 3VYGA 2CP7A 4PJOE 4J8OA 4HCZA 5C0MA 4J5YA 4C92C 1UHCA 1D3BA 4FYVB 5FU6C 1AHJB 3OYBA 5EG2A 2OTJA 2RK1A 1YI2A 4VUBA 1KG1A 1K8AU 1K1ZA 5GMKh 4PJOG 2D8JA 5GANj 1B07A 2NLUA 4BY6B 2RK2A 5LJ3h 2KQWA 3QYHB 1QWFA 1YJNA 2DKGA 3CPWA 1B3QA 2K79A 3AT1B 2RO0A 2JS2A 3MEWA 5GMKl 3M4GA 1BKBA 4GBQA 4RCBA 1Q7YU 3R6OA 1RLQC 3E1SA 2BUDA 1I81A 4DQ2A 3CCVA 4BE2A 3KUFA 3EGDA 4FL6A 1AEYA 2QDYB 2AZVA 4RCCA 2LQ8A 3IQLA 4FW1A 3U23A 3EH1A 3RIRA 2COZA 2K2VA 5LJ5f 3JRZA 2L3SA 3EG9B 4RTWA 1RACB 1OU8A 3G6ET 4PJJA 2LX9A 2X9HA 4E7KA 1S72Q 2DL5A 3EHRA 3HFNA 5DLOA 1EX4A 1ZHIA 2CREA 4A54A 4UC4A 5GJVB 1G5VA 4M75C 2L3PA 5AT1B 3LGFA 4HT8A 1PD0A 4XTWA 4OB1B 1K73R 8ATCB 4HVWA 1M3BA 4WCIA 3JCMJ 1PSEA 2EYWA 5IAYA 4OMPA 1U06A 1B34A 2HQHA 3EG1A 1M5Q1 1RAAB 3M56A 5GJWB 1VQPA 2MIOA 4RMOA 2ZPBB 2ZPIB 3JCMh 3JCMb 3UT1A 4M7AB 4L6V5 5L23A 2A08A 1TUDA 1KQSP 2RA2A 1X27A 3JCMg 2EIFA 2EGEA 1AD5A 3GBQA 1OI1A 1JO8A 2ROLA 2RJDA 1Q82C 3GIBA 4PFZA 3X26B 3JB9G 1JBMA 1UGSB 1XNIA 4M75B 5CR2A 4OGCA 3CBOA 4DBQA 1M2VA 2KE9A 1R77A 2J6OA 3LWIA 4C92E 3QUIA 2M0YA 1UGVA 3CCLQ 2DJQA 3EG9A 2MK5A 5C6SA 2VGNA 2LCCA 1UHFA 3I35A 3A5ZB 3MPUB 1AWJA 3L1AA 1Q7YR 3UPUA 5LJ5d 3MHXA 4LD6A 4C92G 4M78C 1K9MC 4C92A 1G3YA 2OTJQ 2I0NA 1BI1A 2LVMA 3JB9J 1YI2Q 4DEYA 3EHQA 4C0ZA 2IPOB 5CK9A 4C8QE 2JN0A 4E7IA 4KULA 2OAWA 1PKTA 2HDAA 1YJNQ 4DEXA 2ED0A 2DIQA 4J9DA 2RI5A 2E3HA 4OP0A 1U1TA 2MAMA 3HRSA 2DZ9A 1I07A 1S72T 1D09B 4C8QG 3X24B 4EIKA 3DB4A 4BI3A 2CGHA 2QYZA 2CSQA 4MZMA 1VQNT 3ZL7C 1X6OA 2GFUA 1QVPA 2L0AA 3I55T 2HQEA 1VA7A 1KD1U 1M1KC 4QQGA 4KGXB 3TSZA 2C0TA 1OX9A 1MGQA 5CO7A 3HTRA 1EFNA 3OS0A 4M7DC 1JJ2A 2JW4A 3CCRT 2XDPA 3CCUA 1VQMA 2HBPA 4HKEA 2EQJA 4M78B 5CKHA 3V7SA 4PLLA 1FX7A 2FZKB 2E5KA 2V8IA 2LX7A 4M75A 1QLYA 1V29B 1WX6A 2QAZA 3RMQA 1YJWA 1K4US 2RQVA 4KGVB 2OX7A 4F7UB 4N0AC 2YRVA 5IH2A 3M55A 4KT0E 4IUQA 2DL7A 2J05A 2LMJA 2DL8A 3RESA 2R58A 4M77E 2DNUA 2I2LA 1VQPQ 1XTDA 2O31A 2DXUA 1WNLA 3CCQA 2MPXC 2YXYA 3CXCA 5GAOp 1F1BB 2YUOA 3QZ9B 1VQ9A 4QKUA 2RI2A 1N27A 1J3TA 1WJQA 3HRTA 4MZPA 3CCLT 1VQ7A 1JJ2S 2KRNA 4JLGA
chains in the Genus database with same CATH topology
3EG0A 1X43A 2LQWA 2BZXA 2DL3A 3M0SA 1PRMC 2A36A 4D8KA 1T0HA 2K6DA 2A28A 3REAB 1U5SA 3H0FA 2RNAA 2KT1A 2MOXA 2DM1A 2ED1A 1G83A 2G6FX 1T3SA 2GNCA 2RQTA 2RF0A 1NLOC 3NPFA 4OMLA 2L2PA 2DE0X 1OPKA 1E6GA 1WLPB 1Z9ZA 4JZ3A 3TSWA 3UATA 1GCQC 1WXTA 1NG2A 2ECZA 2FPEA 1ZUUA 1GBRA 2FPFA 2D1XA 2YUQA 2LZ6B 2J06A 2QDLA 2YT6A 3NGPA 1VYTA 5IXBA 3PE0A 4JPBW 2KBTA 1GRIA 2FG0A 2J6FA 4QT7A 1UJYA 1KFZA 1SHGA 2D0NA 2KXCA 1BU1A 1YWPA 1GL5A 2LCSA 3VS0A 2FRYA 1OV3A 1M3CA 1YP5A 2O9VA 3ULRB 1SHFA 1SPKA 2RN8A 4CC7A 2GTJA 1ABOA 1UDLA 1WXBA 2DYBA 2PNIA 1XOVA 4LUDA 2NUZA 1TG0A 1KSWA 1FYNA 2DILA 2OI3A 1YNZA 2HSPA 2JS0A 1CKAA 2M51A 1WI7A 4F16A 2AZSA 4Y92A 3VS3A 4RTXA 2NWMA 2BZYA 4LN2A 3VS6A 4LE9A 3RNJA 2GTOA 1CSKA 1PKSA 3UA6A 2RPNA 3RBBB 3M0PA 3VS4A 4RTTA 4HCKA 1HJDA 1T3LA 1BBZA 1K76A 3CQTA 4J9EA 2MCNA 1PNJA 2K2MA 5ECAA 5HCKA 2YDLA 5I11A 2DVJA 1ABQA 3VS7A 2XMFA 1UE9A 1OOTA 2JT4A 2CUDA 1W6XA 2YUPA 1AZEA 2AKKA 2RQRA 4AFSC 2EW3A 3O5ZA 1CKBA 1Z9QA 4J9GA 1YN8A 3UA7A 1UJ0A 4JZ4A 1YWOA 1M3AA 2F2XA 1FMKA 4AFUC 4FSSA 1AOJA 2RMOA 1SRLA 1K0SA 4OMOA 2EVRA 3H41A 1NEGA 2B86A 1KIKA 3R6NA 2LJ0A 4Z8AA 2KYMA 4Z89A 1UHCA 4RTVA 1S1NA 1Y57A 3KFVA 1W70A 2KR3A 2LJ3A 1K1ZA 2KT8A 4ZNXA 5FWCA 2D8JA 1B07A 5EC7A 1X6BA 2ROTA 3VRYA 4M4ZA 1MUZA 1HD3A 2KRSA 2VVKA 4CC4B 1QWFA 1ZLMA 2JTEA 1AZGB 1B3QA 2K79A 1NYGA 1WDXA 2JS2A 3C0CA 2F2VA 2ABLA 2CSIA 4X1VA 1NYFA 4OMMA 2W0ZA 4GBQA 2KXDA 3UF4A 1RLQC 1TUCA 2HBWA 2KGTA 2A37A 2RQWA 2F2WA 2H8HA 1AEYA 2AZVA 2HEQA 1X2KA 2LNHB 4AG2C 3IQLA 3U23A 4AG1C 4J9CA 5IHNA 1ZUKA 2DBMA 2L3SA 4RTWA 1OEBA 4RUGA 1JU5C 4LUEA 1GCQA 2CH4A 2KEAA 2CH4W 2V1RA 2HCKA 3M0UA 2DL5A 3EHRA 1VYVA 2CREA 1PRLC 1AWOA 2D8HA 4R0KA 5GJVB 3NHNA 2L3PA 5FW9A 1RUWA 2EGCA 2ESWA 2J7IA 2JM9A 2DRMA 4JJCA 4HVWA 3QWYA 1M3BA 4WCIA 2EYWA 1GBQA 3A98A 4OMPA 4CC3A 3PVLA 3VS5A 1U06A 2FEIA 1OPLA 4J9IA 3EG1A 3LH5A 1JQQA 1SSHA 2CDTA 1SRMA 2X3XD 2YSQA 5GJWB 4OMNA 1WXUA 2MIOA 4A63B 3VRZA 3I5RA 4AFZC 1AWXA 4JJDA 1I1JA 1ZBJA 2CUBA 5L23A 2A08A 1QCFA 1TUDA 3QWXX 2JM8A 2SEMA 2DA9A 1JXOA 1X27A 2LP5A 1GFDA 4J9BA 1ZX6A 1W1FA 2JXBA 1E7OA 2EGEA 3M0RA 3M0QA 1BB9A 1AD5A 1UTIA 2KROA 2RQUA 3GBQA 1JO8A 2EBPA 2K3BA 2ROLA 2AK5A 2EQIA 2YUNA 4D8DA 2LQNA 1UG1A 1QKXA 1UECA 2EKHA 3H0HA 1WIEA 2SRCA 2DX1A 2IIMA 1A0NB 2KE9A 4IIOA 2O9SA 5IHKA 1Y0MA 2J6OA 3PVQA 4RTZA 3TVTA 4GLMA 1ARKA 1M8MA 1V1CA 2M0YA 3EG2A 1UGVA 3NMZC 2DJQA 1WA7A 2KRMA 4E6RA 1U3OA 1UFFA 3EGUA 1UHFA 1M30A 3I35A 1AWJA 1JXMA 1X2QA 2GBQA 4AFQC 4OMQA 1I0CA 2VKNA 2I0NA 1WYXA 4J9HA 4DEYA 3EHQA 2OJ2A 2DRKA 3M0TA 1T0JA 2DF6A 2V1QA 1IO6A 1G2BA 1PHTA 2OAWA 3SHWA 1PKTA 2HDAA 2EYZA 1NLPC 4DEXA 2ED0A 4F14A 2VWFA 2DBKA 4J9DA 2DMOA 1UUEA 1KJWA 1LCKA 2FO0A 4IIMA 1PWTA 1I07A 2BTTA 2JMCA 1QWEA 2ENMA 3H0IA 3THKA 4EIKA 2LJ1A 2DLPA 2P4RA 2CSQA 3ZL7C 2L0AA 3FJ5A 4ESRA 2AKLA 2C0IA 1VA7A 2K7AA 2FRWA 1AVZC 2L3QA 1X6GA 2EYXA 4LNPA 1WFWA 1GCPA 3TSZA 3I5SA 2C0TA 1X69A 1ZSGA 4K11A 1H8KA 3VS1A 2GQIA 2EPDA 5IHIA 1HSQA 1EFNA 2O2OA 2J6KA 5IXFA 2JW4A 1QKWA 4F17A 2KNBB 3REBB 1GFCA 5I22A 2DL4A 2E5KA 1SEMA 2LX7A 4HXJA 1QLYA 2EYYA 4KRTA 1WX6A 1K4US 2RQVA 4RTUA 1NM7A 2X3WD 1H3HA 2PTKA 1M27C 5IH2A 1VYUA 2C0OA 4ORZA 3JV3A 1RI9A 2DL7A 2J05A 2LMJA 2DL8A 3VS2A 1YCSB 4HVVA 3SEMA 1NEBA 2CT4A 1MV0B 2KYBA 4Z88A 5FWBA 2DNUA 1H92A 3I9QA 2JMAA 2PZ1A 4RTYA 2O31A 1BK2A 2GGRA 1K0XA 2FPDA 1N5ZA 4CC2A 1AWWA 4JJBA 1E6HA 2YUOA 1RLPC 4HVUA 2BZ8A 1K9AA 4J9FA 2W10A 2CT3A 2EGAA 1J3TA 2K9GA 2O88A 1ZUYA 2KRNA 1JEGA 1MV3A 3EG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG0 A;  1X43 A;  2LQW A;  2BZX A;  2DL3 A;  3M0S A;  1PRM C;  2A36 A;  4D8K A;  1T0H A;  2K6D A;  2A28 A;  3REA B;  1U5S A;  3H0F A;  2RNA A;  2KT1 A;  2MOX A;  2DM1 A;  2ED1 A;  1G83 A;  2G6F X;  1T3S A;  2GNC A;  2RQT A;  2RF0 A;  1NLO C;  3NPF A;  4OML A;  2L2P A;  2DE0 X;  1OPK A;  1E6G A;  1WLP B;  1Z9Z A;  4JZ3 A;  3TSW A;  3UAT A;  1GCQ C;  1WXT A;  1NG2 A;  2ECZ A;  2FPE A;  1ZUU A;  1GBR A;  2FPF A;  2D1X A;  2YUQ A;  2LZ6 B;  2J06 A;  2QDL A;  2YT6 A;  3NGP A;  1VYT A;  5IXB A;  3PE0 A;  4JPB W;  2KBT A;  1GRI A;  2FG0 A;  2J6F A;  4QT7 A;  1UJY A;  1KFZ A;  1SHG A;  2D0N A;  2KXC A;  1BU1 A;  1YWP A;  1GL5 A;  2LCS A;  3VS0 A;  2FRY A;  1OV3 A;  1M3C A;  1YP5 A;  2O9V A;  3ULR B;  1SHF A;  1SPK A;  2RN8 A;  4CC7 A;  2GTJ A;  1ABO A;  1UDL A;  1WXB A;  2DYB A;  2PNI A;  1XOV A;  4LUD A;  2NUZ A;  1TG0 A;  1KSW A;  1FYN A;  2DIL A;  2OI3 A;  1YNZ A;  2HSP A;  2JS0 A;  1CKA A;  2M51 A;  1WI7 A;  4F16 A;  2AZS A;  4Y92 A;  3VS3 A;  4RTX A;  2NWM A;  2BZY A;  4LN2 A;  3VS6 A;  4LE9 A;  3RNJ A;  2GTO A;  1CSK A;  1PKS A;  3UA6 A;  2RPN A;  3RBB B;  3M0P A;  3VS4 A;  4RTT A;  4HCK A;  1HJD A;  1T3L A;  1BBZ A;  1K76 A;  3CQT A;  4J9E A;  2MCN A;  1PNJ A;  2K2M A;  5ECA A;  5HCK A;  2YDL A;  5I11 A;  2DVJ A;  1ABQ A;  3VS7 A;  2XMF A;  1UE9 A;  1OOT A;  2JT4 A;  2CUD A;  1W6X A;  2YUP A;  1AZE A;  2AKK A;  2RQR A;  4AFS C;  2EW3 A;  3O5Z A;  1CKB A;  1Z9Q A;  4J9G A;  1YN8 A;  3UA7 A;  1UJ0 A;  4JZ4 A;  1YWO A;  1M3A A;  2F2X A;  1FMK A;  4AFU C;  4FSS A;  1AOJ A;  2RMO A;  1SRL A;  1K0S A;  4OMO A;  2EVR A;  3H41 A;  1NEG A;  2B86 A;  1KIK A;  3R6N A;  2LJ0 A;  4Z8A A;  2KYM A;  4Z89 A;  1UHC A;  4RTV A;  1S1N A;  1Y57 A;  3KFV A;  1W70 A;  2KR3 A;  2LJ3 A;  1K1Z A;  2KT8 A;  4ZNX A;  5FWC A;  2D8J A;  1B07 A;  5EC7 A;  1X6B A;  2ROT A;  3VRY A;  4M4Z A;  1MUZ A;  1HD3 A;  2KRS A;  2VVK A;  4CC4 B;  1QWF A;  1ZLM A;  2JTE A;  1AZG B;  1B3Q A;  2K79 A;  1NYG A;  1WDX A;  2JS2 A;  3C0C A;  2F2V A;  2ABL A;  2CSI A;  4X1V A;  1NYF A;  4OMM A;  2W0Z A;  4GBQ A;  2KXD A;  3UF4 A;  1RLQ C;  1TUC A;  2HBW A;  2KGT A;  2A37 A;  2RQW A;  2F2W A;  2H8H A;  1AEY A;  2AZV A;  2HEQ A;  1X2K A;  2LNH B;  4AG2 C;  3IQL A;  3U23 A;  4AG1 C;  4J9C A;  5IHN A;  1ZUK A;  2DBM A;  2L3S A;  4RTW A;  1OEB A;  4RUG A;  1JU5 C;  4LUE A;  1GCQ A;  2CH4 A;  2KEA A;  2CH4 W;  2V1R A;  2HCK A;  3M0U A;  2DL5 A;  3EHR A;  1VYV A;  2CRE A;  1PRL C;  1AWO A;  2D8H A;  4R0K A;  5GJV B;  3NHN A;  2L3P A;  5FW9 A;  1RUW A;  2EGC A;  2ESW A;  2J7I A;  2JM9 A;  2DRM A;  4JJC A;  4HVW A;  3QWY A;  1M3B A;  4WCI A;  2EYW A;  1GBQ A;  3A98 A;  4OMP A;  4CC3 A;  3PVL A;  3VS5 A;  1U06 A;  2FEI A;  1OPL A;  4J9I A;  3EG1 A;  3LH5 A;  1JQQ A;  1SSH A;  2CDT A;  1SRM A;  2X3X D;  2YSQ A;  5GJW B;  4OMN A;  1WXU A;  2MIO A;  4A63 B;  3VRZ A;  3I5R A;  4AFZ C;  1AWX A;  4JJD A;  1I1J A;  1ZBJ A;  2CUB A;  5L23 A;  2A08 A;  1QCF A;  1TUD A;  3QWX X;  2JM8 A;  2SEM A;  2DA9 A;  1JXO A;  1X27 A;  2LP5 A;  1GFD A;  4J9B A;  1ZX6 A;  1W1F A;  2JXB A;  1E7O A;  2EGE A;  3M0R A;  3M0Q A;  1BB9 A;  1AD5 A;  1UTI A;  2KRO A;  2RQU A;  3GBQ A;  1JO8 A;  2EBP A;  2K3B A;  2ROL A;  2AK5 A;  2EQI A;  2YUN A;  4D8D A;  2LQN A;  1UG1 A;  1QKX A;  1UEC A;  2EKH A;  3H0H A;  1WIE A;  2SRC A;  2DX1 A;  2IIM A;  1A0N B;  2KE9 A;  4IIO A;  2O9S A;  5IHK A;  1Y0M A;  2J6O A;  3PVQ A;  4RTZ A;  3TVT A;  4GLM A;  1ARK A;  1M8M A;  1V1C A;  2M0Y A;  3EG2 A;  1UGV A;  3NMZ C;  2DJQ A;  1WA7 A;  2KRM A;  4E6R A;  1U3O A;  1UFF A;  3EGU A;  1UHF A;  1M30 A;  3I35 A;  1AWJ A;  1JXM A;  1X2Q A;  2GBQ A;  4AFQ C;  4OMQ A;  1I0C A;  2VKN A;  2I0N A;  1WYX A;  4J9H A;  4DEY A;  3EHQ A;  2OJ2 A;  2DRK A;  3M0T A;  1T0J A;  2DF6 A;  2V1Q A;  1IO6 A;  1G2B A;  1PHT A;  2OAW A;  3SHW A;  1PKT A;  2HDA A;  2EYZ A;  1NLP C;  4DEX A;  2ED0 A;  4F14 A;  2VWF A;  2DBK A;  4J9D A;  2DMO A;  1UUE A;  1KJW A;  1LCK A;  2FO0 A;  4IIM A;  1PWT A;  1I07 A;  2BTT A;  2JMC A;  1QWE A;  2ENM A;  3H0I A;  3THK A;  4EIK A;  2LJ1 A;  2DLP A;  2P4R A;  2CSQ A;  3ZL7 C;  2L0A A;  3FJ5 A;  4ESR A;  2AKL A;  2C0I A;  1VA7 A;  2K7A A;  2FRW A;  1AVZ C;  2L3Q A;  1X6G A;  2EYX A;  4LNP A;  1WFW A;  1GCP A;  3TSZ A;  3I5S A;  2C0T A;  1X69 A;  1ZSG A;  4K11 A;  1H8K A;  3VS1 A;  2GQI A;  2EPD A;  5IHI A;  1HSQ A;  1EFN A;  2O2O A;  2J6K A;  5IXF A;  2JW4 A;  1QKW A;  4F17 A;  2KNB B;  3REB B;  1GFC A;  5I22 A;  2DL4 A;  2E5K A;  1SEM A;  2LX7 A;  4HXJ A;  1QLY A;  2EYY A;  4KRT A;  1WX6 A;  1K4U S;  2RQV A;  4RTU A;  1NM7 A;  2X3W D;  1H3H A;  2PTK A;  1M27 C;  5IH2 A;  1VYU A;  2C0O A;  4ORZ A;  3JV3 A;  1RI9 A;  2DL7 A;  2J05 A;  2LMJ A;  2DL8 A;  3VS2 A;  1YCS B;  4HVV A;  3SEM A;  1NEB A;  2CT4 A;  1MV0 B;  2KYB A;  4Z88 A;  5FWB A;  2DNU A;  1H92 A;  3I9Q A;  2JMA A;  2PZ1 A;  4RTY A;  2O31 A;  1BK2 A;  2GGR A;  1K0X A;  2FPD A;  1N5Z A;  4CC2 A;  1AWW A;  4JJB A;  1E6H A;  2YUO A;  1RLP C;  4HVU A;  2BZ8 A;  1K9A A;  4J9F A;  2W10 A;  2CT3 A;  2EGA A;  1J3T A;  2K9G A;  2O88 A;  1ZUY A;  2KRN A;  1JEG A;  1MV3 A;  3EG3 A; 
#chains in the Genus database with same CATH topology
 1IRE B;  4FT2 A;  1VQO A;  3DLL A;  2ZGW A;  5GAO q;  2KMT A;  1NBE B;  4ZGE B;  1WHM A;  4D8K A;  2DET A;  1GXI E;  3CC2 A;  2X4J A;  1YFN A;  1YJ9 A;  2OTJ T;  1YI2 T;  5DM7 R;  2RF0 A;  3PFS A;  1O9S A;  1XJW B;  3FLG A;  3H9N A;  2DE0 X;  4JRQ A;  3OW2 S;  1M2O A;  9ATC B;  1GBR A;  3CPW P;  2CP2 A;  2FPF A;  4OF1 A;  2ATC B;  4MMK A;  2YUQ A;  1YJN T;  3JCM d;  2LZ6 B;  1IB8 A;  3A8H B;  1ACM B;  1HK9 A;  2DFU A;  3OYK A;  1QVF S;  3LLR A;  4M78 A;  2KXC A;  4FSX A;  1G3S A;  1GL5 A;  5LL6 S;  1KD1 R;  2MF2 A;  2LCS A;  3VS0 A;  2FRY A;  1OV3 A;  2DTI A;  2H3J A;  2FHD A;  2O9V A;  5DLQ E;  3CCV T;  1SHF A;  3CEY A;  1N8R C;  1NPP A;  4F7U A;  1ABO A;  2DYB A;  1XOV A;  2WAC A;  3QHS A;  4FIB A;  4M7A D;  1YNZ A;  4LXC A;  4C5I A;  1Q82 U;  2HSE B;  3QKJ A;  1WI7 A;  4E7J A;  3CC4 A;  3NTK A;  4RTX A;  2VUB A;  1MMG A;  2QTX A;  3UA6 A;  1PKS A;  3RBB B;  3LX7 A;  4RTT A;  3SDZ A;  1T3L A;  1BBZ A;  4J9E A;  4M7D E;  4IUR A;  4FYW B;  1PNJ A;  2K2M A;  5I11 A;  5GAN h;  2DVJ A;  3VS7 A;  4JS4 A;  2Y4Y A;  5GAN g;  2QQS A;  4M7D G;  2AKK A;  4M7D A;  1BIB A;  4AFS C;  4C0D C;  1B7T A;  1M90 R;  2KAF A;  3O5Z A;  3CCU Q;  3E9F A;  1VQM Q;  1VQP T;  1Z9Q A;  4J9G A;  2QG9 B;  1I5O B;  5LJ5 e;  1K9M U;  1H3Z A;  3MET A;  5GAN 8;  4J83 A;  4YTL A;  4E7Z A;  1M3A A;  2EYQ A;  4QQD A;  2F2X A;  2L8D A;  4TVR A;  4AFU C;  2RMO A;  2DEU A;  1UB4 A;  5DY9 A;  3TU4 K;  4OMO A;  2EVR A;  3H41 A;  1NEG A;  4N4G A;  2X4W A;  2LJ0 A;  3H8Z A;  4R55 A;  1NJI C;  4C5G A;  3NFC A;  4N0A A;  4Z89 A;  2E6Z A;  3V8J A;  1Y57 A;  2FYK A;  3KFV A;  4WF2 A;  1W70 A;  5FU7 B;  2DAQ A;  1ZQ1 A;  2LJ3 A;  1BI3 A;  4ZNX A;  1EZZ B;  2CKK A;  3L42 A;  2ROT A;  4M7A F;  2M16 A;  1MUZ A;  2KRS A;  2VVK A;  3SWN B;  4CC4 B;  1NYG A;  3KBG A;  1M1K U;  3C0C A;  2F2V A;  2CSI A;  1NYF A;  1LJO A;  4OB0 B;  4OMM A;  3SB2 A;  1VQ7 Q;  2W0Z A;  3JB9 I;  3HL8 A;  4MDW A;  2KSS A;  4JRP A;  1MMD A;  3UF4 A;  2DXB A;  2HBW A;  4LDY A;  3I55 A;  1G3T A;  3VUB A;  3CC2 Q;  3J80 E;  3URG A;  2HEQ A;  2EWN A;  2LNH B;  3RUX A;  1MMN A;  4PJO B;  3CCS A;  3RDV A;  4J9C A;  4EPC A;  4FYY B;  1X75 C;  2RD1 A;  4KBM B;  3G6E Q;  1JU5 C;  4B6M A;  3GLX A;  3VU3 C;  1OU9 A;  5CQX A;  2CH4 W;  2V1R A;  3PIP A;  3M0U A;  2JZ2 A;  3OY9 A;  2X4Y A;  1PRL C;  2WSC E;  2D8H A;  3V8K A;  1Q82 R;  3NHN A;  2QI2 A;  2D9T A;  4FT4 A;  4ZN1 A;  2DEQ A;  4HT9 A;  4ELZ C;  1LPL A;  1DJ7 B;  2JM9 A;  2VAS A;  2EQK A;  2EJF A;  1K73 U;  1GBQ A;  3A98 A;  3VS5 A;  5KYX A;  1OPL A;  5IT9 E;  3EH2 A;  3LH5 A;  3WVE B;  1VQL A;  1SSH A;  2CDT A;  1SRM A;  3LWH A;  4OMN A;  1FWZ A;  1WXU A;  4A63 B;  1JJ2 P;  1UGR B;  1VQ6 A;  3I5R A;  2QQB A;  4JJD A;  1I1J A;  4P5N A;  3UWN A;  3ER0 A;  3CCU T;  1VQM T;  2YLC A;  2JM8 A;  3FIF A;  4A4K A;  4KH0 B;  1KQ1 A;  1MND A;  3VV0 A;  4EMK C;  1ZX6 A;  2JXB A;  2WSE E;  3OYI A;  1TOV A;  3M0R A;  2F5T X;  3SWN A;  1OZ3 A;  2P0P A;  3QPH A;  1RAG B;  1ZSZ C;  1YJW T;  1UTI A;  2GF7 A;  2RQU A;  2EBP A;  2O4X B;  4DBR A;  2PU9 B;  3ME9 A;  3FB9 A;  2EQI A;  3PNW C;  1BI0 A;  1UG1 A;  1VQ4 A;  4KH1 B;  1QKX A;  3JCM e;  4MZT A;  2DIG A;  3H0H A;  4Q5W A;  1WQW A;  4M78 F;  4RKU E;  2DD5 A;  2IIM A;  2O9S A;  3CXC P;  4XTU A;  5IHK A;  1Y0M A;  3TVT A;  4RTZ A;  4PJO A;  3CCQ T;  3RMS A;  1M1K R;  1VQ9 T;  4XTZ A;  5FRO A;  1VUB A;  5LJ3 g;  3JAM E;  4E6R A;  4F7U F;  2E12 A;  2QA4 A;  3EGU A;  2QXF A;  1M30 A;  1N8R U;  2GBQ A;  2A7Y A;  4C8Q C;  4AFQ C;  1M90 C;  1VQ7 T;  1BIA A;  2HQX A;  2VKN A;  4QQ6 A;  3C12 A;  2XID A;  1WYX A;  1VQO T;  5GAN d;  1QVG S;  4XU1 A;  4KUD K;  4BDY A;  3CC2 T;  1M2V B;  5CKF A;  3QXE B;  2DF6 A;  1YJ9 T;  1G2B A;  3OYH A;  3QII A;  3I56 A;  2EYZ A;  3CBP A;  3DB3 A;  1Y96 B;  2VWF A;  2DBK A;  2XKO C;  1ZSZ B;  3QJ6 A;  5GAM j;  2WSF E;  1KJW A;  2FO0 A;  3JCM c;  1QWE A;  2P84 A;  1WHL A;  1FMW A;  2X4X A;  4C92 B;  2DLP A;  5FU6 B;  1VQN Q;  3I55 Q;  1RAI B;  2AKL A;  4PK4 A;  5D6X A;  2L3Q A;  1AVZ C;  2ZAE A;  3E19 A;  3HFO A;  1GCP A;  3HRU A;  2RHX A;  1X69 A;  3CCS Q;  2QGG A;  1ZSG A;  3VS1 A;  1YHQ A;  2EPD A;  5IHI A;  1HSQ A;  2E65 A;  2XHC A;  2J6K A;  2O4X A;  3CCR Q;  2HD0 A;  2XDD A;  1QKW A;  4BI4 A;  1WJS A;  1NJI U;  3EGX B;  4C8Q B;  4BI8 B;  1M1F A;  1OQK A;  5KE3 A;  2CP3 A;  4CI0 C;  5HK3 A;  4J7I A;  1BCO A;  4M77 C;  3CC4 T;  2EJG A;  2QEX A;  4BE0 A;  2LRQ A;  2X3W D;  1H3H A;  2PTK A;  2NUT A;  2Y4X A;  4QW2 A;  2MI6 A;  4BD3 A;  2CT4 A;  1MV0 B;  4Z88 A;  1H92 A;  3GNG A;  1BI2 A;  2M1H A;  2F5K A;  2FPD A;  1I5L A;  1TUG B;  1HYO A;  4HA8 A;  3ZBD A;  2M0O A;  4HVU A;  2W10 A;  3CMA A;  3L2W A;  4EMK A;  4XTV A;  1VQ8 A;  1ZUY A;  3LH0 A;  1Y96 A;  1N8R R;  1ZSZ A;  1MV3 A;  5LJ5 j;  4Z02 A;  2LQW A;  1Q81 C;  1T0H A;  1U5S A;  1VQ4 Q;  2O01 E;  2HL3 A;  4HCB A;  1FMV A;  3L2U A;  4A4H A;  2QK0 A;  3GP8 A;  4JRK A;  4OML A;  2P0Q A;  1RAB B;  1WLP B;  1Z9Z A;  4JZ3 A;  4OB3 B;  3CME A;  5D6W A;  1UGQ B;  2BIV A;  2ECZ A;  1ZUU A;  1R8O B;  1V76 A;  2J06 A;  2QDL A;  2QA4 Q;  2CZ7 B;  5GAN 5;  4JPB W;  3EGX A;  2J6F A;  1UJY A;  4BB7 A;  3E9G A;  4Y91 A;  4C8Q A;  3HP9 A;  2D0N A;  4E7H A;  3OYA A;  3CC7 A;  3OA6 A;  2E1H A;  2KVQ G;  2RH2 A;  3CCV Q;  1M3C A;  1YP5 A;  3JCM f;  3S3N A;  1SPK A;  2DK3 A;  4M7A E;  4CC7 A;  2KY9 A;  2DTO A;  2L5Q A;  3CCS T;  5CAI A;  3M54 A;  1M1G A;  1R0C B;  1TG0 A;  2D6F A;  1NJI R;  2HKQ B;  4E7S A;  2OI3 A;  4ELY C;  1VQ5 A;  5FLX E;  2HSP A;  2JS0 A;  5LJ3 d;  2E3I A;  4E7L A;  2AZS A;  1D1C A;  4II1 A;  4PNO A;  2BZY A;  5A0L A;  1VIE A;  4IKF A;  2XD0 A;  2PVG B;  2RPN A;  3VS4 A;  3M5A A;  4XAX B;  1K76 A;  4PJO F;  5D6Y A;  4FU6 A;  3J81 E;  5ECA A;  1RL2 A;  1TS9 A;  2IG0 A;  2XIC A;  1ABQ A;  3OW2 A;  3INZ A;  4FYX B;  1M8V A;  3L2Z A;  1W6X A;  4ATO A;  3VJP A;  1AZE A;  1VQL T;  3P8B B;  2EW3 A;  4XTX A;  4CRI A;  3X28 B;  1TU0 B;  4XU2 A;  1VQ6 T;  1M90 U;  3UA7 A;  5GAO m;  3C4S A;  1UJ0 A;  4DBH A;  1N6A A;  1QVF A;  1YWO A;  2K4Y A;  2BE9 B;  1FMK A;  4M77 G;  2LT1 A;  5GAN e;  3OYY A;  4M77 A;  1KIK A;  1ZA1 B;  4Z8A A;  2KYM A;  3PMT A;  1WHJ A;  4RTV A;  3CCE A;  5GMK i;  2X51 A;  3JCM V;  1WPY A;  4M7D B;  1NZ9 A;  4XQ3 A;  3TCJ A;  3RKW A;  2KR3 A;  3M58 A;  2KT8 A;  5FWC A;  5J26 A;  1VQ4 T;  3MEA A;  3M9Q A;  5EC7 A;  3VRY A;  2CZ6 B;  3MEV A;  4QVC A;  4M4Z A;  2OTL A;  4LDX A;  1WDX A;  2VB6 A;  2ABL A;  2E70 A;  3MP8 A;  5KYN A;  2HAX A;  4C92 D;  1VQ8 Q;  2XI9 A;  4LDV A;  1RAH B;  2RJF A;  2KXD A;  2QA4 T;  2CP5 A;  4PFO A;  2A37 A;  3S3M A;  1C0M A;  4XU3 A;  3LYI A;  3G1J A;  2A0F B;  3PIO A;  3OYN A;  1XQH A;  1VQK A;  3JCM P;  1ZUK A;  2DBM A;  4C0G A;  1YIT A;  3OYJ A;  5GAN 6;  4RUG A;  3FDR A;  3HHT B;  2KEA A;  2PVD B;  3MKD A;  3LGL A;  1K8A C;  5KYU B;  1UGP B;  1MNE A;  1VYV A;  3RKY A;  1AWO A;  3I56 T;  3OS1 A;  4R0K A;  3GF5 A;  3G71 A;  2E10 A;  5FW9 A;  4JJN K;  3JB9 F;  2ESW A;  4JUV A;  2J7I A;  4DA4 A;  3PT9 A;  2PQW A;  3X25 B;  1C1A A;  4CC3 A;  3PVL A;  5I21 A;  2FEI A;  1WQ7 A;  8AT1 B;  1JQQ A;  4JS5 A;  2HL5 C;  1PC0 A;  2K5L A;  3VRZ A;  1YHQ T;  2LDM A;  4M75 D;  1TTH B;  3V8L A;  2CYZ B;  5GAN 2;  1ZBJ A;  4X9C A;  4C92 F;  3FEO A;  4AMC A;  3QWX X;  2RHU A;  2SEM A;  1JXO A;  5FRN A;  3OYF A;  2LP5 A;  1GFD A;  4J9B A;  7AT1 B;  1ZA2 B;  1E7O A;  2VXE A;  2FZG B;  4KUI A;  1BB9 A;  1YJW Q;  3OBY A;  5KYX B;  2AHJ B;  2QEX T;  3OYD A;  2K5I A;  3V7C A;  1PD1 A;  3OQ5 A;  5I2M A;  4A4F A;  2YUN A;  5GAN 7;  4PJM A;  2RHZ A;  4AT1 B;  2CZ0 B;  2MWO A;  2C06 A;  2KDS A;  5GAM h;  3RER A;  1PSF A;  3CCJ A;  1A0N B;  2JTF A;  3MP6 A;  4BE1 A;  4IIO A;  5GAM g;  1N9S A;  3CCQ Q;  1I4K 1;  2E64 A;  1ARK A;  2E5Q A;  1M8M A;  1OUL A;  2A3L A;  1V1C A;  3EG2 A;  3QG1 A;  1VQ9 Q;  2JVV A;  4IUV A;  1D1A A;  3OYE A;  3EAE A;  1UFF A;  3AHU A;  4BDZ A;  3CMA T;  5AYF A;  3LW5 E;  5KYU A;  1JXM A;  2K57 A;  1X2Q A;  2DJZ A;  1PG5 B;  2FZC B;  2MWP A;  5KE2 A;  1VQ8 T;  2NYS A;  1I0C A;  1KQS S;  3VYH B;  1VQO Q;  5GMK e;  2YRD A;  4C0D B;  3KXT A;  2OJ2 A;  5LJ3 e;  4M75 F;  3QSU A;  1YJ9 Q;  1N9R A;  1M4Z A;  1IO6 A;  1PHT A;  3OYL A;  3G4S A;  2OTL Q;  3SHW A;  4Y28 E;  3HSB A;  3CME T;  2DMO A;  1UUE A;  2BE7 D;  5GAN f;  4M78 D;  2COY A;  2EAY A;  4R56 A;  3J7A F;  3H0I A;  4J6W A;  1U8R A;  3SD4 A;  1D0Z A;  3L2V A;  2E41 A;  4ESR A;  3FC3 A;  1SSF A;  3QDR B;  1X6G A;  2EYX A;  4LNP A;  1WFW A;  3C94 A;  5GAN 3;  2RM4 A;  3I5S A;  3CC7 T;  1LNX A;  4IUT A;  3PGG A;  1VQK Q;  1FXX A;  4K11 A;  1RAD B;  2G3R A;  3O8V A;  1YIT Q;  1O75 A;  2O2O A;  5IXF A;  1W2B A;  2KNB B;  1YCY A;  3REB B;  3A8G B;  1GFC A;  5HKC A;  1Q81 R;  2DL4 A;  2K3X A;  1EIF A;  1SEM A;  4HXJ A;  5LJ5 h;  1VQ5 T;  2M9U A;  4GY5 A;  3CC4 Q;  5LJ5 g;  4RTU A;  1QVG A;  4D6W A;  3MCA B;  2COW A;  3BY7 A;  1NM7 A;  2XK0 A;  2C0O A;  3EFO B;  2DXC A;  4ORZ A;  4M7D D;  3PTA A;  3OW2 P;  2EQU A;  1YIJ A;  3VS2 A;  1YCS B;  4HVV A;  3A8M B;  2QQA A;  5FWB A;  4PLI A;  3I9Q A;  3GNF B;  2HNI A;  2PUK B;  4RTY A;  1BK2 A;  3JSC A;  2GGR A;  2YRC A;  4CC2 A;  4OGE A;  1UEB A;  1QVF P;  1G3W A;  4ZTF A;  1K9A A;  5CIU A;  2CT3 A;  2PVO B;  3ZFJ A;  3GOX A;  5GAO n;  2PUO B;  2K9G A;  2O88 A;  1W2B S;  1IRX A;  4A4E A;  2NUT B;  2DPP B;  4XK8 E;  1VOM A;  1JEG A;  1TH7 A;  3EG3 A;  3BDU A;  4IUP A;  2BZX A;  2F69 A;  2DL3 A;  2B8A A;  3M0S A;  2A36 A;  2BKD N;  2FL7 A;  1X01 A;  2DZC A;  2K6D A;  4ZTJ A;  1BYM A;  3H0F A;  2MOX A;  2ED1 A;  3CCE T;  1G83 A;  1T3S A;  1AT1 B;  3H6Z A;  5HK0 A;  2CS7 A;  3ZEH A;  2GNC A;  2RQT A;  1NLO C;  1QP3 A;  3NPF A;  3CCJ Q;  2L2P A;  2XU8 A;  1P92 A;  1E6G A;  1TWB A;  4ME7 A;  4PKC C;  3S3O A;  3UAT A;  1GCQ C;  1WXT A;  5CCA A;  1QQJ A;  4DOW A;  5A0G A;  2KK4 A;  1VIF A;  4EMK B;  2LCL A;  2OTL T;  2D1X A;  1Q86 C;  3NGP A;  2DD4 A;  5KYY A;  1VYT A;  5CKE A;  1R0B G;  4BUG A;  2KBT A;  4M7A C;  1D1B A;  4QT7 A;  2P4T A;  1KFZ A;  4M7D F;  3A1P A;  1BU1 A;  5L8R E;  3S6W A;  3JCM X;  2RJE A;  3ULR B;  2JNG A;  3HPW A;  1SKU B;  2HMA A;  2RN8 A;  2F1L A;  1KC8 C;  2ZPF B;  2GTJ A;  2DVE A;  1UDL A;  2ZPH B;  1WXB A;  2L3R A;  3G4S Q;  2PNI A;  5GAM d;  1VQK T;  4LUD A;  3MP1 A;  3EFO A;  1RI0 A;  5KCH A;  1YIT T;  4OVA A;  1FYN A;  1OZ2 A;  1KQ2 A;  1Q95 G;  2JJ9 A;  2M51 A;  4Y92 A;  3VS3 A;  4LN2 A;  1WJR A;  2AT1 B;  1CSK A;  3CPW S;  1WGS A;  3G71 T;  3M0P A;  4N4I A;  3CQT A;  2NUP A;  2CP6 A;  5A2Q E;  2ZPE B;  3VKI A;  2YDL A;  2IVW A;  5LJ3 f;  2R5A A;  1OOT A;  2QGF B;  2YUP A;  1KHI A;  1VQL Q;  3CD6 A;  4EDU A;  4KGZ B;  1VQ6 Q;  3P8D A;  1YN8 A;  3F70 A;  5GAO l;  1M9S A;  2QAS A;  2H3E B;  2DXT A;  3CBM A;  4XU0 A;  3DKM A;  4FSS A;  1AOJ A;  2VV5 A;  3QO3 A;  3QZ5 B;  1K0S A;  3GPL A;  2B86 A;  2X35 A;  5M9O A;  3OYG A;  3PMI A;  3BE3 A;  4L59 A;  3FRN A;  1S1N A;  2LC4 A;  1YIJ Q;  4J7F A;  1K8A R;  2ZPG B;  1Y07 A;  4PJO D;  3A8L B;  2ZCF B;  4BAC A;  1X6B A;  2K3Y A;  1HD3 A;  1Y71 A;  1ZLM A;  3CCJ T;  2JTE A;  1AZG B;  4B9W A;  1NE8 A;  4M77 B;  3M59 A;  5GMK m;  2DTH A;  4C0F A;  4X1V A;  5I2S A;  1HXD A;  1RAE B;  1TUC A;  2GFA A;  2KGT A;  5D7U A;  3P8H A;  2RQW A;  2YLB A;  2F2W A;  2H8H A;  3UDC A;  1MHN A;  1X2K A;  2P0K A;  5GAO r;  4AG2 C;  4AG1 C;  4A4G A;  2GQV A;  5IHN A;  2E6N A;  4NOY A;  4E2F B;  3EFS A;  1OEB A;  1MMA A;  3G7Z A;  4LUE A;  3JCM Q;  1GCQ A;  2CH4 A;  1LOJ A;  1QCN A;  2M02 A;  2MYS A;  2ZZD A;  2HCK A;  1SF9 A;  2QQ9 A;  5GMK j;  3G4S T;  3I56 Q;  1IGU A;  3M4Y A;  5LJ3 j;  1TXQ A;  1U1S A;  4M7A G;  5CVI A;  4M7A A;  1RUW A;  2EGC A;  2GCX A;  2HZY A;  2R5M A;  1IZ6 A;  2K5F A;  4QVD A;  2DRM A;  4JJC A;  3QWY A;  3WVD B;  3WXM B;  4M75 E;  3CCM A;  4J9I A;  2XG8 D;  2X3X D;  2YSQ A;  2RJC A;  4XTY A;  1W2B P;  1ZBX A;  3OMG A;  1YHQ Q;  3QBY A;  4AFZ C;  4M75 G;  1AWX A;  3E2U A;  2CUB A;  5IN1 A;  1QCO A;  1QCF A;  2DA9 A;  3OYM A;  1IXD A;  1PM3 A;  1OYX A;  1W1F A;  3TQ7 P;  5CKB A;  3M0Q A;  3QDF A;  1QVG P;  5GAN 4;  3NTH A;  3MO8 A;  2RHY A;  2V26 A;  3CPF A;  5FRM A;  2KRO A;  2QEX Q;  3TEE A;  3DLM A;  2K3B A;  5KH6 A;  4MDX A;  2AK5 A;  1SG5 A;  3JB9 D;  4D8D A;  2LQN A;  3RKX A;  1UEC A;  2EKH A;  1YIJ T;  1Q86 U;  3CD6 Q;  1K73 C;  2LT4 A;  1WIE A;  1LVK A;  2SRC A;  2DX1 A;  2KI7 A;  1IHW A;  3PVQ A;  4GLM A;  2V8K A;  3C95 A;  4LD9 K;  3OS5 A;  3NMZ C;  3MJX A;  1WA7 A;  2KRM A;  3OMC A;  1U3O A;  3CMA Q;  2HKN A;  2L89 A;  1KC8 U;  3NTI A;  5HY6 A;  2RB6 A;  3L2Q A;  1W4S A;  4OMQ A;  1IGQ A;  5GAM e;  4OMF B;  3L2R A;  1H64 1;  4J9H A;  4NL2 A;  4X34 A;  3BDL A;  4C5E A;  3EFR A;  3QYG B;  2DRK A;  3M0T A;  5J39 A;  3G6E A;  1T0J A;  2JUF A;  3JCM W;  2V1Q A;  2MMP A;  4M78 E;  5KCO A;  3ASK A;  1YBY A;  2V8J A;  1NLP C;  3CME Q;  4F14 A;  2VC8 A;  1LCK A;  4FM4 B;  4IIM A;  1PWT A;  2BTT A;  3T9N A;  2JMC A;  4C8Q D;  4M78 G;  2ENM A;  6AT1 B;  3THK A;  4EMG A;  4F7U E;  4LDW A;  2LJ1 A;  3CXC S;  2EQM A;  2JOY A;  2P4R A;  3Q1J A;  1Y7X A;  3FJ5 A;  2C0I A;  1I8F A;  2K7A A;  4O5V A;  2FRW A;  4F7U G;  3CC7 Q;  3OB9 A;  4J6Y A;  2RHI A;  3JB9 H;  1H8K A;  2LQK A;  2GQI A;  1Q7Y C;  1WHK A;  2E4H A;  4LDU A;  5FU7 C;  4DBF A;  4F17 A;  1BCM A;  1C6V X;  2YHT A;  3OS2 A;  5I22 A;  4ZN3 A;  1KQS A;  1VQ5 Q;  2R57 A;  3SWN C;  1Q81 U;  2EYY A;  2VGM A;  4KRT A;  4MML A;  5A0D A;  4HCC A;  1TSF A;  2VYT A;  1QW1 A;  3OSV A;  3M53 A;  5KYW B;  1M27 C;  2DER A;  1VYU A;  3CCM Q;  1NPR A;  3JV3 A;  1RI9 A;  4PJN A;  3X20 B;  3SEM A;  1NEB A;  2KYB A;  1KK7 A;  2JMA A;  1Q86 R;  1WHG A;  3HKS A;  2PZ1 A;  4PJO C;  1K0X A;  1N5Z A;  2RI3 A;  4F04 B;  3CD6 T;  1AWW A;  2Z0W A;  4JJB A;  1QMC A;  4C8Q F;  1E6H A;  3OBW A;  4M77 D;  1RLP C;  2CZ1 B;  2BZ8 A;  4J9F A;  2EGA A;  2DYI A;  1KC8 R;  3EG0 A;  1X43 A;  3BW1 A;  3QJY A;  4ZGD B;  2FVU A;  4OB2 B;  2OAU A;  4B9X A;  1PRM C;  2LNV A;  4JDS A;  2A28 A;  3REA B;  2FB7 A;  1IHV A;  2RNA A;  2KT1 A;  3CCE Q;  2EJ9 A;  2DM1 A;  1WZO A;  2G6F X;  2QQR A;  4PFP A;  4RG2 A;  3OYC A;  1OPK A;  3TSW A;  1NG2 A;  1D0Y A;  2AIR B;  1WHH A;  2FPE A;  3BFM A;  1S72 A;  1OX8 A;  1D3B B;  2YT6 A;  1RAF B;  3D7S B;  1VQN A;  5IXB A;  3PE0 A;  4E47 A;  4EMH A;  4FW2 A;  4ZGJ B;  1KHC A;  1GRI A;  2FG0 A;  3RR6 A;  1SHG A;  4DOV A;  1YWP A;  3M57 A;  1JB0 E;  2Y90 A;  4GLK A;  3FJP A;  4L5G A;  4PL6 A;  3CCR A;  2QTV A;  4JRI A;  4N4H A;  5KYW A;  2CP0 A;  4PJL A;  4M77 F;  2NUZ A;  4WTO B;  2EFI A;  1JRI A;  1G8X A;  4X9D A;  5CKD A;  2YWW A;  5KYY B;  1KSW A;  5CQY A;  2LTO A;  2DIL A;  4IUU A;  3MEU A;  1CKA A;  3EGD B;  4F16 A;  4ANJ A;  1D0X A;  2NWM A;  4BY6 C;  3VS6 A;  4LE9 A;  4A53 A;  3RNJ A;  2GTO A;  3G71 Q;  4O6J A;  4HCK A;  5GAM f;  1HJD A;  2XDB A;  4V2S A;  2MCN A;  1QP2 A;  2VXF A;  5HCK A;  3VUZ A;  2XMF A;  4JLI A;  2JTM A;  1UE9 A;  3A8O B;  2JT4 A;  2CUD A;  3CCM T;  3TRE A;  4FCY A;  4NL3 A;  4J6X A;  2RQR A;  4QVZ A;  1K9M R;  2DO3 A;  1KD1 C;  1CKB A;  4JZ4 A;  4NS5 A;  4RG8 A;  3SFM A;  3V7R A;  3N5B B;  3CCL A;  5J3B A;  2EKO A;  1SRL A;  2NUP B;  3OSS C;  1B34 B;  4C5H A;  2D0Q B;  3R6N A;  1PCX A;  3VYG A;  2CP7 A;  4PJO E;  4J8O A;  4HCZ A;  5C0M A;  4J5Y A;  4C92 C;  1UHC A;  1D3B A;  4FYV B;  5FU6 C;  1AHJ B;  3OYB A;  5EG2 A;  2OTJ A;  2RK1 A;  1YI2 A;  4VUB A;  1KG1 A;  1K8A U;  1K1Z A;  5GMK h;  4PJO G;  2D8J A;  5GAN j;  1B07 A;  2NLU A;  4BY6 B;  2RK2 A;  5LJ3 h;  2KQW A;  3QYH B;  1QWF A;  1YJN A;  2DKG A;  3CPW A;  1B3Q A;  2K79 A;  3AT1 B;  2RO0 A;  2JS2 A;  3MEW A;  5GMK l;  3M4G A;  1BKB A;  4GBQ A;  4RCB A;  1Q7Y U;  3R6O A;  1RLQ C;  3E1S A;  2BUD A;  1I81 A;  4DQ2 A;  3CCV A;  4BE2 A;  3KUF A;  3EGD A;  4FL6 A;  1AEY A;  2QDY B;  2AZV A;  4RCC A;  2LQ8 A;  3IQL A;  4FW1 A;  3U23 A;  3EH1 A;  3RIR A;  2COZ A;  2K2V A;  5LJ5 f;  3JRZ A;  2L3S A;  3EG9 B;  4RTW A;  1RAC B;  1OU8 A;  3G6E T;  4PJJ A;  2LX9 A;  2X9H A;  4E7K A;  1S72 Q;  2DL5 A;  3EHR A;  3HFN A;  5DLO A;  1EX4 A;  1ZHI A;  2CRE A;  4A54 A;  4UC4 A;  5GJV B;  1G5V A;  4M75 C;  2L3P A;  5AT1 B;  3LGF A;  4HT8 A;  1PD0 A;  4XTW A;  4OB1 B;  1K73 R;  8ATC B;  4HVW A;  1M3B A;  4WCI A;  3JCM J;  1PSE A;  2EYW A;  5IAY A;  4OMP A;  1U06 A;  1B34 A;  2HQH A;  3EG1 A;  1M5Q 1;  1RAA B;  3M56 A;  5GJW B;  1VQP A;  2MIO A;  4RMO A;  2ZPB B;  2ZPI B;  3JCM h;  3JCM b;  3UT1 A;  4M7A B;  4L6V 5;  5L23 A;  2A08 A;  1TUD A;  1KQS P;  2RA2 A;  1X27 A;  3JCM g;  2EIF A;  2EGE A;  1AD5 A;  3GBQ A;  1OI1 A;  1JO8 A;  2ROL A;  2RJD A;  1Q82 C;  3GIB A;  4PFZ A;  3X26 B;  3JB9 G;  1JBM A;  1UGS B;  1XNI A;  4M75 B;  5CR2 A;  4OGC A;  3CBO A;  4DBQ A;  1M2V A;  2KE9 A;  1R77 A;  2J6O A;  3LWI A;  4C92 E;  3QUI A;  2M0Y A;  1UGV A;  3CCL Q;  2DJQ A;  3EG9 A;  2MK5 A;  5C6S A;  2VGN A;  2LCC A;  1UHF A;  3I35 A;  3A5Z B;  3MPU B;  1AWJ A;  3L1A A;  1Q7Y R;  3UPU A;  5LJ5 d;  3MHX A;  4LD6 A;  4C92 G;  4M78 C;  1K9M C;  4C92 A;  1G3Y A;  2OTJ Q;  2I0N A;  1BI1 A;  2LVM A;  3JB9 J;  1YI2 Q;  4DEY A;  3EHQ A;  4C0Z A;  2IPO B;  5CK9 A;  4C8Q E;  2JN0 A;  4E7I A;  4KUL A;  2OAW A;  1PKT A;  2HDA A;  1YJN Q;  4DEX A;  2ED0 A;  2DIQ A;  4J9D A;  2RI5 A;  2E3H A;  4OP0 A;  1U1T A;  2MAM A;  3HRS A;  2DZ9 A;  1I07 A;  1S72 T;  1D09 B;  4C8Q G;  3X24 B;  4EIK A;  3DB4 A;  4BI3 A;  2CGH A;  2QYZ A;  2CSQ A;  4MZM A;  1VQN T;  3ZL7 C;  1X6O A;  2GFU A;  1QVP A;  2L0A A;  3I55 T;  2HQE A;  1VA7 A;  1KD1 U;  1M1K C;  4QQG A;  4KGX B;  3TSZ A;  2C0T A;  1OX9 A;  1MGQ A;  5CO7 A;  3HTR A;  1EFN A;  3OS0 A;  4M7D C;  1JJ2 A;  2JW4 A;  3CCR T;  2XDP A;  3CCU A;  1VQM A;  2HBP A;  4HKE A;  2EQJ A;  4M78 B;  5CKH A;  3V7S A;  4PLL A;  1FX7 A;  2FZK B;  2E5K A;  2V8I A;  2LX7 A;  4M75 A;  1QLY A;  1V29 B;  1WX6 A;  2QAZ A;  3RMQ A;  1YJW A;  1K4U S;  2RQV A;  4KGV B;  2OX7 A;  4F7U B;  4N0A C;  2YRV A;  5IH2 A;  3M55 A;  4KT0 E;  4IUQ A;  2DL7 A;  2J05 A;  2LMJ A;  2DL8 A;  3RES A;  2R58 A;  4M77 E;  2DNU A;  2I2L A;  1VQP Q;  1XTD A;  2O31 A;  2DXU A;  1WNL A;  3CCQ A;  2MPX C;  2YXY A;  3CXC A;  5GAO p;  1F1B B;  2YUO A;  3QZ9 B;  1VQ9 A;  4QKU A;  2RI2 A;  1N27 A;  1J3T A;  1WJQ A;  3HRT A;  4MZP A;  3CCL T;  1VQ7 A;  1JJ2 S;  2KRN A;  4JLG A; 
#chains in the Genus database with same CATH homology
 3EG0 A;  1X43 A;  2LQW A;  2BZX A;  2DL3 A;  3M0S A;  1PRM C;  2A36 A;  4D8K A;  1T0H A;  2K6D A;  2A28 A;  3REA B;  1U5S A;  3H0F A;  2RNA A;  2KT1 A;  2MOX A;  2DM1 A;  2ED1 A;  1G83 A;  2G6F X;  1T3S A;  2GNC A;  2RQT A;  2RF0 A;  1NLO C;  3NPF A;  4OML A;  2L2P A;  2DE0 X;  1OPK A;  1E6G A;  1WLP B;  1Z9Z A;  4JZ3 A;  3TSW A;  3UAT A;  1GCQ C;  1WXT A;  1NG2 A;  2ECZ A;  2FPE A;  1ZUU A;  1GBR A;  2FPF A;  2D1X A;  2YUQ A;  2LZ6 B;  2J06 A;  2QDL A;  2YT6 A;  3NGP A;  1VYT A;  5IXB A;  3PE0 A;  4JPB W;  2KBT A;  1GRI A;  2FG0 A;  2J6F A;  4QT7 A;  1UJY A;  1KFZ A;  1SHG A;  2D0N A;  2KXC A;  1BU1 A;  1YWP A;  1GL5 A;  2LCS A;  3VS0 A;  2FRY A;  1OV3 A;  1M3C A;  1YP5 A;  2O9V A;  3ULR B;  1SHF A;  1SPK A;  2RN8 A;  4CC7 A;  2GTJ A;  1ABO A;  1UDL A;  1WXB A;  2DYB A;  2PNI A;  1XOV A;  4LUD A;  2NUZ A;  1TG0 A;  1KSW A;  1FYN A;  2DIL A;  2OI3 A;  1YNZ A;  2HSP A;  2JS0 A;  1CKA A;  2M51 A;  1WI7 A;  4F16 A;  2AZS A;  4Y92 A;  3VS3 A;  4RTX A;  2NWM A;  2BZY A;  4LN2 A;  3VS6 A;  4LE9 A;  3RNJ A;  2GTO A;  1CSK A;  1PKS A;  3UA6 A;  2RPN A;  3RBB B;  3M0P A;  3VS4 A;  4RTT A;  4HCK A;  1HJD A;  1T3L A;  1BBZ A;  1K76 A;  3CQT A;  4J9E A;  2MCN A;  1PNJ A;  2K2M A;  5ECA A;  5HCK A;  2YDL A;  5I11 A;  2DVJ A;  1ABQ A;  3VS7 A;  2XMF A;  1UE9 A;  1OOT A;  2JT4 A;  2CUD A;  1W6X A;  2YUP A;  1AZE A;  2AKK A;  2RQR A;  4AFS C;  2EW3 A;  3O5Z A;  1CKB A;  1Z9Q A;  4J9G A;  1YN8 A;  3UA7 A;  1UJ0 A;  4JZ4 A;  1YWO A;  1M3A A;  2F2X A;  1FMK A;  4AFU C;  4FSS A;  1AOJ A;  2RMO A;  1SRL A;  1K0S A;  4OMO A;  2EVR A;  3H41 A;  1NEG A;  2B86 A;  1KIK A;  3R6N A;  2LJ0 A;  4Z8A A;  2KYM A;  4Z89 A;  1UHC A;  4RTV A;  1S1N A;  1Y57 A;  3KFV A;  1W70 A;  2KR3 A;  2LJ3 A;  1K1Z A;  2KT8 A;  4ZNX A;  5FWC A;  2D8J A;  1B07 A;  5EC7 A;  1X6B A;  2ROT A;  3VRY A;  4M4Z A;  1MUZ A;  1HD3 A;  2KRS A;  2VVK A;  4CC4 B;  1QWF A;  1ZLM A;  2JTE A;  1AZG B;  1B3Q A;  2K79 A;  1NYG A;  1WDX A;  2JS2 A;  3C0C A;  2F2V A;  2ABL A;  2CSI A;  4X1V A;  1NYF A;  4OMM A;  2W0Z A;  4GBQ A;  2KXD A;  3UF4 A;  1RLQ C;  1TUC A;  2HBW A;  2KGT A;  2A37 A;  2RQW A;  2F2W A;  2H8H A;  1AEY A;  2AZV A;  2HEQ A;  1X2K A;  2LNH B;  4AG2 C;  3IQL A;  3U23 A;  4AG1 C;  4J9C A;  5IHN A;  1ZUK A;  2DBM A;  2L3S A;  4RTW A;  1OEB A;  4RUG A;  1JU5 C;  4LUE A;  1GCQ A;  2CH4 A;  2KEA A;  2CH4 W;  2V1R A;  2HCK A;  3M0U A;  2DL5 A;  3EHR A;  1VYV A;  2CRE A;  1PRL C;  1AWO A;  2D8H A;  4R0K A;  5GJV B;  3NHN A;  2L3P A;  5FW9 A;  1RUW A;  2EGC A;  2ESW A;  2J7I A;  2JM9 A;  2DRM A;  4JJC A;  4HVW A;  3QWY A;  1M3B A;  4WCI A;  2EYW A;  1GBQ A;  3A98 A;  4OMP A;  4CC3 A;  3PVL A;  3VS5 A;  1U06 A;  2FEI A;  1OPL A;  4J9I A;  3EG1 A;  3LH5 A;  1JQQ A;  1SSH A;  2CDT A;  1SRM A;  2X3X D;  2YSQ A;  5GJW B;  4OMN A;  1WXU A;  2MIO A;  4A63 B;  3VRZ A;  3I5R A;  4AFZ C;  1AWX A;  4JJD A;  1I1J A;  1ZBJ A;  2CUB A;  5L23 A;  2A08 A;  1QCF A;  1TUD A;  3QWX X;  2JM8 A;  2SEM A;  2DA9 A;  1JXO A;  1X27 A;  2LP5 A;  1GFD A;  4J9B A;  1ZX6 A;  1W1F A;  2JXB A;  1E7O A;  2EGE A;  3M0R A;  3M0Q A;  1BB9 A;  1AD5 A;  1UTI A;  2KRO A;  2RQU A;  3GBQ A;  1JO8 A;  2EBP A;  2K3B A;  2ROL A;  2AK5 A;  2EQI A;  2YUN A;  4D8D A;  2LQN A;  1UG1 A;  1QKX A;  1UEC A;  2EKH A;  3H0H A;  1WIE A;  2SRC A;  2DX1 A;  2IIM A;  1A0N B;  2KE9 A;  4IIO A;  2O9S A;  5IHK A;  1Y0M A;  2J6O A;  3PVQ A;  4RTZ A;  3TVT A;  4GLM A;  1ARK A;  1M8M A;  1V1C A;  2M0Y A;  3EG2 A;  1UGV A;  3NMZ C;  2DJQ A;  1WA7 A;  2KRM A;  4E6R A;  1U3O A;  1UFF A;  3EGU A;  1UHF A;  1M30 A;  3I35 A;  1AWJ A;  1JXM A;  1X2Q A;  2GBQ A;  4AFQ C;  4OMQ A;  1I0C A;  2VKN A;  2I0N A;  1WYX A;  4J9H A;  4DEY A;  3EHQ A;  2OJ2 A;  2DRK A;  3M0T A;  1T0J A;  2DF6 A;  2V1Q A;  1IO6 A;  1G2B A;  1PHT A;  2OAW A;  3SHW A;  1PKT A;  2HDA A;  2EYZ A;  1NLP C;  4DEX A;  2ED0 A;  4F14 A;  2VWF A;  2DBK A;  4J9D A;  2DMO A;  1UUE A;  1KJW A;  1LCK A;  2FO0 A;  4IIM A;  1PWT A;  1I07 A;  2BTT A;  2JMC A;  1QWE A;  2ENM A;  3H0I A;  3THK A;  4EIK A;  2LJ1 A;  2DLP A;  2P4R A;  2CSQ A;  3ZL7 C;  2L0A A;  3FJ5 A;  4ESR A;  2AKL A;  2C0I A;  1VA7 A;  2K7A A;  2FRW A;  1AVZ C;  2L3Q A;  1X6G A;  2EYX A;  4LNP A;  1WFW A;  1GCP A;  3TSZ A;  3I5S A;  2C0T A;  1X69 A;  1ZSG A;  4K11 A;  1H8K A;  3VS1 A;  2GQI A;  2EPD A;  5IHI A;  1HSQ A;  1EFN A;  2O2O A;  2J6K A;  5IXF A;  2JW4 A;  1QKW A;  4F17 A;  2KNB B;  3REB B;  1GFC A;  5I22 A;  2DL4 A;  2E5K A;  1SEM A;  2LX7 A;  4HXJ A;  1QLY A;  2EYY A;  4KRT A;  1WX6 A;  1K4U S;  2RQV A;  4RTU A;  1NM7 A;  2X3W D;  1H3H A;  2PTK A;  1M27 C;  5IH2 A;  1VYU A;  2C0O A;  4ORZ A;  3JV3 A;  1RI9 A;  2DL7 A;  2J05 A;  2LMJ A;  2DL8 A;  3VS2 A;  1YCS B;  4HVV A;  3SEM A;  1NEB A;  2CT4 A;  1MV0 B;  2KYB A;  4Z88 A;  5FWB A;  2DNU A;  1H92 A;  3I9Q A;  2JMA A;  2PZ1 A;  4RTY A;  2O31 A;  1BK2 A;  2GGR A;  1K0X A;  2FPD A;  1N5Z A;  4CC2 A;  1AWW A;  4JJB A;  1E6H A;  2YUO A;  1RLP C;  4HVU A;  2BZ8 A;  1K9A A;  4J9F A;  2W10 A;  2CT3 A;  2EGA A;  1J3T A;  2K9G A;  2O88 A;  1ZUY A;  2KRN A;  1JEG A;  1MV3 A;  3EG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...