2LJ1A

The third sh3 domain of r85fl with ataxin-7 prr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
b'QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbin and SH3 domain-containing protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Structure Basis for the Recognition of Ataxin-7 PRR with R85FL SH3 Domain
rcsb
total genus 8
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj1A00
3O5ZA 3UATA 1T3LA 2I0NA 1JXMA 1ZUKA 2YDLA 2O9VA 2DYBA 2D0NA 1YWPA 2OAWA 3VS0A 1Y57A 1NLPC 3VS4A 1WLPB 3ZL7C 2X3WD 1BU1A 2EGEA 4JJCA 1ZX6A 5FW9A 1GFCA 2KGTA 2OI3A 1GBQA 1X2QA 4J9FA 1ZBJA 1H3HA 4ZNXA 2RMOA 1SEMA 2NWMA 2EGAA 2C0OA 4F14A 1AWJA 2C0TA 4J9BA 2QDLA 1K9AA 1LCKA 3I9QA 2A36A 1GBRA 2ESWA 1W6XA 4JPBW 2RQUA 2HDAA 2AZVA 1PRLC 4M4ZA 3UF4A 3NMZC 1UGVA 4IIOA 2K7AA 1QKWA 2KEAA 2ED1A 2EYYA 3EG0A 4D8KA 2LJ1A 3VS6A 2VVKA 1OOTA 4J9HA 1OPKA 1Z9ZA 5IHKA 1KIKA 2DILA 1M30A 1ABOA 2AKKA 2MOXA 1PKSA 4AFQC 1CKAA 4Z8AA 1WFWA 2EQIA 3SHWA 2RQRA 2HCKA 2LZ6B 1U06A 1V1CA 4E6RA 1UTIA 4JJBA 1UFFA 1OEBA 4QT7A 1RUWA 2M0YA 3PVQA 3EGUA 2KT8A 1MV3A 1M8MA 2VKNA 2CDTA 1XOVA 2DBMA 4LUEA 1JU5C 1SHFA 1UG1A 2RPNA 4KRTA 1Y0MA 2DL3A 2EYZA 3VRZA 2RNAA 2ROTA 3RNJA 1QLYA 2ECZA 2W10A 4RTXA 4CC4B 1GCQA 1ZSGA 2LJ0A 1WDXA 1SRMA 2YSQA 1ZUYA 4AFSC 2JMAA 4LE9A 1AWXA 2A28A 2F2XA 1IO6A 4J9EA 4AG2C 1UHCA 1S1NA 2JMCA 2KXCA 2J06A 1T0JA 3H0FA 2V1QA 2YUPA 4CC7A 2CSIA 2ED0A 2KR3A 1MV0B 1N5ZA 1X43A 1PKTA 1YP5A 4F17A 2J6FA 3I5SA 4OMOA 2FEIA 1ABQA 3UA7A 1UECA 1UDLA 2DBKA 2KRNA 2GGRA 2BTTA 2F2WA 1A0NB 1WXBA 2LCSA 1YCSB 2EYXA 2A08A 2G6FX 1UJ0A 1Z9QA 1BB9A 1WXTA 4RTVA 5IXFA 2J7IA 3EG1A 2BZ8A 3M0SA 2PZ1A 1WA7A 3TVTA 3ULRB 2CUDA 4D8DA 2LJ3A 2FPEA 1VA7A 1K4US 3M0RA 2DRKA 2KROA 2RN8A 2RQVA 2A37A 2LQWA 1AZGB 3M0TA 4RUGA 3FJ5A 2O9SA 1NG2A 3C0CA 1RLQC 2GTOA 2D8JA 3CQTA 3KFVA 2L3QA 1AVZC 1NEBA 2KBTA 1NYGA 2EKHA 2EGCA 1T0HA 2KRSA 4Z89A 2E5KA 2DF6A 2K3BA 1GL5A 1VYVA 1X6GA 2LQNA 1X2KA 1X69A 2YUOA 1UE9A 2AK5A 1GCPA 4Z88A 1SSHA 4FSSA 1YNZA 2FRYA 2KYBA 1M3BA 1SRLA 2EVRA 4RTZA 2DA9A 1B3QA 2DNUA 2K2MA 2DE0X 1JXOA 2D1XA 4J9GA 1H92A 1E6GA 2RQWA 1J3TA 4RTWA 5IHNA 2CH4W 2K9GA 1NEGA 3PE0A 2IIMA 1QCFA 2KE9A 2JTEA 5IH2A 1U3OA 1WIEA 1BK2A 3TSWA 2XMFA 1I0CA 4LUDA 5HCKA 2SRCA 3VS1A 1M3CA 1K0SA 4HVVA 3VS3A 1X27A 2EYWA 2DMOA 1I07A 1OPLA 2JW4A 4J9IA 1UJYA 3GBQA 4AG1C 1EFNA 5L23A 2DM1A 4GBQA 1PNJA 2DVJA 1AWOA 1QWFA 4IIMA 3UA6A 2AZSA 1PRMC 4CC3A 2JM9A 3RBBB 2L3PA 1B07A 1M3AA 1AEYA 1PWTA 2FRWA 4AFUC 1UHFA 4JJDA 2YT6A 4RTUA 2JT4A 3R6NA 3VRYA 4GLMA 3QWXX 2OJ2A 3JV3A 2CT4A 2X3XD 3I5RA 3M0PA 5I22A 4JZ3A 2J6OA 2PNIA 1G2BA 1HJDA 1FYNA 2GNCA 1NYFA 1SPKA 3THKA 4OMMA 2DJQA 1QWEA 4LN2A 2JXBA 1JQQA 2LMJA 2GQIA 2O2OA 5ECAA 1BBZA 1UUEA 2PTKA 4HXJA 3M0UA 2CSQA 2BZYA 3QWYA 1G83A 1I1JA 4J9DA 4EIKA 2VWFA 3TSZA 2ROLA 1TUDA 2DL8A 3NGPA 1CKBA 2FG0A 2SEMA 3I35A 4HCKA 2CH4A 1KSWA 2DLPA 1OV3A 2KYMA 2JM8A 2L2PA 2P4RA 3M0QA 1K76A 1JEGA 4WCIA 1WX6A 1WXUA 2FO0A 2HSPA 5FWCA 2MIOA 1HSQA 2W0ZA 1T3SA 3H41A 1CSKA 5EC7A 2DL5A 2CT3A 4OMNA 4RTTA 1ZUUA 2EW3A 2EPDA 2KRMA 4A63B 1VYTA 2JS0A 4ORZA 1TUCA 1ZLMA 1AOJA 2YUQA 1SHGA 4OMPA 2FPFA 3EG2A 2RQTA 2RF0A 3SEMA 1YWOA 1KJWA 2DL7A 2GTJA 4OMQA 3PVLA 4AFZC 5FWBA 4F16A 3REAB 2NUZA 1KFZA 1TG0A 4RTYA 5I11A 1E6HA 2O31A 4OMLA 2YUNA 1AD5A 5GJVB 2V1RA 1RI9A 4ESRA 3U23A 1NM7A 2KT1A 2L3SA 3NHNA 2KXDA 5IXBA 2D8HA 2ABLA 1NLOC 1WYXA 2H8HA 3EG3A 3H0HA 3EHQA 4K11A 1MUZA 4R0KA 1U5SA 3VS7A 3VS2A 1YN8A 2FPDA 4LNPA 4X1VA 3NPFA 1FMKA 1VYUA 4HVWA 1E7OA 2B86A 2JS2A 3A98A 5IHIA 2MCNA 1AZEA 4J9CA 4JZ4A 1H8KA 2HBWA 1AWWA 2GBQA 1WI7A 3LH5A 2AKLA 2CUBA 4CC2A 1K1ZA 3H0IA 4DEYA 1ARKA 2DRMA 2EBPA 2CREA 2LNHB 4Y92A 3VS5A 5GJWB 1QKXA 2LP5A 2HEQA 2J6KA 1W70A 2K79A 1X6BA 3EHRA 2O88A 2ENMA 4DEXA 2M51A 1JO8A 1K0XA 2K6DA 4HVUA 1GRIA 2LX7A 2F2VA 1HD3A 1GFDA 2J05A 1W1FA 1GCQC 3REBB 2BZXA 1RLPC 3IQLA 1M27C 2DL4A 2L0AA 2KNBB 2C0IA 2DX1A 1PHTA
chains in the Genus database with same CATH superfamily
2HL5C 1G8XA 3JAME 1EZZB 1YJWT 4E47A 2K5FA 1Y57A 1NLPC 3VS4A 2COYA 1YHQQ 1RADB 1O9SA 2EGEA 4MMLA 1PG5B 5J26A 2PVGB 1JRIA 3CMAQ 2RK1A 3CC7A 3GIBA 2XICA 4FU6A 5CK9A 3OYFA 1GBQA 3MCAB 4J9FA 2M0OA 5CVIA 5CQYA 1H3HA 3TQ7P 3JCMP 1SEMA 2NWMA 2YRCA 2C0OA 2QTXA 2QDLA 3QDRB 2DIQA 1GBRA 1OI1A 3QJ6A 5FU7C 2AZVA 1QVPA 1KC8R 4JS5A 2E1HA 3ZEHA 2HKNA 1QKWA 3M53A 3CC4T 2DERA 5I21A 4TVRA 4FYVB 2EYYA 3EG0A 3CBMA 3QJYA 4D8KA 2LJ1A 2X4YA 1RL2A 2EAYA 2XKOC 4J9HA 5IHKA 1X6OA 1MNEA 3SDZA 4B6MA 2H3JA 3LH0A 4C92C 1ABOA 1WFWA 5LJ5g 1G3TA 4XAXB 2F1LA 1KC8U 2E41A 3DB3A 1IGQA 4PJLA 4PJMA 1U06A 3TEEA 4E6RA 5DM7R 5GAOm 1UFFA 4L59A 1Y7XA 1RUWA 3FEOA 3OA6A 1TS9A 3GP8A 4BY6B 5CKEA 4L5GA 4C92B 4XU0A 5LJ5h 4M78E 2VKNA 4M7DB 2VGMA 3CD6T 3JCMf 2DBMA 4LUEA 3MEWA 1PSFA 2MMPA 1QVFP 1Y0MA 3CCUT 5GAOn 2RHUA 3VV0A 3META 3VRZA 4XTZA 2RNAA 4II1A 2XD0A 1QQJA 1ZSGA 1Q82U 1PD1A 4VUBA 3ME9A 2YSQA 5AYFA 2EJFA 1ZUYA 2WSEE 3QG1A 3RMQA 1VQ8T 2M9UA 2F2XA 1VQLQ 4LDWA 4AG2C 5A0DA 2LT4A 1VQ4T 2XIDA 3PFSA 2O01E 2V1QA 4X9DA 4JDSA 4RG8A 2CSIA 1N27A 1YJNQ 1MV0B 1VQ8A 1PKTA 1YP5A 4YTLA 4E7JA 2P0PA 4JRPA 4FT4A 2RHXA 2DPPB 3CCMA 1VQMQ 5GANh 4BD3A 2JUFA 1S72T 2DBKA 4C0FA 2KRNA 4KGXB 2LCSA 2RJEA 2YWWA 2EYXA 2A08A 1U1TA 1ZQ1A 1BB9A 4RTVA 2J7IA 3EG1A 4PJOF 4DQ2A 1U8RA 2LQKA 2OX7A 3A5ZB 1QVFS 1ZA1B 3HRSA 3TVTA 2YXYA 4BE1A 1TU0B 2LJ3A 3WXMB 1VA7A 2DRKA 2CZ7B 4GLKA 3BDUA 2DKGA 2LQWA 4XTUA 3MEAA 4RUGA 3FJ5A 1NG2A 1K8AC 3LX7A 2NLUA 1OX8A 2EJGA 1SF9A 3I55T 2L3QA 1AVZC 1YITQ 1M1KR 3OW2S 1MMNA 1T0HA 2KRSA 4Z89A 2E5KA 2KK4A 1GL5A 1BIAA 3MHXA 1OZ2A 1JBMA 2QGGA 2E6NA 3HP9A 4BI4A 3V7RA 1SRLA 4RMOA 4FCYA 3G4SQ 2DA9A 2K2MA 4M77C 1X01A 4HCZA 3RIRA 1D0XA 4BE2A 4QKUA 3A8MB 3MP6A 1KQ2A 1H92A 1E6GA 4PK4A 4RTWA 5IHNA 2JVVA 1NEGA 1WZOA 1YIJT 3AT1B 2IIMA 3X20B 4OVAA 4RCBA 1VQ7Q 3QUIA 1IRXA 5IH2A 3J81E 1YJWQ 3G6ET 4C8QF 1G3WA 5LJ5e 3CCJT 4HVVA 2YLCA 5A0GA 1X27A 2EYWA 5GANf 4PJOB 1Q86R 2DAQA 4XTVA 3JB9I 4KH0B 2BE7D 2K4YA 2DVJA 2RI3A 3PMTA 4HA8A 2DXTA 4JJNK 3OW2P 3RBBB 2L3PA 1TSFA 5KYYA 2XI9A 4XTXA 4ME7A 2GF7A 1KQSA 5FLXE 4JJDA 1LPLA 1MNDA 2YT6A 4RTUA 4OB2B 2RB6A 3E1SA 3A8LB 1BI2A 1TH7A 3R6NA 3VRYA 4GLMA 3M55A 3FC3A 3V7CA 2CT4A 1W2BA 2PNIA 1NYFA 3CC2A 2RJDA 2X4JA 4BB7A 3G4ST 4N4IA 4OMMA 2CYZB 3QZ5B 2JXBA 3P8HA 4N4GA 5KYXA 1BBZA 2QTVA 2P0QA 1PD0A 3H8ZA 2BUDA 4PL6A 3MKDA 1SSFA 2FVUA 4JS4A 1PCXA 2MF2A 1OV3A 5CCAA 3V7SA 3CCLA 3RMSA 1HSQA 2W0ZA 1T3SA 1D3BA 4JLIA 5C0MA 1QCNA 2K3YA 4MZTA 2CT3A 4RTTA 1YJWA 3NFCA 5FU6B 3OS5A 4C92D 4J7FA 2FZCB 4M7DD 4QVCA 3OYJA 2OTJT 2GCXA 1NBEB 3QIIA 3PNWC 3OS2A 3QHSA 2D9TA 1KJWA 1K8AU 4D6WA 2RHIA 4OMQA 1C6VX 4OB0B 5M9OA 3CCSA 2A0FB 2HBPA 3REAB 1JJ2P 2XDDA 1RAAB 4M75G 2NUZA 3D7SB 1VQ5A 5KYUA 2X51A 4RTYA 1E6HA 1M8VA 1RABB 3MP8A 4M77E 4F7UE 2DTIA 4XQ3A 1KK7A 3CCVQ 2HSEB 2LT1A 1RI9A 4C8QA 2DJZA 4MDWA 2E5QA 1R8OB 2ZPBB 5IXBA 5GAOr 4K11A 3EHQA 5HK3A 4NL3A 3VS7A 3O8VA 2FPDA 2FHDA 3QDFA 4KBMB 3CC2T 1FMKA 1VYUA 4C0DB 2WACA 3A98A 4E7ZA 2CP3A 5IN1A 4OGEA 1YBYA 1BCMA 4EMHA 2ZPGB 3ZBDA 1AWWA 1WI7A 5GAMh 2RHYA 4CC2A 3H0IA 1QW1A 2LNHB 5KH6A 1QKXA 1BCOA 5KCHA 3PTAA 3FJPA 4M77G 3ZFJA 4F7UG 1X6BA 2O88A 1QVGA 2M51A 1JO8A 5GANd 1M2OA 1R0CB 1RAHB 4M78F 2K3XA 3REBB 2BZXA 4XTYA 1RLPC 2L0AA 1QP3A 2KNBB 3FDRA 3LGFA 1TWBA 1K73R 2C0IA 3RERA 2DX1A 4OP0A 5C6SA 1PHTA 2K57A 2YRVA 1UEBA 4BDYA 1WJQA 1Q7YR 1IXDA 3VYGA 4J6YA 1T3LA 1JXMA 1Y71A 4IUQA 4Y28E 2O9VA 3OYKA 2XK0A 2OAWA 3H9NA 3VS0A 3CCQQ 3G6EA 1WHLA 1IGUA 4OB1B 1ZX6A 4M78D 4FL6A 2AIRB 1GFCA 2RM4A 2KGTA 1X2QA 5FROA 4FSXA 4ZNXA 2RMOA 1YJ9A 4NS5A 2JN0A 1K9AA 1TTHB 2PQWA 1W6XA 1M1KU 1B7TA 1NJIC 1PRLC 2DZ9A 2RO0A 3CCQT 5A2QE 2KEAA 3L2WA 3VS6A 3L2QA 2VVKA 3VUBA 3OS1A 1KIKA 3RESA 1VQPT 2DILA 2AKKA 2MOXA 1PKSA 4Z8AA 1OZ3A 3HSBA 1AT1B 3HHTB 4E7HA 4P5NA 3SHWA 2WSCE 1M90R 2NYSA 1UTIA 4JJBA 1OEBA 1VQKQ 2VGNA 4ZTJA 3G4SA 1UGQB 3NTHA 3OS0A 1YJ9Q 3URGA 1XOVA 1W4SA 2PU9B 4PJOC 1M2VB 4PLLA 1SHFA 1VQ5T 1UG1A 2QEXQ 1ZHIA 2QI2A 4ELZC 3FIFA 2EYZA 3JB9D 1KD1C 5GAMe 2RI2A 3SFMA 2GFAA 3OBWA 2ECZA 2W10A 1VQ6Q 4RTXA 2RD1A 2LJ0A 3OW2A 1EIFA 5GAN2 3CCRQ 2R5MA 3RKXA 2LX9A 4LE9A 2A28A 1IO6A 1S1NA 2KXCA 1T0JA 1PSEA 2WSFE 2YUPA 4CC7A 2ED0A 2KR3A 2R57A 2COWA 2HNIA 1N5ZA 3RUXA 2DIGA 5CKHA 1PM3A 3I5SA 4EMGA 5J3BA 2JJ9A 4C8QB 3UA7A 4M7AA 2BTTA 4Z02A 1A0NB 5KYXB 1G3YA 2RJFA 2BKDN 2G6FX 5IXFA 2BZ8A 3OYHA 2PZ1A 4DBRA 3JCMW 2LCCA 2CZ0B 1D09B 2FPEA 1K4US 2V26A 2A7YA 3S3MA 2RQVA 4PFZA 1UGPB 1ACMB 4BUGA 4DOVA 2EQMA 2EQJA 3CC2Q 3C0CA 1UB4A 3JCMX 3F70A 1JB0E 2XG8D 2D8JA 3CQTA 3CMEQ 2X4WA 2XHCA 1FXXA 2F5KA 3H6ZA 4QVDA 3DKMA 5GMKj 3OMGA 2DF6A 2CZ1B 3FB9A 2RH2A 4LD9K 2I2LA 1GCPA 4Z88A 5GAN3 5GMKm 4F04B 2FRYA 4ATOA 4RTZA 1B3QA 4XU2A 1YJ9T 2LNVA 2OAUA 4DBHA 3E2UA 2DXUA 3JRZA 3L2VA 1JXOA 2QYZA 4FT2A 1R77A 2RQWA 4J8OA 3CC7Q 2CH4W 1YI2Q 4IURA 1Q7YC 4A54A 5KE3A 1WIEA 3JCMb 5LJ3h 4GY5A 1I8FA 3TSWA 2XMFA 4C8QG 1WQ7A 4KGVB 2R58A 1M3CA 5HK0A 3CCUA 1OPLA 2E3HA 4J9IA 1Q82R 4MDXA 1NJIR 4LD6A 4M75A 2PUOB 4GBQA 1AWOA 4QVZA 4IIMA 4OGCA 2AZSA 3MEVA 3G7ZA 1PRMC 2JTMA 5GMKi 1MGQA 2HL3A 1B07A 4DBFA 2CKKA 3CCMQ 2B8AA 1NPPA 3BFMA 1UGRB 3QZ9B 3JB9J 4HKEA 4ZGJB 1I81A 3G71T 5I2MA 4E2FB 4PNOA 1QP2A 2JT4A 2CP5A 5GAMg 3CCQA 4AMCA 3RKYA 3JV3A 3WVEB 2ZAEA 2X3XD 3M57A 1QVGP 2DXCA 2OTLA 3M0PA 5LJ5d 1NPRA 3X24B 2EYQA 1GXIE 5GAMf 3M59A 4V2SA 5KE2A 2DJQA 2L89A 1QWEA 4MMKA 3G71Q 1H3ZA 4LN2A 4C5GA 4EMKA 2FL7A 1IHWA 2O2OA 1VQNQ 1UUEA 2PTKA 3JCMd 3HRUA 3QWYA 1XJWB 4J9DA 3PIPA 4EIKA 1YITT 2CP0A 1CKBA 3RKWA 2DLPA 1Q86U 2ZPFB 2P4RA 4EPCA 1WX6A 1Q81C 1BI3A 2MIOA 4A4FA 1H641 1OQKA 3JSCA 1CSKA 2YHTA 3OYNA 2IVWA 3DLMA 2E3IA 1VYTA 4R55A 2EQKA 1AOJA 2YUQA 4OMPA 2FPFA 4FW2A 4KGZB 1Q81U 2NUTA 1VQ7T 3EG2A 2RQTA 3CXCS 5GAN6 3SEMA 5KYWB 1WJSA 1DJ7B 2ZCFB 2QEXT 2V8KA 1S72Q 4M77B 4F7UB 3LWHA 4AFZC 4WTOB 1RACB 3I55A 1OYXA 1KFZA 1RI0A 4A4GA 1ZBXA 3CMEA 5I11A 3CXCA 2ZGWA 2DEQA 1VIFA 1VQLT 3OMCA 5DLQE 2YRDA 2L3SA 3NHNA 3OSSC 3EG3A 3GNFB 1U5SA 1BI1A 4LNPA 2VV5A 3PMIA 4X1VA 3NPFA 2XDBA 3E9GA 4JLGA 4HVWA 2JS2A 2LVMA 4OB3B 2DYIA 3MO8A 3JCMc 3C12A 3CBPA 2M1HA 4NL2A 3UPUA 4J9CA 1YI2A 2PUKB 1H8KA 2GBQA 1RAIB 3LH5A 2AKLA 3OYAA 2DRMA 4RKUE 3CCET 5FRMA 2KY9A 3INZA 5GAOq 3R6OA 1FMWA 1WHJA 2J6KA 1W70A 2MK5A 2K79A 2QQAA 4KULA 2DK3A 4ZN3A 4HVUA 2LX7A 3CCST 1LJOA 1W1FA 2RI5A 4C0GA 4PLIA 2L3RA 4M7AF 4M75D 1Y07A 4ANJA 3IQLA 2VXEA 4C92F 3MEUA 2XU8A 4A4EA 1VQKT 3O5ZA 1VQ9A 3UATA 3X26B 1QMCA 2YDLA 2DYBA 1N8RU 2COZA 3BW1A 1WLPB 3ZL7C 3S3OA 2X3WD 3CPFA 2ZZDA 3L2ZA 3JB9G 4IUTA 4JJCA 4M7AD 5FW9A 1YIJA 1OU9A 1K9MR 2QK0A 4QW2A 2OI3A 5D7UA 2E70A 2NUPB 4FM4B 3OYBA 5D6YA 4M77F 4F7UF 2CP7A 3J80E 1N9SA 1QCOA 4F14A 2C0TA 1D1CA 3I9QA 2JOYA 2ESWA 1MMDA 4M78G 1ZSZA 2RQUA 3GF5A 1RAGB 2HDAA 3NMZC 1UGVA 2CS7A 2QAZA 4IIOA 2X4XA 2CP6A 2JTFA 2K7AA 2MWPA 3C4SA 3SWNA 2E10A 5LJ3j 4M7DE 2ED1A 5GANj 3G6EQ 2NUPA 3L42A 1KQSP 2HZYA 1Z9ZA 1M30A 1YI2T 1XQHA 1CKAA 3CD6A 1N6AA 2EQIA 5IT9E 4X34A 3RR6A 2HCKA 2LZ6B 4Q5WA 3L2UA 2KDSA 2F5TX 4M75B 1V1CA 1OULA 2HD0A 3CEYA 3CCLQ 4X9CA 2M0YA 1IZ6A 1WQWA 3N5BB 3SD4A 5LJ3e 1D1AA 3A1PA 1VIEA 2KT8A 4JRIA 1MV3A 2LTOA 1M8MA 3M9QA 4MZMA 1YHQA 3L1AA 5GAMj 2DTHA 3CMET 2KI7A 5GAOl 4IKFA 4KRTA 5CR2A 2DL3A 1WHMA 1G3SA 4M7AB 1R0BG 3NTIA 4BY6C 4C8QE 5GAN7 1K8AR 2QA4Q 3V8LA 1VQOA 1N8RC 3ER0A 4AFSC 2MAMA 2JMAA 5LJ3d 4J9EA 1UHCA 1QVGS 3SWNC 3KUFA 3H0FA 3PGGA 3OQ5A 2OTLQ 3NTKA 1X43A 2V8JA 5A0LA 5GAN8 8ATCB 2CGHA 4OMOA 1EX4A 5CAIA 3BE3A 1UECA 1UDLA 3JB9H 4M78A 3EH2A 2KVQG 1Z9QA 1WXTA 5IAYA 1LVKA 1VQ8Q 3M0SA 3PT9A 4FYYB 1VQ9Q 3CCRT 6AT1B 1WA7A 1F1BB 4C8QC 2L5QA 3HL8A 1YJNT 3ULRB 4D8DA 5GAN4 3TU4K 1NJIU 2EIFA 5KYWA 2RN8A 2A37A 1ZSZB 4M7DF 1S72A 1AZGB 5J39A 2O9SA 1RLQC 2GTOA 4J7IA 1VQ5Q 3LLRA 3KFVA 4KH1B 4CRIA 1NEBA 1NZ9A 1BYMA 1NYGA 4FIBA 3CC4A 2EKHA 2EGCA 1RAFB 4WF2A 1WNLA 2QEXA 3E19A 2RJCA 2K3BA 2QG9B 3EFOB 3CCVT 1X6GA 2LQNA 1D1BA 1X69A 2YUOA 2MYSA 2AK5A 1HXDA 3TCJA 1YNZA 2D0QB 4C0DC 1M3BA 1M90U 1U1SA 3HFOA 4M75E 3S6WA 5GAMd 1WPYA 2DE0X 4IUPA 1J3TA 5CIUA 3X28B 2P84A 5KCOA 3OYMA 2HQEA 4C92G 5GANe 2JTEA 2OTJQ 4DA4A 2EQUA 1YCYA 1V29B 2Z0WA 2QGFB 1BK2A 4A53A 2H3EB 2DXBA 1YIJQ 5HCKA 2SRCA 3VS1A 3OYGA 2K5LA 1K0SA 3CPWS 3VS3A 2O4XB 5CKFA 1VQ6T 2E65A 2JW4A 1UJYA 9ATCB 1EFNA 5L23A 3A8GB 2DM1A 3T9NA 3CC4Q 1KD1R 4M78C 4CC3A 4RCCA 2MPXC 1AEYA 1UGSB 1PWTA 3CCVA 4M75C 2YLBA 3P8BB 3I55Q 4AFUC 4O5VA 3OYIA 5CKBA 1Q81R 1TXQA 2EFIA 1I5OB 3QWXX 1KD1U 4PJJA 4XU1A 1TOVA 2QQ9A 5L8RE 3EFSA 1NE8A 5GMKe 1Q82C 4JZ3A 2J6OA 4A4HA 1P92A 1JJ2A 5HKCA 1SPKA 4OMFB 1YFNA 4QQDA 1K73C 1JQQA 3BDLA 5ECAA 5GAOp 2QQSA 1VQ6A 2E64A 3QBYA 1N8RR 2BZYA 2HAXA 5LJ5j 1G83A 1I1JA 2VWFA 3EGXA 3TSZA 3SWNB 1TUDA 2DL8A 3EAEA 2IG0A 3NGPA 2FG0A 2SEMA 3I35A 4HCKA 3VYHB 1KSWA 3M5AA 2KYMA 2JM8A 3QKJA 2L2PA 4ZGEB 2E12A 2KMTA 1WXUA 1VQ4Q 2FO0A 1VQOQ 2HSPA 3GLXA 4PJOD 3H41A 2E6ZA 3A8OB 1M1FA 5EC7A 2M16A 2EW3A 2BIVA 1M9SA 4N0AC 2JS0A 4ORZA 4A63B 4C92E 1VQ9T 1VQKA 4A4KA 3OYCA 1TUCA 3PIOA 3UDCA 2LCLA 3M56A 1VQOT 2DD5A 4R56A 3HKSA 2DL7A 4C5HA 3VKIA 4QQ6A 2Y90A 3PVLA 4F16A 4RG2A 3KXTA 2D6FA 1TG0A 1M5Q1 1ZSZC 2AT1B 2KAFA 4B9XA 3A8HB 4BACA 1VQNT 2DEUA 3QPHA 2HMAA 4OMLA 1MHNA 2YUNA 4ZTFA 1WHKA 1AD5A 5GJVB 1VQMT 3JB9F 4LDVA 4ESRA 3QXEB 4EMKC 3U23A 1NM7A 5LJ3g 3S3NA 5LJ5f 2X9HA 2K5IA 2H8HA 1NLOC 3H0HA 3WVDB 4AT1B 1AZEA 2B86A 5FRNA 5IHIA 3CXCP 5GMKl 3M4GA 4EDUA 4C0ZA 1VQPA 3EG9B 2CUBA 2RA2A 4LDUA 1K1ZA 1ARKA 2EBPA 3LGLA 2CREA 4Y92A 3VS5A 5GJWB 2QDYB 4C92A 3G71A 2LP5A 3CCMT 1RAEB 4HCBA 4JRKA 2ENMA 1VOMA 4DEXA 4J6WA 1K0XA 2K6DA 2F2VA 1M2VA 1I4K1 2IPOB 3M58A 2G3RA 3V8JA 1W2BS 4BI8B 2DL4A 5GANg 5HY6A 1WGSA 3HPWA 3JCMe 3M54A 2FZKB 2I0NA 1ZUKA 3VU3C 2D0NA 1YWPA 3RDVA 1BIBA 1YITA 1KQSS 3CMAA 2VYTA 8AT1B 3CC7T 3LW5E 1MMGA 5CKDA 3OYDA 1BU1A 2C06A 4C5IA 3X25B 2O4XA 4J6XA 4FYWB 1IHVA 1HK9A 5FU7B 1ZBJA 1K9MC 2EJ9A 3QSUA 3GPLA 2EGAA 1FMVA 2KQWA 1AWJA 4J9BA 4HT8A 1LCKA 4XU3A 1B34A 2A36A 4JPBW 4M7AG 4M4ZA 3UF4A 1M1GA 1K9MU 5D6WA 1XTDA 1IB8A 1Y96A 4C5EA 3V8KA 1Q86C 4LXCA 2LDMA 1OOTA 1OPKA 1PC0A 2HKQB 4KT0E 1YHQT 4AFQC 1MMAA 1K73U 4Y91A 1OX9A 5AT1B 2RQRA 1FWZA 3UWNA 4QT7A 3LYIA 3OYLA 3CPWP 3PVQA 5LL6S 2VUBA 1C0MA 3EGUA 3OBYA 3VUZA 2P4TA 4M7AE 4M75F 3CCJA 2QXFA 3I56A 2CDTA 3CCEQ 1ZA2B 4PFPA 1VQNA 1JU5C 1Q95G 4FYXB 3MPUB 4PKCC 3MJXA 2RPNA 4BDZA 4M77D 3M4YA 3HRTA 4M78B 2Y4YA 3CMAT 2ROTA 4M7DC 2HQXA 4B9WA 2LQ8A 3RNJA 1QLYA 4CC4B 4DBQA 1GCQA 3BY7A 1WDXA 2RK2A 1SRMA 2QQBA 2QA4T 2QA4A 1V76A 1AWXA 2JNGA 4J83A 2JMCA 2J06A 2PVDB 2QASA 2LRQA 2VC8A 1N9RA 3FLGA 3C94A 2XDPA 2EWNA 1WHHA 4F17A 2J6FA 4PJNA 4N0AA 2RHZA 3JCMh 3EGXB 4E7KA 1BI0A 2FEIA 3OYEA 1ABQA 3I56Q 2GGRA 3I56T 2F2WA 3CCLT 1WXBA 1YCSB 1UJ0A 4UC4A 1D0YA 5EG2A 2ATCB 1HYOA 4OF1A 1SKUB 2ZPHB 2ZPIB 3EGDB 2CUDA 1WJRA 1Y96B 4ZGDB 1M4ZA 1M1KC 3VJPA 1VQPQ 3M0RA 2VASA 2KROA 3G1JA 2K2VA 4HCCA 4M7DG 3M0TA 5CO7A 3CCUQ 5CQXA 1JJ2S 4KUDK 2KBTA 4E7LA 4PJOG 2GFUA 7AT1B 1BKBA 1VYVA 1X2KA 1OU8A 1UE9A 4PFOA 3P8DA 3TREA 2LC4A 1SSHA 4FSSA 2KYBA 2EVRA 3EFRA 2R5AA 1KG1A 2DNUA 5I2SA 3EH1A 5GMKh 4HT9A 2MWOA 2DETA 5DY9A 2D1XA 1VQ7A 4J9GA 3Q1JA 2NUTB 3MP1A 2K9GA 3QYGB 1TUGB 3PE0A 2E4HA 1QCFA 1KHIA 1X75C 3QO3A 2KE9A 1U3OA 1FX7A 1I0CA 4LUDA 2FYKA 4XK8E 2DMOA 1I07A 3E9FA 3CPWA 2F69A 3GBQA 5D6XA 4AG1C 1O75A 1PNJA 3JCMJ 1IREB 1QWFA 3UA6A 5DLOA 1W2BP 4M7AC 1C1AA 2JM9A 3FRNA 2BE9B 3EG9A 2X35A 1M3AA 2DZCA 2FRWA 2GQVA 2M02A 1UHFA 1VQMA 3CCEA 2DFUA 2AHJB 2OJ2A 3J7AF 4E7SA 3I5RA 3LWIA 1VUBA 2EKOA 5I22A 1KHCA 1HJDA 1G2BA 1FYNA 2GNCA 3ASKA 3AHUA 5KYUB 3THKA 2V8IA 4KUIA 3CCRA 1WHGA 2LMJA 2GQIA 3OYYA 3SB2A 4HXJA 4IUUA 4LDYA 1KC8C 3M0UA 2CSQA 1Q7YU 4BE0A 2ROLA 1LOJA 2P0KA 3CCSQ 2OTLT 1AHJB 2CH4A 1G5VA 2JZ2A 3M0QA 1K76A 4BI3A 1JEGA 4WCIA 1B34B 4E7IA 5FWCA 3EFOA 1D3BB 4N4HA 5GAN5 4J5YA 4MZPA 3EGDA 2A3LA 2DL5A 4OMNA 1VQ4A 3C95A 2DVEA 1ZUUA 2OTJA 2EPDA 2KRMA 2VXFA 1ZLMA 1XNIA 4ELYC 1SHGA 4PJOE 3HFNA 2RF0A 4L6V5 2CZ6B 3CBOA 1YWOA 3OY9A 2KSSA 4JRQA 5FU6C 1KQ1A 2GTJA 1D0ZA 5FWBA 2DTOA 1LNXA 4XTWA 2DD4A 3DB4A 2VB6A 3JCMg 2O31A 4ZN1A 3QYHB 4O6JA 5KYNA 3GOXA 2HQHA 3GNGA 2V1RA 3L2RA 5LJ3f 1QVFA 2KT1A 2QQRA 2KXDA 2D8HA 2ABLA 1WYXA 2PVOB 4FW1A 1MUZA 4R0KA 3VS2A 1YN8A 4IUVA 2MCNA 1E7OA 1YJNA 3OSVA 4EMKB 4CI0C 5KYYB 2CP2A 4C8QD 4JZ4A 2MI6A 2HBWA 2Y4XA 2L8DA 1VQLA 4DEYA 4JUVA 4DOWA 3HTRA 1I5LA 4M77A 4F7UA 2FB7A 4QQGA 4NOYA 3JCMV 4LDXA 3DLLA 2HEQA 1M90C 3UT1A 4PJOA 3KBGA 2FZGB 1SG5A 3EHRA 2DO3A 1GRIA 1GFDA 1HD3A 3JCMQ 2J05A 1GCQC 2ZPEB 3OB9A 3CD6Q 4M7DA 1M27C 3CCJQ
chains in the Genus database with same CATH topology
3O5ZA 3UATA 1T3LA 2I0NA 1JXMA 1ZUKA 2YDLA 2O9VA 2DYBA 2D0NA 1YWPA 2OAWA 3VS0A 1Y57A 1NLPC 3VS4A 1WLPB 3ZL7C 2X3WD 1BU1A 2EGEA 4JJCA 1ZX6A 5FW9A 1GFCA 2KGTA 2OI3A 1GBQA 1X2QA 4J9FA 1ZBJA 1H3HA 4ZNXA 2RMOA 1SEMA 2NWMA 2EGAA 2C0OA 4F14A 1AWJA 2C0TA 4J9BA 2QDLA 1K9AA 1LCKA 3I9QA 2A36A 1GBRA 2ESWA 1W6XA 4JPBW 2RQUA 2HDAA 2AZVA 1PRLC 4M4ZA 3UF4A 3NMZC 1UGVA 4IIOA 2K7AA 1QKWA 2KEAA 2ED1A 2EYYA 3EG0A 4D8KA 2LJ1A 3VS6A 2VVKA 1OOTA 4J9HA 1OPKA 1Z9ZA 5IHKA 1KIKA 2DILA 1M30A 1ABOA 2AKKA 2MOXA 1PKSA 4AFQC 1CKAA 4Z8AA 1WFWA 2EQIA 3SHWA 2RQRA 2HCKA 2LZ6B 1U06A 1V1CA 4E6RA 1UTIA 4JJBA 1UFFA 1OEBA 4QT7A 1RUWA 2M0YA 3PVQA 3EGUA 2KT8A 1MV3A 1M8MA 2VKNA 2CDTA 1XOVA 2DBMA 4LUEA 1JU5C 1SHFA 1UG1A 2RPNA 4KRTA 1Y0MA 2DL3A 2EYZA 3VRZA 2RNAA 2ROTA 3RNJA 1QLYA 2ECZA 2W10A 4RTXA 4CC4B 1GCQA 1ZSGA 2LJ0A 1WDXA 1SRMA 2YSQA 1ZUYA 4AFSC 2JMAA 4LE9A 1AWXA 2A28A 2F2XA 1IO6A 4J9EA 4AG2C 1UHCA 1S1NA 2JMCA 2KXCA 2J06A 1T0JA 3H0FA 2V1QA 2YUPA 4CC7A 2CSIA 2ED0A 2KR3A 1MV0B 1N5ZA 1X43A 1PKTA 1YP5A 4F17A 2J6FA 3I5SA 4OMOA 2FEIA 1ABQA 3UA7A 1UECA 1UDLA 2DBKA 2KRNA 2GGRA 2BTTA 2F2WA 1A0NB 1WXBA 2LCSA 1YCSB 2EYXA 2A08A 2G6FX 1UJ0A 1Z9QA 1BB9A 1WXTA 4RTVA 5IXFA 2J7IA 3EG1A 2BZ8A 3M0SA 2PZ1A 1WA7A 3TVTA 3ULRB 2CUDA 4D8DA 2LJ3A 2FPEA 1VA7A 1K4US 3M0RA 2DRKA 2KROA 2RN8A 2RQVA 2A37A 2LQWA 1AZGB 3M0TA 4RUGA 3FJ5A 2O9SA 1NG2A 3C0CA 1RLQC 2GTOA 2D8JA 3CQTA 3KFVA 2L3QA 1AVZC 1NEBA 2KBTA 1NYGA 2EKHA 2EGCA 1T0HA 2KRSA 4Z89A 2E5KA 2DF6A 2K3BA 1GL5A 1VYVA 1X6GA 2LQNA 1X2KA 1X69A 2YUOA 1UE9A 2AK5A 1GCPA 4Z88A 1SSHA 4FSSA 1YNZA 2FRYA 2KYBA 1M3BA 1SRLA 2EVRA 4RTZA 2DA9A 1B3QA 2DNUA 2K2MA 2DE0X 1JXOA 2D1XA 4J9GA 1H92A 1E6GA 2RQWA 1J3TA 4RTWA 5IHNA 2CH4W 2K9GA 1NEGA 3PE0A 2IIMA 1QCFA 2KE9A 2JTEA 5IH2A 1U3OA 1WIEA 1BK2A 3TSWA 2XMFA 1I0CA 4LUDA 5HCKA 2SRCA 3VS1A 1M3CA 1K0SA 4HVVA 3VS3A 1X27A 2EYWA 2DMOA 1I07A 1OPLA 2JW4A 4J9IA 1UJYA 3GBQA 4AG1C 1EFNA 5L23A 2DM1A 4GBQA 1PNJA 2DVJA 1AWOA 1QWFA 4IIMA 3UA6A 2AZSA 1PRMC 4CC3A 2JM9A 3RBBB 2L3PA 1B07A 1M3AA 1AEYA 1PWTA 2FRWA 4AFUC 1UHFA 4JJDA 2YT6A 4RTUA 2JT4A 3R6NA 3VRYA 4GLMA 3QWXX 2OJ2A 3JV3A 2CT4A 2X3XD 3I5RA 3M0PA 5I22A 4JZ3A 2J6OA 2PNIA 1G2BA 1HJDA 1FYNA 2GNCA 1NYFA 1SPKA 3THKA 4OMMA 2DJQA 1QWEA 4LN2A 2JXBA 1JQQA 2LMJA 2GQIA 2O2OA 5ECAA 1BBZA 1UUEA 2PTKA 4HXJA 3M0UA 2CSQA 2BZYA 3QWYA 1G83A 1I1JA 4J9DA 4EIKA 2VWFA 3TSZA 2ROLA 1TUDA 2DL8A 3NGPA 1CKBA 2FG0A 2SEMA 3I35A 4HCKA 2CH4A 1KSWA 2DLPA 1OV3A 2KYMA 2JM8A 2L2PA 2P4RA 3M0QA 1K76A 1JEGA 4WCIA 1WX6A 1WXUA 2FO0A 2HSPA 5FWCA 2MIOA 1HSQA 2W0ZA 1T3SA 3H41A 1CSKA 5EC7A 2DL5A 2CT3A 4OMNA 4RTTA 1ZUUA 2EW3A 2EPDA 2KRMA 4A63B 1VYTA 2JS0A 4ORZA 1TUCA 1ZLMA 1AOJA 2YUQA 1SHGA 4OMPA 2FPFA 3EG2A 2RQTA 2RF0A 3SEMA 1YWOA 1KJWA 2DL7A 2GTJA 4OMQA 3PVLA 4AFZC 5FWBA 4F16A 3REAB 2NUZA 1KFZA 1TG0A 4RTYA 5I11A 1E6HA 2O31A 4OMLA 2YUNA 1AD5A 5GJVB 2V1RA 1RI9A 4ESRA 3U23A 1NM7A 2KT1A 2L3SA 3NHNA 2KXDA 5IXBA 2D8HA 2ABLA 1NLOC 1WYXA 2H8HA 3EG3A 3H0HA 3EHQA 4K11A 1MUZA 4R0KA 1U5SA 3VS7A 3VS2A 1YN8A 2FPDA 4LNPA 4X1VA 3NPFA 1FMKA 1VYUA 4HVWA 1E7OA 2B86A 2JS2A 3A98A 5IHIA 2MCNA 1AZEA 4J9CA 4JZ4A 1H8KA 2HBWA 1AWWA 2GBQA 1WI7A 3LH5A 2AKLA 2CUBA 4CC2A 1K1ZA 3H0IA 4DEYA 1ARKA 2DRMA 2EBPA 2CREA 2LNHB 4Y92A 3VS5A 5GJWB 1QKXA 2LP5A 2HEQA 2J6KA 1W70A 2K79A 1X6BA 3EHRA 2O88A 2ENMA 4DEXA 2M51A 1JO8A 1K0XA 2K6DA 4HVUA 1GRIA 2LX7A 2F2VA 1HD3A 1GFDA 2J05A 1W1FA 1GCQC 3REBB 2BZXA 1RLPC 3IQLA 1M27C 2DL4A 2L0AA 2KNBB 2C0IA 2DX1A 1PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Z A;  3UAT A;  1T3L A;  2I0N A;  1JXM A;  1ZUK A;  2YDL A;  2O9V A;  2DYB A;  2D0N A;  1YWP A;  2OAW A;  3VS0 A;  1Y57 A;  1NLP C;  3VS4 A;  1WLP B;  3ZL7 C;  2X3W D;  1BU1 A;  2EGE A;  4JJC A;  1ZX6 A;  5FW9 A;  1GFC A;  2KGT A;  2OI3 A;  1GBQ A;  1X2Q A;  4J9F A;  1ZBJ A;  1H3H A;  4ZNX A;  2RMO A;  1SEM A;  2NWM A;  2EGA A;  2C0O A;  4F14 A;  1AWJ A;  2C0T A;  4J9B A;  2QDL A;  1K9A A;  1LCK A;  3I9Q A;  2A36 A;  1GBR A;  2ESW A;  1W6X A;  4JPB W;  2RQU A;  2HDA A;  2AZV A;  1PRL C;  4M4Z A;  3UF4 A;  3NMZ C;  1UGV A;  4IIO A;  2K7A A;  1QKW A;  2KEA A;  2ED1 A;  2EYY A;  3EG0 A;  4D8K A;  2LJ1 A;  3VS6 A;  2VVK A;  1OOT A;  4J9H A;  1OPK A;  1Z9Z A;  5IHK A;  1KIK A;  2DIL A;  1M30 A;  1ABO A;  2AKK A;  2MOX A;  1PKS A;  4AFQ C;  1CKA A;  4Z8A A;  1WFW A;  2EQI A;  3SHW A;  2RQR A;  2HCK A;  2LZ6 B;  1U06 A;  1V1C A;  4E6R A;  1UTI A;  4JJB A;  1UFF A;  1OEB A;  4QT7 A;  1RUW A;  2M0Y A;  3PVQ A;  3EGU A;  2KT8 A;  1MV3 A;  1M8M A;  2VKN A;  2CDT A;  1XOV A;  2DBM A;  4LUE A;  1JU5 C;  1SHF A;  1UG1 A;  2RPN A;  4KRT A;  1Y0M A;  2DL3 A;  2EYZ A;  3VRZ A;  2RNA A;  2ROT A;  3RNJ A;  1QLY A;  2ECZ A;  2W10 A;  4RTX A;  4CC4 B;  1GCQ A;  1ZSG A;  2LJ0 A;  1WDX A;  1SRM A;  2YSQ A;  1ZUY A;  4AFS C;  2JMA A;  4LE9 A;  1AWX A;  2A28 A;  2F2X A;  1IO6 A;  4J9E A;  4AG2 C;  1UHC A;  1S1N A;  2JMC A;  2KXC A;  2J06 A;  1T0J A;  3H0F A;  2V1Q A;  2YUP A;  4CC7 A;  2CSI A;  2ED0 A;  2KR3 A;  1MV0 B;  1N5Z A;  1X43 A;  1PKT A;  1YP5 A;  4F17 A;  2J6F A;  3I5S A;  4OMO A;  2FEI A;  1ABQ A;  3UA7 A;  1UEC A;  1UDL A;  2DBK A;  2KRN A;  2GGR A;  2BTT A;  2F2W A;  1A0N B;  1WXB A;  2LCS A;  1YCS B;  2EYX A;  2A08 A;  2G6F X;  1UJ0 A;  1Z9Q A;  1BB9 A;  1WXT A;  4RTV A;  5IXF A;  2J7I A;  3EG1 A;  2BZ8 A;  3M0S A;  2PZ1 A;  1WA7 A;  3TVT A;  3ULR B;  2CUD A;  4D8D A;  2LJ3 A;  2FPE A;  1VA7 A;  1K4U S;  3M0R A;  2DRK A;  2KRO A;  2RN8 A;  2RQV A;  2A37 A;  2LQW A;  1AZG B;  3M0T A;  4RUG A;  3FJ5 A;  2O9S A;  1NG2 A;  3C0C A;  1RLQ C;  2GTO A;  2D8J A;  3CQT A;  3KFV A;  2L3Q A;  1AVZ C;  1NEB A;  2KBT A;  1NYG A;  2EKH A;  2EGC A;  1T0H A;  2KRS A;  4Z89 A;  2E5K A;  2DF6 A;  2K3B A;  1GL5 A;  1VYV A;  1X6G A;  2LQN A;  1X2K A;  1X69 A;  2YUO A;  1UE9 A;  2AK5 A;  1GCP A;  4Z88 A;  1SSH A;  4FSS A;  1YNZ A;  2FRY A;  2KYB A;  1M3B A;  1SRL A;  2EVR A;  4RTZ A;  2DA9 A;  1B3Q A;  2DNU A;  2K2M A;  2DE0 X;  1JXO A;  2D1X A;  4J9G A;  1H92 A;  1E6G A;  2RQW A;  1J3T A;  4RTW A;  5IHN A;  2CH4 W;  2K9G A;  1NEG A;  3PE0 A;  2IIM A;  1QCF A;  2KE9 A;  2JTE A;  5IH2 A;  1U3O A;  1WIE A;  1BK2 A;  3TSW A;  2XMF A;  1I0C A;  4LUD A;  5HCK A;  2SRC A;  3VS1 A;  1M3C A;  1K0S A;  4HVV A;  3VS3 A;  1X27 A;  2EYW A;  2DMO A;  1I07 A;  1OPL A;  2JW4 A;  4J9I A;  1UJY A;  3GBQ A;  4AG1 C;  1EFN A;  5L23 A;  2DM1 A;  4GBQ A;  1PNJ A;  2DVJ A;  1AWO A;  1QWF A;  4IIM A;  3UA6 A;  2AZS A;  1PRM C;  4CC3 A;  2JM9 A;  3RBB B;  2L3P A;  1B07 A;  1M3A A;  1AEY A;  1PWT A;  2FRW A;  4AFU C;  1UHF A;  4JJD A;  2YT6 A;  4RTU A;  2JT4 A;  3R6N A;  3VRY A;  4GLM A;  3QWX X;  2OJ2 A;  3JV3 A;  2CT4 A;  2X3X D;  3I5R A;  3M0P A;  5I22 A;  4JZ3 A;  2J6O A;  2PNI A;  1G2B A;  1HJD A;  1FYN A;  2GNC A;  1NYF A;  1SPK A;  3THK A;  4OMM A;  2DJQ A;  1QWE A;  4LN2 A;  2JXB A;  1JQQ A;  2LMJ A;  2GQI A;  2O2O A;  5ECA A;  1BBZ A;  1UUE A;  2PTK A;  4HXJ A;  3M0U A;  2CSQ A;  2BZY A;  3QWY A;  1G83 A;  1I1J A;  4J9D A;  4EIK A;  2VWF A;  3TSZ A;  2ROL A;  1TUD A;  2DL8 A;  3NGP A;  1CKB A;  2FG0 A;  2SEM A;  3I35 A;  4HCK A;  2CH4 A;  1KSW A;  2DLP A;  1OV3 A;  2KYM A;  2JM8 A;  2L2P A;  2P4R A;  3M0Q A;  1K76 A;  1JEG A;  4WCI A;  1WX6 A;  1WXU A;  2FO0 A;  2HSP A;  5FWC A;  2MIO A;  1HSQ A;  2W0Z A;  1T3S A;  3H41 A;  1CSK A;  5EC7 A;  2DL5 A;  2CT3 A;  4OMN A;  4RTT A;  1ZUU A;  2EW3 A;  2EPD A;  2KRM A;  4A63 B;  1VYT A;  2JS0 A;  4ORZ A;  1TUC A;  1ZLM A;  1AOJ A;  2YUQ A;  1SHG A;  4OMP A;  2FPF A;  3EG2 A;  2RQT A;  2RF0 A;  3SEM A;  1YWO A;  1KJW A;  2DL7 A;  2GTJ A;  4OMQ A;  3PVL A;  4AFZ C;  5FWB A;  4F16 A;  3REA B;  2NUZ A;  1KFZ A;  1TG0 A;  4RTY A;  5I11 A;  1E6H A;  2O31 A;  4OML A;  2YUN A;  1AD5 A;  5GJV B;  2V1R A;  1RI9 A;  4ESR A;  3U23 A;  1NM7 A;  2KT1 A;  2L3S A;  3NHN A;  2KXD A;  5IXB A;  2D8H A;  2ABL A;  1NLO C;  1WYX A;  2H8H A;  3EG3 A;  3H0H A;  3EHQ A;  4K11 A;  1MUZ A;  4R0K A;  1U5S A;  3VS7 A;  3VS2 A;  1YN8 A;  2FPD A;  4LNP A;  4X1V A;  3NPF A;  1FMK A;  1VYU A;  4HVW A;  1E7O A;  2B86 A;  2JS2 A;  3A98 A;  5IHI A;  2MCN A;  1AZE A;  4J9C A;  4JZ4 A;  1H8K A;  2HBW A;  1AWW A;  2GBQ A;  1WI7 A;  3LH5 A;  2AKL A;  2CUB A;  4CC2 A;  1K1Z A;  3H0I A;  4DEY A;  1ARK A;  2DRM A;  2EBP A;  2CRE A;  2LNH B;  4Y92 A;  3VS5 A;  5GJW B;  1QKX A;  2LP5 A;  2HEQ A;  2J6K A;  1W70 A;  2K79 A;  1X6B A;  3EHR A;  2O88 A;  2ENM A;  4DEX A;  2M51 A;  1JO8 A;  1K0X A;  2K6D A;  4HVU A;  1GRI A;  2LX7 A;  2F2V A;  1HD3 A;  1GFD A;  2J05 A;  1W1F A;  1GCQ C;  3REB B;  2BZX A;  1RLP C;  3IQL A;  1M27 C;  2DL4 A;  2L0A A;  2KNB B;  2C0I A;  2DX1 A;  1PHT A; 
#chains in the Genus database with same CATH topology
 2HL5 C;  1G8X A;  3JAM E;  1EZZ B;  1YJW T;  4E47 A;  2K5F A;  1Y57 A;  1NLP C;  3VS4 A;  2COY A;  1YHQ Q;  1RAD B;  1O9S A;  2EGE A;  4MML A;  1PG5 B;  5J26 A;  2PVG B;  1JRI A;  3CMA Q;  2RK1 A;  3CC7 A;  3GIB A;  2XIC A;  4FU6 A;  5CK9 A;  3OYF A;  1GBQ A;  3MCA B;  4J9F A;  2M0O A;  5CVI A;  5CQY A;  1H3H A;  3TQ7 P;  3JCM P;  1SEM A;  2NWM A;  2YRC A;  2C0O A;  2QTX A;  2QDL A;  3QDR B;  2DIQ A;  1GBR A;  1OI1 A;  3QJ6 A;  5FU7 C;  2AZV A;  1QVP A;  1KC8 R;  4JS5 A;  2E1H A;  3ZEH A;  2HKN A;  1QKW A;  3M53 A;  3CC4 T;  2DER A;  5I21 A;  4TVR A;  4FYV B;  2EYY A;  3EG0 A;  3CBM A;  3QJY A;  4D8K A;  2LJ1 A;  2X4Y A;  1RL2 A;  2EAY A;  2XKO C;  4J9H A;  5IHK A;  1X6O A;  1MNE A;  3SDZ A;  4B6M A;  2H3J A;  3LH0 A;  4C92 C;  1ABO A;  1WFW A;  5LJ5 g;  1G3T A;  4XAX B;  2F1L A;  1KC8 U;  2E41 A;  3DB3 A;  1IGQ A;  4PJL A;  4PJM A;  1U06 A;  3TEE A;  4E6R A;  5DM7 R;  5GAO m;  1UFF A;  4L59 A;  1Y7X A;  1RUW A;  3FEO A;  3OA6 A;  1TS9 A;  3GP8 A;  4BY6 B;  5CKE A;  4L5G A;  4C92 B;  4XU0 A;  5LJ5 h;  4M78 E;  2VKN A;  4M7D B;  2VGM A;  3CD6 T;  3JCM f;  2DBM A;  4LUE A;  3MEW A;  1PSF A;  2MMP A;  1QVF P;  1Y0M A;  3CCU T;  5GAO n;  2RHU A;  3VV0 A;  3MET A;  3VRZ A;  4XTZ A;  2RNA A;  4II1 A;  2XD0 A;  1QQJ A;  1ZSG A;  1Q82 U;  1PD1 A;  4VUB A;  3ME9 A;  2YSQ A;  5AYF A;  2EJF A;  1ZUY A;  2WSE E;  3QG1 A;  3RMQ A;  1VQ8 T;  2M9U A;  2F2X A;  1VQL Q;  4LDW A;  4AG2 C;  5A0D A;  2LT4 A;  1VQ4 T;  2XID A;  3PFS A;  2O01 E;  2V1Q A;  4X9D A;  4JDS A;  4RG8 A;  2CSI A;  1N27 A;  1YJN Q;  1MV0 B;  1VQ8 A;  1PKT A;  1YP5 A;  4YTL A;  4E7J A;  2P0P A;  4JRP A;  4FT4 A;  2RHX A;  2DPP B;  3CCM A;  1VQM Q;  5GAN h;  4BD3 A;  2JUF A;  1S72 T;  2DBK A;  4C0F A;  2KRN A;  4KGX B;  2LCS A;  2RJE A;  2YWW A;  2EYX A;  2A08 A;  1U1T A;  1ZQ1 A;  1BB9 A;  4RTV A;  2J7I A;  3EG1 A;  4PJO F;  4DQ2 A;  1U8R A;  2LQK A;  2OX7 A;  3A5Z B;  1QVF S;  1ZA1 B;  3HRS A;  3TVT A;  2YXY A;  4BE1 A;  1TU0 B;  2LJ3 A;  3WXM B;  1VA7 A;  2DRK A;  2CZ7 B;  4GLK A;  3BDU A;  2DKG A;  2LQW A;  4XTU A;  3MEA A;  4RUG A;  3FJ5 A;  1NG2 A;  1K8A C;  3LX7 A;  2NLU A;  1OX8 A;  2EJG A;  1SF9 A;  3I55 T;  2L3Q A;  1AVZ C;  1YIT Q;  1M1K R;  3OW2 S;  1MMN A;  1T0H A;  2KRS A;  4Z89 A;  2E5K A;  2KK4 A;  1GL5 A;  1BIA A;  3MHX A;  1OZ2 A;  1JBM A;  2QGG A;  2E6N A;  3HP9 A;  4BI4 A;  3V7R A;  1SRL A;  4RMO A;  4FCY A;  3G4S Q;  2DA9 A;  2K2M A;  4M77 C;  1X01 A;  4HCZ A;  3RIR A;  1D0X A;  4BE2 A;  4QKU A;  3A8M B;  3MP6 A;  1KQ2 A;  1H92 A;  1E6G A;  4PK4 A;  4RTW A;  5IHN A;  2JVV A;  1NEG A;  1WZO A;  1YIJ T;  3AT1 B;  2IIM A;  3X20 B;  4OVA A;  4RCB A;  1VQ7 Q;  3QUI A;  1IRX A;  5IH2 A;  3J81 E;  1YJW Q;  3G6E T;  4C8Q F;  1G3W A;  5LJ5 e;  3CCJ T;  4HVV A;  2YLC A;  5A0G A;  1X27 A;  2EYW A;  5GAN f;  4PJO B;  1Q86 R;  2DAQ A;  4XTV A;  3JB9 I;  4KH0 B;  2BE7 D;  2K4Y A;  2DVJ A;  2RI3 A;  3PMT A;  4HA8 A;  2DXT A;  4JJN K;  3OW2 P;  3RBB B;  2L3P A;  1TSF A;  5KYY A;  2XI9 A;  4XTX A;  4ME7 A;  2GF7 A;  1KQS A;  5FLX E;  4JJD A;  1LPL A;  1MND A;  2YT6 A;  4RTU A;  4OB2 B;  2RB6 A;  3E1S A;  3A8L B;  1BI2 A;  1TH7 A;  3R6N A;  3VRY A;  4GLM A;  3M55 A;  3FC3 A;  3V7C A;  2CT4 A;  1W2B A;  2PNI A;  1NYF A;  3CC2 A;  2RJD A;  2X4J A;  4BB7 A;  3G4S T;  4N4I A;  4OMM A;  2CYZ B;  3QZ5 B;  2JXB A;  3P8H A;  4N4G A;  5KYX A;  1BBZ A;  2QTV A;  2P0Q A;  1PD0 A;  3H8Z A;  2BUD A;  4PL6 A;  3MKD A;  1SSF A;  2FVU A;  4JS4 A;  1PCX A;  2MF2 A;  1OV3 A;  5CCA A;  3V7S A;  3CCL A;  3RMS A;  1HSQ A;  2W0Z A;  1T3S A;  1D3B A;  4JLI A;  5C0M A;  1QCN A;  2K3Y A;  4MZT A;  2CT3 A;  4RTT A;  1YJW A;  3NFC A;  5FU6 B;  3OS5 A;  4C92 D;  4J7F A;  2FZC B;  4M7D D;  4QVC A;  3OYJ A;  2OTJ T;  2GCX A;  1NBE B;  3QII A;  3PNW C;  3OS2 A;  3QHS A;  2D9T A;  1KJW A;  1K8A U;  4D6W A;  2RHI A;  4OMQ A;  1C6V X;  4OB0 B;  5M9O A;  3CCS A;  2A0F B;  2HBP A;  3REA B;  1JJ2 P;  2XDD A;  1RAA B;  4M75 G;  2NUZ A;  3D7S B;  1VQ5 A;  5KYU A;  2X51 A;  4RTY A;  1E6H A;  1M8V A;  1RAB B;  3MP8 A;  4M77 E;  4F7U E;  2DTI A;  4XQ3 A;  1KK7 A;  3CCV Q;  2HSE B;  2LT1 A;  1RI9 A;  4C8Q A;  2DJZ A;  4MDW A;  2E5Q A;  1R8O B;  2ZPB B;  5IXB A;  5GAO r;  4K11 A;  3EHQ A;  5HK3 A;  4NL3 A;  3VS7 A;  3O8V A;  2FPD A;  2FHD A;  3QDF A;  4KBM B;  3CC2 T;  1FMK A;  1VYU A;  4C0D B;  2WAC A;  3A98 A;  4E7Z A;  2CP3 A;  5IN1 A;  4OGE A;  1YBY A;  1BCM A;  4EMH A;  2ZPG B;  3ZBD A;  1AWW A;  1WI7 A;  5GAM h;  2RHY A;  4CC2 A;  3H0I A;  1QW1 A;  2LNH B;  5KH6 A;  1QKX A;  1BCO A;  5KCH A;  3PTA A;  3FJP A;  4M77 G;  3ZFJ A;  4F7U G;  1X6B A;  2O88 A;  1QVG A;  2M51 A;  1JO8 A;  5GAN d;  1M2O A;  1R0C B;  1RAH B;  4M78 F;  2K3X A;  3REB B;  2BZX A;  4XTY A;  1RLP C;  2L0A A;  1QP3 A;  2KNB B;  3FDR A;  3LGF A;  1TWB A;  1K73 R;  2C0I A;  3RER A;  2DX1 A;  4OP0 A;  5C6S A;  1PHT A;  2K57 A;  2YRV A;  1UEB A;  4BDY A;  1WJQ A;  1Q7Y R;  1IXD A;  3VYG A;  4J6Y A;  1T3L A;  1JXM A;  1Y71 A;  4IUQ A;  4Y28 E;  2O9V A;  3OYK A;  2XK0 A;  2OAW A;  3H9N A;  3VS0 A;  3CCQ Q;  3G6E A;  1WHL A;  1IGU A;  4OB1 B;  1ZX6 A;  4M78 D;  4FL6 A;  2AIR B;  1GFC A;  2RM4 A;  2KGT A;  1X2Q A;  5FRO A;  4FSX A;  4ZNX A;  2RMO A;  1YJ9 A;  4NS5 A;  2JN0 A;  1K9A A;  1TTH B;  2PQW A;  1W6X A;  1M1K U;  1B7T A;  1NJI C;  1PRL C;  2DZ9 A;  2RO0 A;  3CCQ T;  5A2Q E;  2KEA A;  3L2W A;  3VS6 A;  3L2Q A;  2VVK A;  3VUB A;  3OS1 A;  1KIK A;  3RES A;  1VQP T;  2DIL A;  2AKK A;  2MOX A;  1PKS A;  4Z8A A;  1OZ3 A;  3HSB A;  1AT1 B;  3HHT B;  4E7H A;  4P5N A;  3SHW A;  2WSC E;  1M90 R;  2NYS A;  1UTI A;  4JJB A;  1OEB A;  1VQK Q;  2VGN A;  4ZTJ A;  3G4S A;  1UGQ B;  3NTH A;  3OS0 A;  1YJ9 Q;  3URG A;  1XOV A;  1W4S A;  2PU9 B;  4PJO C;  1M2V B;  4PLL A;  1SHF A;  1VQ5 T;  1UG1 A;  2QEX Q;  1ZHI A;  2QI2 A;  4ELZ C;  3FIF A;  2EYZ A;  3JB9 D;  1KD1 C;  5GAM e;  2RI2 A;  3SFM A;  2GFA A;  3OBW A;  2ECZ A;  2W10 A;  1VQ6 Q;  4RTX A;  2RD1 A;  2LJ0 A;  3OW2 A;  1EIF A;  5GAN 2;  3CCR Q;  2R5M A;  3RKX A;  2LX9 A;  4LE9 A;  2A28 A;  1IO6 A;  1S1N A;  2KXC A;  1T0J A;  1PSE A;  2WSF E;  2YUP A;  4CC7 A;  2ED0 A;  2KR3 A;  2R57 A;  2COW A;  2HNI A;  1N5Z A;  3RUX A;  2DIG A;  5CKH A;  1PM3 A;  3I5S A;  4EMG A;  5J3B A;  2JJ9 A;  4C8Q B;  3UA7 A;  4M7A A;  2BTT A;  4Z02 A;  1A0N B;  5KYX B;  1G3Y A;  2RJF A;  2BKD N;  2G6F X;  5IXF A;  2BZ8 A;  3OYH A;  2PZ1 A;  4DBR A;  3JCM W;  2LCC A;  2CZ0 B;  1D09 B;  2FPE A;  1K4U S;  2V26 A;  2A7Y A;  3S3M A;  2RQV A;  4PFZ A;  1UGP B;  1ACM B;  4BUG A;  4DOV A;  2EQM A;  2EQJ A;  3CC2 Q;  3C0C A;  1UB4 A;  3JCM X;  3F70 A;  1JB0 E;  2XG8 D;  2D8J A;  3CQT A;  3CME Q;  2X4W A;  2XHC A;  1FXX A;  2F5K A;  3H6Z A;  4QVD A;  3DKM A;  5GMK j;  3OMG A;  2DF6 A;  2CZ1 B;  3FB9 A;  2RH2 A;  4LD9 K;  2I2L A;  1GCP A;  4Z88 A;  5GAN 3;  5GMK m;  4F04 B;  2FRY A;  4ATO A;  4RTZ A;  1B3Q A;  4XU2 A;  1YJ9 T;  2LNV A;  2OAU A;  4DBH A;  3E2U A;  2DXU A;  3JRZ A;  3L2V A;  1JXO A;  2QYZ A;  4FT2 A;  1R77 A;  2RQW A;  4J8O A;  3CC7 Q;  2CH4 W;  1YI2 Q;  4IUR A;  1Q7Y C;  4A54 A;  5KE3 A;  1WIE A;  3JCM b;  5LJ3 h;  4GY5 A;  1I8F A;  3TSW A;  2XMF A;  4C8Q G;  1WQ7 A;  4KGV B;  2R58 A;  1M3C A;  5HK0 A;  3CCU A;  1OPL A;  2E3H A;  4J9I A;  1Q82 R;  4MDX A;  1NJI R;  4LD6 A;  4M75 A;  2PUO B;  4GBQ A;  1AWO A;  4QVZ A;  4IIM A;  4OGC A;  2AZS A;  3MEV A;  3G7Z A;  1PRM C;  2JTM A;  5GMK i;  1MGQ A;  2HL3 A;  1B07 A;  4DBF A;  2CKK A;  3CCM Q;  2B8A A;  1NPP A;  3BFM A;  1UGR B;  3QZ9 B;  3JB9 J;  4HKE A;  4ZGJ B;  1I81 A;  3G71 T;  5I2M A;  4E2F B;  4PNO A;  1QP2 A;  2JT4 A;  2CP5 A;  5GAM g;  3CCQ A;  4AMC A;  3RKY A;  3JV3 A;  3WVE B;  2ZAE A;  2X3X D;  3M57 A;  1QVG P;  2DXC A;  2OTL A;  3M0P A;  5LJ5 d;  1NPR A;  3X24 B;  2EYQ A;  1GXI E;  5GAM f;  3M59 A;  4V2S A;  5KE2 A;  2DJQ A;  2L89 A;  1QWE A;  4MMK A;  3G71 Q;  1H3Z A;  4LN2 A;  4C5G A;  4EMK A;  2FL7 A;  1IHW A;  2O2O A;  1VQN Q;  1UUE A;  2PTK A;  3JCM d;  3HRU A;  3QWY A;  1XJW B;  4J9D A;  3PIP A;  4EIK A;  1YIT T;  2CP0 A;  1CKB A;  3RKW A;  2DLP A;  1Q86 U;  2ZPF B;  2P4R A;  4EPC A;  1WX6 A;  1Q81 C;  1BI3 A;  2MIO A;  4A4F A;  1H64 1;  1OQK A;  3JSC A;  1CSK A;  2YHT A;  3OYN A;  2IVW A;  3DLM A;  2E3I A;  1VYT A;  4R55 A;  2EQK A;  1AOJ A;  2YUQ A;  4OMP A;  2FPF A;  4FW2 A;  4KGZ B;  1Q81 U;  2NUT A;  1VQ7 T;  3EG2 A;  2RQT A;  3CXC S;  5GAN 6;  3SEM A;  5KYW B;  1WJS A;  1DJ7 B;  2ZCF B;  2QEX T;  2V8K A;  1S72 Q;  4M77 B;  4F7U B;  3LWH A;  4AFZ C;  4WTO B;  1RAC B;  3I55 A;  1OYX A;  1KFZ A;  1RI0 A;  4A4G A;  1ZBX A;  3CME A;  5I11 A;  3CXC A;  2ZGW A;  2DEQ A;  1VIF A;  1VQL T;  3OMC A;  5DLQ E;  2YRD A;  2L3S A;  3NHN A;  3OSS C;  3EG3 A;  3GNF B;  1U5S A;  1BI1 A;  4LNP A;  2VV5 A;  3PMI A;  4X1V A;  3NPF A;  2XDB A;  3E9G A;  4JLG A;  4HVW A;  2JS2 A;  2LVM A;  4OB3 B;  2DYI A;  3MO8 A;  3JCM c;  3C12 A;  3CBP A;  2M1H A;  4NL2 A;  3UPU A;  4J9C A;  1YI2 A;  2PUK B;  1H8K A;  2GBQ A;  1RAI B;  3LH5 A;  2AKL A;  3OYA A;  2DRM A;  4RKU E;  3CCE T;  5FRM A;  2KY9 A;  3INZ A;  5GAO q;  3R6O A;  1FMW A;  1WHJ A;  2J6K A;  1W70 A;  2MK5 A;  2K79 A;  2QQA A;  4KUL A;  2DK3 A;  4ZN3 A;  4HVU A;  2LX7 A;  3CCS T;  1LJO A;  1W1F A;  2RI5 A;  4C0G A;  4PLI A;  2L3R A;  4M7A F;  4M75 D;  1Y07 A;  4ANJ A;  3IQL A;  2VXE A;  4C92 F;  3MEU A;  2XU8 A;  4A4E A;  1VQK T;  3O5Z A;  1VQ9 A;  3UAT A;  3X26 B;  1QMC A;  2YDL A;  2DYB A;  1N8R U;  2COZ A;  3BW1 A;  1WLP B;  3ZL7 C;  3S3O A;  2X3W D;  3CPF A;  2ZZD A;  3L2Z A;  3JB9 G;  4IUT A;  4JJC A;  4M7A D;  5FW9 A;  1YIJ A;  1OU9 A;  1K9M R;  2QK0 A;  4QW2 A;  2OI3 A;  5D7U A;  2E70 A;  2NUP B;  4FM4 B;  3OYB A;  5D6Y A;  4M77 F;  4F7U F;  2CP7 A;  3J80 E;  1N9S A;  1QCO A;  4F14 A;  2C0T A;  1D1C A;  3I9Q A;  2JOY A;  2ESW A;  1MMD A;  4M78 G;  1ZSZ A;  2RQU A;  3GF5 A;  1RAG B;  2HDA A;  3NMZ C;  1UGV A;  2CS7 A;  2QAZ A;  4IIO A;  2X4X A;  2CP6 A;  2JTF A;  2K7A A;  2MWP A;  3C4S A;  3SWN A;  2E10 A;  5LJ3 j;  4M7D E;  2ED1 A;  5GAN j;  3G6E Q;  2NUP A;  3L42 A;  1KQS P;  2HZY A;  1Z9Z A;  1M30 A;  1YI2 T;  1XQH A;  1CKA A;  3CD6 A;  1N6A A;  2EQI A;  5IT9 E;  4X34 A;  3RR6 A;  2HCK A;  2LZ6 B;  4Q5W A;  3L2U A;  2KDS A;  2F5T X;  4M75 B;  1V1C A;  1OUL A;  2HD0 A;  3CEY A;  3CCL Q;  4X9C A;  2M0Y A;  1IZ6 A;  1WQW A;  3N5B B;  3SD4 A;  5LJ3 e;  1D1A A;  3A1P A;  1VIE A;  2KT8 A;  4JRI A;  1MV3 A;  2LTO A;  1M8M A;  3M9Q A;  4MZM A;  1YHQ A;  3L1A A;  5GAM j;  2DTH A;  3CME T;  2KI7 A;  5GAO l;  4IKF A;  4KRT A;  5CR2 A;  2DL3 A;  1WHM A;  1G3S A;  4M7A B;  1R0B G;  3NTI A;  4BY6 C;  4C8Q E;  5GAN 7;  1K8A R;  2QA4 Q;  3V8L A;  1VQO A;  1N8R C;  3ER0 A;  4AFS C;  2MAM A;  2JMA A;  5LJ3 d;  4J9E A;  1UHC A;  1QVG S;  3SWN C;  3KUF A;  3H0F A;  3PGG A;  3OQ5 A;  2OTL Q;  3NTK A;  1X43 A;  2V8J A;  5A0L A;  5GAN 8;  8ATC B;  2CGH A;  4OMO A;  1EX4 A;  5CAI A;  3BE3 A;  1UEC A;  1UDL A;  3JB9 H;  4M78 A;  3EH2 A;  2KVQ G;  1Z9Q A;  1WXT A;  5IAY A;  1LVK A;  1VQ8 Q;  3M0S A;  3PT9 A;  4FYY B;  1VQ9 Q;  3CCR T;  6AT1 B;  1WA7 A;  1F1B B;  4C8Q C;  2L5Q A;  3HL8 A;  1YJN T;  3ULR B;  4D8D A;  5GAN 4;  3TU4 K;  1NJI U;  2EIF A;  5KYW A;  2RN8 A;  2A37 A;  1ZSZ B;  4M7D F;  1S72 A;  1AZG B;  5J39 A;  2O9S A;  1RLQ C;  2GTO A;  4J7I A;  1VQ5 Q;  3LLR A;  3KFV A;  4KH1 B;  4CRI A;  1NEB A;  1NZ9 A;  1BYM A;  1NYG A;  4FIB A;  3CC4 A;  2EKH A;  2EGC A;  1RAF B;  4WF2 A;  1WNL A;  2QEX A;  3E19 A;  2RJC A;  2K3B A;  2QG9 B;  3EFO B;  3CCV T;  1X6G A;  2LQN A;  1D1B A;  1X69 A;  2YUO A;  2MYS A;  2AK5 A;  1HXD A;  3TCJ A;  1YNZ A;  2D0Q B;  4C0D C;  1M3B A;  1M90 U;  1U1S A;  3HFO A;  4M75 E;  3S6W A;  5GAM d;  1WPY A;  2DE0 X;  4IUP A;  1J3T A;  5CIU A;  3X28 B;  2P84 A;  5KCO A;  3OYM A;  2HQE A;  4C92 G;  5GAN e;  2JTE A;  2OTJ Q;  4DA4 A;  2EQU A;  1YCY A;  1V29 B;  2Z0W A;  2QGF B;  1BK2 A;  4A53 A;  2H3E B;  2DXB A;  1YIJ Q;  5HCK A;  2SRC A;  3VS1 A;  3OYG A;  2K5L A;  1K0S A;  3CPW S;  3VS3 A;  2O4X B;  5CKF A;  1VQ6 T;  2E65 A;  2JW4 A;  1UJY A;  9ATC B;  1EFN A;  5L23 A;  3A8G B;  2DM1 A;  3T9N A;  3CC4 Q;  1KD1 R;  4M78 C;  4CC3 A;  4RCC A;  2MPX C;  1AEY A;  1UGS B;  1PWT A;  3CCV A;  4M75 C;  2YLB A;  3P8B B;  3I55 Q;  4AFU C;  4O5V A;  3OYI A;  5CKB A;  1Q81 R;  1TXQ A;  2EFI A;  1I5O B;  3QWX X;  1KD1 U;  4PJJ A;  4XU1 A;  1TOV A;  2QQ9 A;  5L8R E;  3EFS A;  1NE8 A;  5GMK e;  1Q82 C;  4JZ3 A;  2J6O A;  4A4H A;  1P92 A;  1JJ2 A;  5HKC A;  1SPK A;  4OMF B;  1YFN A;  4QQD A;  1K73 C;  1JQQ A;  3BDL A;  5ECA A;  5GAO p;  2QQS A;  1VQ6 A;  2E64 A;  3QBY A;  1N8R R;  2BZY A;  2HAX A;  5LJ5 j;  1G83 A;  1I1J A;  2VWF A;  3EGX A;  3TSZ A;  3SWN B;  1TUD A;  2DL8 A;  3EAE A;  2IG0 A;  3NGP A;  2FG0 A;  2SEM A;  3I35 A;  4HCK A;  3VYH B;  1KSW A;  3M5A A;  2KYM A;  2JM8 A;  3QKJ A;  2L2P A;  4ZGE B;  2E12 A;  2KMT A;  1WXU A;  1VQ4 Q;  2FO0 A;  1VQO Q;  2HSP A;  3GLX A;  4PJO D;  3H41 A;  2E6Z A;  3A8O B;  1M1F A;  5EC7 A;  2M16 A;  2EW3 A;  2BIV A;  1M9S A;  4N0A C;  2JS0 A;  4ORZ A;  4A63 B;  4C92 E;  1VQ9 T;  1VQK A;  4A4K A;  3OYC A;  1TUC A;  3PIO A;  3UDC A;  2LCL A;  3M56 A;  1VQO T;  2DD5 A;  4R56 A;  3HKS A;  2DL7 A;  4C5H A;  3VKI A;  4QQ6 A;  2Y90 A;  3PVL A;  4F16 A;  4RG2 A;  3KXT A;  2D6F A;  1TG0 A;  1M5Q 1;  1ZSZ C;  2AT1 B;  2KAF A;  4B9X A;  3A8H B;  4BAC A;  1VQN T;  2DEU A;  3QPH A;  2HMA A;  4OML A;  1MHN A;  2YUN A;  4ZTF A;  1WHK A;  1AD5 A;  5GJV B;  1VQM T;  3JB9 F;  4LDV A;  4ESR A;  3QXE B;  4EMK C;  3U23 A;  1NM7 A;  5LJ3 g;  3S3N A;  5LJ5 f;  2X9H A;  2K5I A;  2H8H A;  1NLO C;  3H0H A;  3WVD B;  4AT1 B;  1AZE A;  2B86 A;  5FRN A;  5IHI A;  3CXC P;  5GMK l;  3M4G A;  4EDU A;  4C0Z A;  1VQP A;  3EG9 B;  2CUB A;  2RA2 A;  4LDU A;  1K1Z A;  1ARK A;  2EBP A;  3LGL A;  2CRE A;  4Y92 A;  3VS5 A;  5GJW B;  2QDY B;  4C92 A;  3G71 A;  2LP5 A;  3CCM T;  1RAE B;  4HCB A;  4JRK A;  2ENM A;  1VOM A;  4DEX A;  4J6W A;  1K0X A;  2K6D A;  2F2V A;  1M2V A;  1I4K 1;  2IPO B;  3M58 A;  2G3R A;  3V8J A;  1W2B S;  4BI8 B;  2DL4 A;  5GAN g;  5HY6 A;  1WGS A;  3HPW A;  3JCM e;  3M54 A;  2FZK B;  2I0N A;  1ZUK A;  3VU3 C;  2D0N A;  1YWP A;  3RDV A;  1BIB A;  1YIT A;  1KQS S;  3CMA A;  2VYT A;  8AT1 B;  3CC7 T;  3LW5 E;  1MMG A;  5CKD A;  3OYD A;  1BU1 A;  2C06 A;  4C5I A;  3X25 B;  2O4X A;  4J6X A;  4FYW B;  1IHV A;  1HK9 A;  5FU7 B;  1ZBJ A;  1K9M C;  2EJ9 A;  3QSU A;  3GPL A;  2EGA A;  1FMV A;  2KQW A;  1AWJ A;  4J9B A;  4HT8 A;  1LCK A;  4XU3 A;  1B34 A;  2A36 A;  4JPB W;  4M7A G;  4M4Z A;  3UF4 A;  1M1G A;  1K9M U;  5D6W A;  1XTD A;  1IB8 A;  1Y96 A;  4C5E A;  3V8K A;  1Q86 C;  4LXC A;  2LDM A;  1OOT A;  1OPK A;  1PC0 A;  2HKQ B;  4KT0 E;  1YHQ T;  4AFQ C;  1MMA A;  1K73 U;  4Y91 A;  1OX9 A;  5AT1 B;  2RQR A;  1FWZ A;  3UWN A;  4QT7 A;  3LYI A;  3OYL A;  3CPW P;  3PVQ A;  5LL6 S;  2VUB A;  1C0M A;  3EGU A;  3OBY A;  3VUZ A;  2P4T A;  4M7A E;  4M75 F;  3CCJ A;  2QXF A;  3I56 A;  2CDT A;  3CCE Q;  1ZA2 B;  4PFP A;  1VQN A;  1JU5 C;  1Q95 G;  4FYX B;  3MPU B;  4PKC C;  3MJX A;  2RPN A;  4BDZ A;  4M77 D;  3M4Y A;  3HRT A;  4M78 B;  2Y4Y A;  3CMA T;  2ROT A;  4M7D C;  2HQX A;  4B9W A;  2LQ8 A;  3RNJ A;  1QLY A;  4CC4 B;  4DBQ A;  1GCQ A;  3BY7 A;  1WDX A;  2RK2 A;  1SRM A;  2QQB A;  2QA4 T;  2QA4 A;  1V76 A;  1AWX A;  2JNG A;  4J83 A;  2JMC A;  2J06 A;  2PVD B;  2QAS A;  2LRQ A;  2VC8 A;  1N9R A;  3FLG A;  3C94 A;  2XDP A;  2EWN A;  1WHH A;  4F17 A;  2J6F A;  4PJN A;  4N0A A;  2RHZ A;  3JCM h;  3EGX B;  4E7K A;  1BI0 A;  2FEI A;  3OYE A;  1ABQ A;  3I56 Q;  2GGR A;  3I56 T;  2F2W A;  3CCL T;  1WXB A;  1YCS B;  1UJ0 A;  4UC4 A;  1D0Y A;  5EG2 A;  2ATC B;  1HYO A;  4OF1 A;  1SKU B;  2ZPH B;  2ZPI B;  3EGD B;  2CUD A;  1WJR A;  1Y96 B;  4ZGD B;  1M4Z A;  1M1K C;  3VJP A;  1VQP Q;  3M0R A;  2VAS A;  2KRO A;  3G1J A;  2K2V A;  4HCC A;  4M7D G;  3M0T A;  5CO7 A;  3CCU Q;  5CQX A;  1JJ2 S;  4KUD K;  2KBT A;  4E7L A;  4PJO G;  2GFU A;  7AT1 B;  1BKB A;  1VYV A;  1X2K A;  1OU8 A;  1UE9 A;  4PFO A;  3P8D A;  3TRE A;  2LC4 A;  1SSH A;  4FSS A;  2KYB A;  2EVR A;  3EFR A;  2R5A A;  1KG1 A;  2DNU A;  5I2S A;  3EH1 A;  5GMK h;  4HT9 A;  2MWO A;  2DET A;  5DY9 A;  2D1X A;  1VQ7 A;  4J9G A;  3Q1J A;  2NUT B;  3MP1 A;  2K9G A;  3QYG B;  1TUG B;  3PE0 A;  2E4H A;  1QCF A;  1KHI A;  1X75 C;  3QO3 A;  2KE9 A;  1U3O A;  1FX7 A;  1I0C A;  4LUD A;  2FYK A;  4XK8 E;  2DMO A;  1I07 A;  3E9F A;  3CPW A;  2F69 A;  3GBQ A;  5D6X A;  4AG1 C;  1O75 A;  1PNJ A;  3JCM J;  1IRE B;  1QWF A;  3UA6 A;  5DLO A;  1W2B P;  4M7A C;  1C1A A;  2JM9 A;  3FRN A;  2BE9 B;  3EG9 A;  2X35 A;  1M3A A;  2DZC A;  2FRW A;  2GQV A;  2M02 A;  1UHF A;  1VQM A;  3CCE A;  2DFU A;  2AHJ B;  2OJ2 A;  3J7A F;  4E7S A;  3I5R A;  3LWI A;  1VUB A;  2EKO A;  5I22 A;  1KHC A;  1HJD A;  1G2B A;  1FYN A;  2GNC A;  3ASK A;  3AHU A;  5KYU B;  3THK A;  2V8I A;  4KUI A;  3CCR A;  1WHG A;  2LMJ A;  2GQI A;  3OYY A;  3SB2 A;  4HXJ A;  4IUU A;  4LDY A;  1KC8 C;  3M0U A;  2CSQ A;  1Q7Y U;  4BE0 A;  2ROL A;  1LOJ A;  2P0K A;  3CCS Q;  2OTL T;  1AHJ B;  2CH4 A;  1G5V A;  2JZ2 A;  3M0Q A;  1K76 A;  4BI3 A;  1JEG A;  4WCI A;  1B34 B;  4E7I A;  5FWC A;  3EFO A;  1D3B B;  4N4H A;  5GAN 5;  4J5Y A;  4MZP A;  3EGD A;  2A3L A;  2DL5 A;  4OMN A;  1VQ4 A;  3C95 A;  2DVE A;  1ZUU A;  2OTJ A;  2EPD A;  2KRM A;  2VXF A;  1ZLM A;  1XNI A;  4ELY C;  1SHG A;  4PJO E;  3HFN A;  2RF0 A;  4L6V 5;  2CZ6 B;  3CBO A;  1YWO A;  3OY9 A;  2KSS A;  4JRQ A;  5FU6 C;  1KQ1 A;  2GTJ A;  1D0Z A;  5FWB A;  2DTO A;  1LNX A;  4XTW A;  2DD4 A;  3DB4 A;  2VB6 A;  3JCM g;  2O31 A;  4ZN1 A;  3QYH B;  4O6J A;  5KYN A;  3GOX A;  2HQH A;  3GNG A;  2V1R A;  3L2R A;  5LJ3 f;  1QVF A;  2KT1 A;  2QQR A;  2KXD A;  2D8H A;  2ABL A;  1WYX A;  2PVO B;  4FW1 A;  1MUZ A;  4R0K A;  3VS2 A;  1YN8 A;  4IUV A;  2MCN A;  1E7O A;  1YJN A;  3OSV A;  4EMK B;  4CI0 C;  5KYY B;  2CP2 A;  4C8Q D;  4JZ4 A;  2MI6 A;  2HBW A;  2Y4X A;  2L8D A;  1VQL A;  4DEY A;  4JUV A;  4DOW A;  3HTR A;  1I5L A;  4M77 A;  4F7U A;  2FB7 A;  4QQG A;  4NOY A;  3JCM V;  4LDX A;  3DLL A;  2HEQ A;  1M90 C;  3UT1 A;  4PJO A;  3KBG A;  2FZG B;  1SG5 A;  3EHR A;  2DO3 A;  1GRI A;  1GFD A;  1HD3 A;  3JCM Q;  2J05 A;  1GCQ C;  2ZPE B;  3OB9 A;  3CD6 Q;  4M7D A;  1M27 C;  3CCJ Q; 
#chains in the Genus database with same CATH homology
 3O5Z A;  3UAT A;  1T3L A;  2I0N A;  1JXM A;  1ZUK A;  2YDL A;  2O9V A;  2DYB A;  2D0N A;  1YWP A;  2OAW A;  3VS0 A;  1Y57 A;  1NLP C;  3VS4 A;  1WLP B;  3ZL7 C;  2X3W D;  1BU1 A;  2EGE A;  4JJC A;  1ZX6 A;  5FW9 A;  1GFC A;  2KGT A;  2OI3 A;  1GBQ A;  1X2Q A;  4J9F A;  1ZBJ A;  1H3H A;  4ZNX A;  2RMO A;  1SEM A;  2NWM A;  2EGA A;  2C0O A;  4F14 A;  1AWJ A;  2C0T A;  4J9B A;  2QDL A;  1K9A A;  1LCK A;  3I9Q A;  2A36 A;  1GBR A;  2ESW A;  1W6X A;  4JPB W;  2RQU A;  2HDA A;  2AZV A;  1PRL C;  4M4Z A;  3UF4 A;  3NMZ C;  1UGV A;  4IIO A;  2K7A A;  1QKW A;  2KEA A;  2ED1 A;  2EYY A;  3EG0 A;  4D8K A;  2LJ1 A;  3VS6 A;  2VVK A;  1OOT A;  4J9H A;  1OPK A;  1Z9Z A;  5IHK A;  1KIK A;  2DIL A;  1M30 A;  1ABO A;  2AKK A;  2MOX A;  1PKS A;  4AFQ C;  1CKA A;  4Z8A A;  1WFW A;  2EQI A;  3SHW A;  2RQR A;  2HCK A;  2LZ6 B;  1U06 A;  1V1C A;  4E6R A;  1UTI A;  4JJB A;  1UFF A;  1OEB A;  4QT7 A;  1RUW A;  2M0Y A;  3PVQ A;  3EGU A;  2KT8 A;  1MV3 A;  1M8M A;  2VKN A;  2CDT A;  1XOV A;  2DBM A;  4LUE A;  1JU5 C;  1SHF A;  1UG1 A;  2RPN A;  4KRT A;  1Y0M A;  2DL3 A;  2EYZ A;  3VRZ A;  2RNA A;  2ROT A;  3RNJ A;  1QLY A;  2ECZ A;  2W10 A;  4RTX A;  4CC4 B;  1GCQ A;  1ZSG A;  2LJ0 A;  1WDX A;  1SRM A;  2YSQ A;  1ZUY A;  4AFS C;  2JMA A;  4LE9 A;  1AWX A;  2A28 A;  2F2X A;  1IO6 A;  4J9E A;  4AG2 C;  1UHC A;  1S1N A;  2JMC A;  2KXC A;  2J06 A;  1T0J A;  3H0F A;  2V1Q A;  2YUP A;  4CC7 A;  2CSI A;  2ED0 A;  2KR3 A;  1MV0 B;  1N5Z A;  1X43 A;  1PKT A;  1YP5 A;  4F17 A;  2J6F A;  3I5S A;  4OMO A;  2FEI A;  1ABQ A;  3UA7 A;  1UEC A;  1UDL A;  2DBK A;  2KRN A;  2GGR A;  2BTT A;  2F2W A;  1A0N B;  1WXB A;  2LCS A;  1YCS B;  2EYX A;  2A08 A;  2G6F X;  1UJ0 A;  1Z9Q A;  1BB9 A;  1WXT A;  4RTV A;  5IXF A;  2J7I A;  3EG1 A;  2BZ8 A;  3M0S A;  2PZ1 A;  1WA7 A;  3TVT A;  3ULR B;  2CUD A;  4D8D A;  2LJ3 A;  2FPE A;  1VA7 A;  1K4U S;  3M0R A;  2DRK A;  2KRO A;  2RN8 A;  2RQV A;  2A37 A;  2LQW A;  1AZG B;  3M0T A;  4RUG A;  3FJ5 A;  2O9S A;  1NG2 A;  3C0C A;  1RLQ C;  2GTO A;  2D8J A;  3CQT A;  3KFV A;  2L3Q A;  1AVZ C;  1NEB A;  2KBT A;  1NYG A;  2EKH A;  2EGC A;  1T0H A;  2KRS A;  4Z89 A;  2E5K A;  2DF6 A;  2K3B A;  1GL5 A;  1VYV A;  1X6G A;  2LQN A;  1X2K A;  1X69 A;  2YUO A;  1UE9 A;  2AK5 A;  1GCP A;  4Z88 A;  1SSH A;  4FSS A;  1YNZ A;  2FRY A;  2KYB A;  1M3B A;  1SRL A;  2EVR A;  4RTZ A;  2DA9 A;  1B3Q A;  2DNU A;  2K2M A;  2DE0 X;  1JXO A;  2D1X A;  4J9G A;  1H92 A;  1E6G A;  2RQW A;  1J3T A;  4RTW A;  5IHN A;  2CH4 W;  2K9G A;  1NEG A;  3PE0 A;  2IIM A;  1QCF A;  2KE9 A;  2JTE A;  5IH2 A;  1U3O A;  1WIE A;  1BK2 A;  3TSW A;  2XMF A;  1I0C A;  4LUD A;  5HCK A;  2SRC A;  3VS1 A;  1M3C A;  1K0S A;  4HVV A;  3VS3 A;  1X27 A;  2EYW A;  2DMO A;  1I07 A;  1OPL A;  2JW4 A;  4J9I A;  1UJY A;  3GBQ A;  4AG1 C;  1EFN A;  5L23 A;  2DM1 A;  4GBQ A;  1PNJ A;  2DVJ A;  1AWO A;  1QWF A;  4IIM A;  3UA6 A;  2AZS A;  1PRM C;  4CC3 A;  2JM9 A;  3RBB B;  2L3P A;  1B07 A;  1M3A A;  1AEY A;  1PWT A;  2FRW A;  4AFU C;  1UHF A;  4JJD A;  2YT6 A;  4RTU A;  2JT4 A;  3R6N A;  3VRY A;  4GLM A;  3QWX X;  2OJ2 A;  3JV3 A;  2CT4 A;  2X3X D;  3I5R A;  3M0P A;  5I22 A;  4JZ3 A;  2J6O A;  2PNI A;  1G2B A;  1HJD A;  1FYN A;  2GNC A;  1NYF A;  1SPK A;  3THK A;  4OMM A;  2DJQ A;  1QWE A;  4LN2 A;  2JXB A;  1JQQ A;  2LMJ A;  2GQI A;  2O2O A;  5ECA A;  1BBZ A;  1UUE A;  2PTK A;  4HXJ A;  3M0U A;  2CSQ A;  2BZY A;  3QWY A;  1G83 A;  1I1J A;  4J9D A;  4EIK A;  2VWF A;  3TSZ A;  2ROL A;  1TUD A;  2DL8 A;  3NGP A;  1CKB A;  2FG0 A;  2SEM A;  3I35 A;  4HCK A;  2CH4 A;  1KSW A;  2DLP A;  1OV3 A;  2KYM A;  2JM8 A;  2L2P A;  2P4R A;  3M0Q A;  1K76 A;  1JEG A;  4WCI A;  1WX6 A;  1WXU A;  2FO0 A;  2HSP A;  5FWC A;  2MIO A;  1HSQ A;  2W0Z A;  1T3S A;  3H41 A;  1CSK A;  5EC7 A;  2DL5 A;  2CT3 A;  4OMN A;  4RTT A;  1ZUU A;  2EW3 A;  2EPD A;  2KRM A;  4A63 B;  1VYT A;  2JS0 A;  4ORZ A;  1TUC A;  1ZLM A;  1AOJ A;  2YUQ A;  1SHG A;  4OMP A;  2FPF A;  3EG2 A;  2RQT A;  2RF0 A;  3SEM A;  1YWO A;  1KJW A;  2DL7 A;  2GTJ A;  4OMQ A;  3PVL A;  4AFZ C;  5FWB A;  4F16 A;  3REA B;  2NUZ A;  1KFZ A;  1TG0 A;  4RTY A;  5I11 A;  1E6H A;  2O31 A;  4OML A;  2YUN A;  1AD5 A;  5GJV B;  2V1R A;  1RI9 A;  4ESR A;  3U23 A;  1NM7 A;  2KT1 A;  2L3S A;  3NHN A;  2KXD A;  5IXB A;  2D8H A;  2ABL A;  1NLO C;  1WYX A;  2H8H A;  3EG3 A;  3H0H A;  3EHQ A;  4K11 A;  1MUZ A;  4R0K A;  1U5S A;  3VS7 A;  3VS2 A;  1YN8 A;  2FPD A;  4LNP A;  4X1V A;  3NPF A;  1FMK A;  1VYU A;  4HVW A;  1E7O A;  2B86 A;  2JS2 A;  3A98 A;  5IHI A;  2MCN A;  1AZE A;  4J9C A;  4JZ4 A;  1H8K A;  2HBW A;  1AWW A;  2GBQ A;  1WI7 A;  3LH5 A;  2AKL A;  2CUB A;  4CC2 A;  1K1Z A;  3H0I A;  4DEY A;  1ARK A;  2DRM A;  2EBP A;  2CRE A;  2LNH B;  4Y92 A;  3VS5 A;  5GJW B;  1QKX A;  2LP5 A;  2HEQ A;  2J6K A;  1W70 A;  2K79 A;  1X6B A;  3EHR A;  2O88 A;  2ENM A;  4DEX A;  2M51 A;  1JO8 A;  1K0X A;  2K6D A;  4HVU A;  1GRI A;  2LX7 A;  2F2V A;  1HD3 A;  1GFD A;  2J05 A;  1W1F A;  1GCQ C;  3REB B;  2BZX A;  1RLP C;  3IQL A;  1M27 C;  2DL4 A;  2L0A A;  2KNB B;  2C0I A;  2DX1 A;  1PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...