2LJ4A

Solution structure of the tbpin1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MSEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structural Analysis of the Single-Domain Parvulin TbPin1
doi rcsb
source organism Trypanosoma brucei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase/rotamase, putative
total genus 28
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lj4A00
5DITA 2VN1A 4DIPA 1Q6HA 2XP3A 3UF8A 1D7HA 1N1AA 1R9HA 5HWCA 5GPGA 1PBKA 3NTPA 4IQCA 2KE0A 4ODPA 1FKJA 1ROTA 2DG9A 2PPOA 2Q5AA 3O5PA 2ZR5A 2D9FA 4MGVA 4W9QA 3CGMA 3OOBA 2UZ5A 4DZ3A 3TCZA 1J4IA 2RUQA 1B6CA 4W9PA 1YW5A 2PPNA 3IKGA 2XP8A 1F8AB 2DG4A 2LKNA 3UQBA 4DRHA 2ZR6A 3EY6A 1FKRA 3JXVA 2XP6A 3KCEA 2XP7A 5B8IC 5BXJA 1FKLA 2AWGA 1F40A 1D6OA 2ZQSA 1FD9A 2RUDA 3TC5A 2LJ4A 3O5QA 3CGNA 3O5MA 1A7XA 2XPBA 1C9HA 5HTGA 2FAPA 3UI5A 3UQIA 2F2DA 1NSGA 1FAPA 4MSPA 4U84A 1ROUA 3UQAA 4J4OA 2Y78A 1HXVA 4TW8A 1Q6IA 5I98A 1QPLA 3KAHA 2KFWA 1FKFA 4DRNA 1J4HA 2PV3A 3O5EA 1ZCNA 3PA7A 2KI3A 1FKDA 1FKHA 2MLXA 3LUOA 4IQ2A 5HW7A 2JZVA 2M08A 3O5OA 2M1IA 2IF4A 4R0XA 4IPXA 3O5KA 3UI4A 4DT4A 2ITKA 3I6CA 3PRDA 4ODQA 2PPPA 4QT3A 2MF9A 3RGCA 4GIVA 4DRIA 4DROA 3KAGA 2RSEA 2RUCA 4ODOA 3O5DA 3O5LA 2XPAA 4O2TA 4NNRA 3KAFA 1TCOC 3O5IA 3KACA 2LPVA 1EYMA 3NRKA 4JFKA 5DIVA 2ZR4A 2F21A 2M2AA 3RFWA 5DIUA 1U79A 3FAPA 2ZQVA 3H9RB 4LAXA 1FJDA 2RQSA 2N87A 4BF8A 2XP9A 1BKFA 1PINA 3O5RA 4N19A 3UI6A 4DH0A 1Q6UA 2ZQTA 2MLYA 4TW6A 1NMWA 3KZ7A 3WH0A 5HT1A 1J4RA 2PBCA 4DRPA 3B7XA 1J6YA 4FN2A 5J6EA 1KT1A 1KT0A 5HW6A 4LAWA 4ODRA 2PV1A 2OFNA 4ITZA 4DRKA 1FKKA 1FKGA 3GPKA 4ODKA 1YATA 4DZ2A 2MLZA 3MDYB 1QPFA 4GGQA 2F4EA 1W26A 4ODMA 5HW8A 5HUAA 1BL4A 1Y0OA 2VCDA 4JFJA 3O5FA 3NI6A 2LGOA 4QIBA 2MPHA 1D7IA 2XP5A 2L2SA 2XP4A 3KAIA 3PRBA 4G50A 4LAYA 1T11A 1P5QA 1JVWA 1ZK6A 2KR7A 2K8IA 4J4NA 1FKSA 3IKDA 3JYJA 4ODLA 4TW7A 2MNTA 1L1PA 1EQ3A 1JNTA 1D7JA 4TNSA 4U85A 4C02B 4LAVA 4JFLA 4FAPA 2KGJA 2KO7A 4JFIA 5D75A 1FKBA 3VAWA 4DRMA 4QT2A 4ODNA 1FKIA 1NMVA 2FKEA 4TYOA 1QZ2A 3ODKA 3TDBA 3O5GA 2DG3A 2PV2A 4DRQA 1JNSA 4W9OA 1Q1CA 3IK8A 3KABA 3KADA 4TX0A 2RURA 3IHZA 3JYMA 4G2PA 4JYSA 5HWBA 1M5YA 4DRJA 2ZQUA 1FKTA 3O5JA 4JFMA 5HKGA 4U86A
chains in the Genus database with same CATH superfamily
1ZBWA 2FDMA 4P8UA 3UF8A 5HBFA 1E9LA 1GPFA 3AS2A 4ODPA 3O5PA 1JNDA 2Q5AA 4W9QA 3CGMA 1J4IA 4DWSC 1B6CA 4LGXA 1LL7A 2PPNA 2XP8A 1F8AB 3RM9A 1NWUA 2ZR6A 3JXVA 1FD9A 3B8SA 4ML4A 1HKJA 4P8XA 4Z2HA 2XPBA 2F2DA 1NSGA 1FAPA 1HXVA 1ROUA 4WKHA 5I98A 3KAHA 1FKFA 4DRNA 1J4HA 3O5EA 2KI3A 1FKDA 1FKHA 4HBEA 2ESCA 1W1VA 1IX5A 3UI4A 3WD1A 4WKFA 2ITKA 3PRDA 4DRIA 3AS1A 4ODOA 3AS0A 2XPAA 4NNRA 1TCOC 1EYMA 2LPVA 1UR9A 2DSUA 4XAKA 2F21A 2M2AA 1RD6A 5DIUA 2ZQVA 4LAXA 1FJDA 5DEZA 2XP9A 4DH0A 1VF8A 3B7XA 4MPKA 1KT1A 5HW6A 1HKMA 3ARYA 1FFRA 2PV1A 2OFNA 3AS3A 3G6LA 1E6NA 3GPKA 1GUVA 1YATA 4ODKA 3WD0A 2DPEA 1W26A 5HW8A 1OGGA 4JFJA 5JH8A 1XHGA 3KAIA 4ZPVR 1LL6A 1E6ZA 4Q7NA 4J4NA 1W9VA 1L1PA 3IKDA 4C02B 4FAPA 1FKBA 1O6IA 1FFQA 3WD3A 1FKIA 2FKEA 3ODKA 2P4VA 3TDBA 1JNSA 1WB0A 3RMEA 4DRQA 3KADA 3CH9A 3IHZA 3JYMA 4W5UA 4WK9A 1X6NA 4MNKA 2ZQUA 1FKTA 3O5JA 4MNJA 4P8WA 1XRVA 2VN1A 2XP3A 4NZCA 3GU0A 1N1AA 4L3NA 1PBKA 1ITXA 3NTPA 2ETNA 2YBTA 1ROTA 2PPOA 4MGVA 2AOSA 2UZ5A 3OOBA 1GOIA 4DZ3A 3TCZA 2RUQA 4KQZA 3ARPA 1OWQA 4DRHA 1FKRA 2XP6A 2XP7A 1FKLA 1D6OA 2O9OA 1TFVA 3B9AA 2RUDA 4R5EA 3TC5A 1UR8A 3O5MA 1A7XA 3ARSA 4HBOA 1C9HA 1HJXA 3ARQA 3RM8A 3EIPA 3UQAA 1Q6IA 1QPLA 3PA7A 5HW7A 4NSBA 3FY1A 2JZVA 4MNLA 3WD4A 4DWSA 4IT4A 4ODQA 4DROA 3RGCA 1LJYA 2G8ZA 2RUCA 1SR0A 3ARVA 3O5IA 1H0IA 4L72B 3RFWA 1X6LA 3FAPA 2QF8A 3H9RB 4BF8A 1PINA 4N19A 3O5RA 3AROA 1E6PA 1ZL1A 2ZQTA 2MLYA 4PTMA 4TW6A 4S3JA 3ARZA 2PBCA 1J6YA 1W1TA 4WJXA 4IT6A 1FKGA 3PR9A 1NWRA 1LG2A 1QPFA 4GGQA 2F4EA 5GQBA 4Z2LA 1Y0OA 2LGOA 1HJWA 1D7IA 2XP5A 4G50A 3WL1A 1T11A 1P5QA 1JVWA 2KR7A 1FKSA 1EQ3A 2WLYA 1EHNA 4U85A 4JFLA 2KGJA 3WQVA 3G6MA 4URIA 4ODNA 1E15A 1NMVA 1QZ2A 1ZU8A 1LQ0A 3IK8A 3KABA 5HWBA 1W1YA 4TX0A 1M5YA 3W4RA 4U86A 3BMBA 2B5UB 5DITA 4Z2GA 4DIPA 1Q6HA 5HWCA 5GPGA 4IQCA 1W9PA 2KE0A 2DG9A 3WIJA 2D9FA 2A3CA 2O92A 1K9TA 4W9PA 4MAVA 3IKGA 1CTNA 1W9UA 2DG4A 2B31A 2LKNA 3EY6A 3KCEA 5B8IC 1SYTA 1F40A 3CHFA 2PN0A 3CHDA 2LJ4A 3CGNA 3UI5A 3UQIA 4U84A 4MSPA 1GRJA 2DT2A 2Y78A 1E6RA 4TW8A 4WKAA 2IUZA 3ARUA 2KFWA 1EDQA 1ZCNA 2MLXA 3LUOA 4IQ2A 4ZS6A 4WIWA 2IF4A 4IPXA 2EULA 3AQUA 3B9DA 3KAGA 2DT1A 3O5DA 4O2TA 4QZVB 2DT0A 1WNOA 1U79A 2RQSA 3B9EA 3UI6A 1NMWA 4DRPA 3OA5A 3QOKA 4FN2A 1KT0A 4LAWA 4ODRA 4ITZA 1NH6A 1WAWA 4DZ2A 2OLHA 3ARTA 1NWSA 4Z2KA 5HUAA 1BL4A 3WKZA 2L2SA 3FXYA 2K8IA 1E44A 3CHEA 2MNTA 2DSZA 1D7JA 4LAVA 3GTYX 3WL0A 4JFIA 3RM4A 4QT2A 1HKIA 4TYOA 2WM0A 5DO2A 2PV2A 4AY1A 1Q1CA 2RURA 2YBUA 4G2PA 4JYSA 4DRJA 1EIBA 1LG1A 4DWSB 1D7HA 1R9HA 1JCHB 4S3KA 1D2KA 3PRAA 4ZPTR 1FKJA 4UDMA 2ZR5A 1W1PA 4Z2JA 3ALFA 4DWSD 1YW5A 4HARA 3UQBA 5BXJA 1H0GA 2AWGA 2DSWA 3ARRA 2ZQSA 1JNEA 3O5QA 5HTGA 2FAPA 2WLZA 5DF0A 1ZBKA 4J4OA 3CHCA 2PV3A 2G41A 2M08A 3WD2A 3O5OA 2M1IA 4R0XA 2A3BA 3O5KA 2DSVA 4DT4A 3I6CA 4QT3A 2PPPA 2MF9A 4GIVA 2RSEA 4Q22A 3WQWA 2F23A 3O5LA 3KAFA 3KACA 4JFKA 5DIVA 3NRKA 2ZR4A 1HJVA 1KFWA 4KR0B 4MNMA 1HKKA 2N87A 1LL4A 3BXWA 1ZB5A 1BKFA 1Q6UA 3KZ7A 3WH0A 5HT1A 3ARXA 1J4RA 4P8VA 5J6EA 4DRKA 1FKKA 2MLZA 3MDYB 4ZPWR 5GPRA 3ALGA 4ODMA 2DT3A 2VCDA 3CZ8A 2WK2A 3O5FA 3NI6A 4QIBA 2MPHA 2XP4A 3PRBA 4LAYA 1ZK6A 4ODLA 4TW7A 3JYJA 1ZBVA 1JNTA 4TNSA 2A3AA 4MTVA 2KO7A 5D75A 3VAWA 4DRMA 1NWTA 2PI6A 3ARWA 1OGBA 3O5GA 2DG3A 4W9OA 1ZBCA 4JFMA 5HKGA 4Z2IA 2A3EA
chains in the Genus database with same CATH topology
1ZBWA 2FDMA 4P8UA 3UF8A 5HBFA 1E9LA 1GPFA 3AS2A 4ODPA 3O5PA 1JNDA 2Q5AA 4W9QA 3CGMA 1J4IA 4DWSC 1B6CA 4LGXA 1LL7A 2PPNA 2XP8A 1F8AB 3RM9A 1NWUA 2ZR6A 3JXVA 1FD9A 3B8SA 4ML4A 1HKJA 4P8XA 4Z2HA 2XPBA 2F2DA 1NSGA 1FAPA 1HXVA 1ROUA 4WKHA 5I98A 3KAHA 1FKFA 4DRNA 1J4HA 3O5EA 2KI3A 1FKDA 1FKHA 4HBEA 2ESCA 1W1VA 1IX5A 3UI4A 3WD1A 4WKFA 2ITKA 3PRDA 4DRIA 3AS1A 4ODOA 3AS0A 2XPAA 4NNRA 1TCOC 1EYMA 2LPVA 1UR9A 2DSUA 4XAKA 2F21A 2M2AA 1RD6A 5DIUA 2ZQVA 4LAXA 1FJDA 5DEZA 2XP9A 4DH0A 1VF8A 3B7XA 4MPKA 1KT1A 5HW6A 1HKMA 3ARYA 1FFRA 2PV1A 2OFNA 3AS3A 3G6LA 1E6NA 3GPKA 1GUVA 1YATA 4ODKA 3WD0A 2DPEA 1W26A 5HW8A 1OGGA 4JFJA 5JH8A 1XHGA 3KAIA 4ZPVR 1LL6A 1E6ZA 4Q7NA 4J4NA 1W9VA 1L1PA 3IKDA 4C02B 4FAPA 1FKBA 1O6IA 1FFQA 3WD3A 1FKIA 2FKEA 3ODKA 3TDBA 1JNSA 1WB0A 3RMEA 4DRQA 3KADA 3CH9A 3IHZA 3JYMA 4W5UA 4WK9A 1X6NA 4MNKA 2ZQUA 1FKTA 3O5JA 4MNJA 4P8WA 1XRVA 2VN1A 2XP3A 4NZCA 1N1AA 4L3NA 1PBKA 1ITXA 3NTPA 2YBTA 1ROTA 2PPOA 4MGVA 2AOSA 2UZ5A 3OOBA 1GOIA 4DZ3A 3TCZA 2RUQA 4KQZA 3ARPA 1OWQA 4DRHA 1FKRA 2XP6A 2XP7A 1FKLA 1D6OA 2O9OA 1TFVA 3B9AA 2RUDA 4R5EA 3TC5A 1UR8A 3O5MA 1A7XA 3ARSA 4HBOA 1C9HA 1HJXA 3ARQA 3RM8A 3UQAA 1Q6IA 1QPLA 3PA7A 5HW7A 4NSBA 3FY1A 2JZVA 4MNLA 3WD4A 4DWSA 4IT4A 4ODQA 4DROA 3RGCA 1LJYA 2G8ZA 2RUCA 1SR0A 3ARVA 3O5IA 1H0IA 4L72B 3RFWA 1X6LA 3FAPA 2QF8A 3H9RB 4BF8A 1PINA 4N19A 3O5RA 3AROA 1E6PA 1ZL1A 2ZQTA 2MLYA 4PTMA 4TW6A 4S3JA 3ARZA 2PBCA 1J6YA 1W1TA 4WJXA 4IT6A 1FKGA 3PR9A 1NWRA 1LG2A 1QPFA 4GGQA 2F4EA 5GQBA 4Z2LA 1Y0OA 2LGOA 1HJWA 1D7IA 2XP5A 4G50A 3WL1A 1T11A 1P5QA 1JVWA 2KR7A 1FKSA 1EQ3A 2WLYA 1EHNA 4U85A 4JFLA 2KGJA 3WQVA 3G6MA 4URIA 4ODNA 1E15A 1NMVA 1QZ2A 1ZU8A 1LQ0A 3IK8A 3KABA 5HWBA 1W1YA 4TX0A 1M5YA 3W4RA 4U86A 5DITA 4Z2GA 4DIPA 1Q6HA 5HWCA 5GPGA 4IQCA 1W9PA 2KE0A 2DG9A 3WIJA 2D9FA 2A3CA 2O92A 1K9TA 4W9PA 4MAVA 3IKGA 1CTNA 1W9UA 2DG4A 2B31A 2LKNA 3EY6A 3KCEA 5B8IC 1SYTA 1F40A 3CHFA 3CHDA 2LJ4A 3CGNA 3UI5A 3UQIA 4U84A 4MSPA 2Y78A 2DT2A 1E6RA 4TW8A 4WKAA 2IUZA 3ARUA 2KFWA 1EDQA 1ZCNA 2MLXA 3LUOA 4IQ2A 4ZS6A 4WIWA 2IF4A 4IPXA 3AQUA 3B9DA 3KAGA 2DT1A 3O5DA 4O2TA 4QZVB 2DT0A 1WNOA 1U79A 2RQSA 3B9EA 3UI6A 1NMWA 4DRPA 3OA5A 3QOKA 4FN2A 1KT0A 4LAWA 4ODRA 4ITZA 1NH6A 1WAWA 4DZ2A 2OLHA 3ARTA 1NWSA 4Z2KA 5HUAA 1BL4A 3WKZA 2L2SA 3FXYA 2K8IA 3CHEA 2MNTA 2DSZA 1D7JA 4LAVA 3WL0A 4JFIA 3RM4A 4QT2A 1HKIA 4TYOA 2WM0A 5DO2A 2PV2A 4AY1A 1Q1CA 2RURA 2YBUA 4G2PA 4JYSA 4DRJA 1EIBA 1LG1A 4DWSB 1D7HA 1R9HA 4S3KA 1D2KA 3PRAA 4ZPTR 1FKJA 2ZR5A 1W1PA 4Z2JA 3ALFA 4DWSD 1YW5A 4HARA 3UQBA 5BXJA 1H0GA 2AWGA 2DSWA 3ARRA 2ZQSA 1JNEA 3O5QA 5HTGA 2FAPA 2WLZA 5DF0A 1ZBKA 4J4OA 3CHCA 2PV3A 2G41A 2M08A 3WD2A 3O5OA 2M1IA 4R0XA 2A3BA 3O5KA 2DSVA 4DT4A 3I6CA 4QT3A 2PPPA 2MF9A 4GIVA 2RSEA 4Q22A 3WQWA 3O5LA 3KAFA 3KACA 4JFKA 5DIVA 3NRKA 2ZR4A 1HJVA 1KFWA 4KR0B 4MNMA 1HKKA 2N87A 1LL4A 3BXWA 1ZB5A 1BKFA 1Q6UA 3KZ7A 3WH0A 5HT1A 3ARXA 1J4RA 4P8VA 5J6EA 4DRKA 1FKKA 2MLZA 3MDYB 4ZPWR 5GPRA 3ALGA 4ODMA 2DT3A 2VCDA 3CZ8A 2WK2A 3O5FA 3NI6A 4QIBA 2MPHA 2XP4A 3PRBA 4LAYA 1ZK6A 4ODLA 4TW7A 3JYJA 1ZBVA 1JNTA 4TNSA 2A3AA 4MTVA 2KO7A 5D75A 3VAWA 4DRMA 1NWTA 2PI6A 3ARWA 1OGBA 3O5GA 2DG3A 4W9OA 1ZBCA 4JFMA 5HKGA 4Z2IA 2A3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIT A;  2VN1 A;  4DIP A;  1Q6H A;  2XP3 A;  3UF8 A;  1D7H A;  1N1A A;  1R9H A;  5HWC A;  5GPG A;  1PBK A;  3NTP A;  4IQC A;  2KE0 A;  4ODP A;  1FKJ A;  1ROT A;  2DG9 A;  2PPO A;  2Q5A A;  3O5P A;  2ZR5 A;  2D9F A;  4MGV A;  4W9Q A;  3CGM A;  3OOB A;  2UZ5 A;  4DZ3 A;  3TCZ A;  1J4I A;  2RUQ A;  1B6C A;  4W9P A;  1YW5 A;  2PPN A;  3IKG A;  2XP8 A;  1F8A B;  2DG4 A;  2LKN A;  3UQB A;  4DRH A;  2ZR6 A;  3EY6 A;  1FKR A;  3JXV A;  2XP6 A;  3KCE A;  2XP7 A;  5B8I C;  5BXJ A;  1FKL A;  2AWG A;  1F40 A;  1D6O A;  2ZQS A;  1FD9 A;  2RUD A;  3TC5 A;  2LJ4 A;  3O5Q A;  3CGN A;  3O5M A;  1A7X A;  2XPB A;  1C9H A;  5HTG A;  2FAP A;  3UI5 A;  3UQI A;  2F2D A;  1NSG A;  1FAP A;  4MSP A;  4U84 A;  1ROU A;  3UQA A;  4J4O A;  2Y78 A;  1HXV A;  4TW8 A;  1Q6I A;  5I98 A;  1QPL A;  3KAH A;  2KFW A;  1FKF A;  4DRN A;  1J4H A;  2PV3 A;  3O5E A;  1ZCN A;  3PA7 A;  2KI3 A;  1FKD A;  1FKH A;  2MLX A;  3LUO A;  4IQ2 A;  5HW7 A;  2JZV A;  2M08 A;  3O5O A;  2M1I A;  2IF4 A;  4R0X A;  4IPX A;  3O5K A;  3UI4 A;  4DT4 A;  2ITK A;  3I6C A;  3PRD A;  4ODQ A;  2PPP A;  4QT3 A;  2MF9 A;  3RGC A;  4GIV A;  4DRI A;  4DRO A;  3KAG A;  2RSE A;  2RUC A;  4ODO A;  3O5D A;  3O5L A;  2XPA A;  4O2T A;  4NNR A;  3KAF A;  1TCO C;  3O5I A;  3KAC A;  2LPV A;  1EYM A;  3NRK A;  4JFK A;  5DIV A;  2ZR4 A;  2F21 A;  2M2A A;  3RFW A;  5DIU A;  1U79 A;  3FAP A;  2ZQV A;  3H9R B;  4LAX A;  1FJD A;  2RQS A;  2N87 A;  4BF8 A;  2XP9 A;  1BKF A;  1PIN A;  3O5R A;  4N19 A;  3UI6 A;  4DH0 A;  1Q6U A;  2ZQT A;  2MLY A;  4TW6 A;  1NMW A;  3KZ7 A;  3WH0 A;  5HT1 A;  1J4R A;  2PBC A;  4DRP A;  3B7X A;  1J6Y A;  4FN2 A;  5J6E A;  1KT1 A;  1KT0 A;  5HW6 A;  4LAW A;  4ODR A;  2PV1 A;  2OFN A;  4ITZ A;  4DRK A;  1FKK A;  1FKG A;  3GPK A;  4ODK A;  1YAT A;  4DZ2 A;  2MLZ A;  3MDY B;  1QPF A;  4GGQ A;  2F4E A;  1W26 A;  4ODM A;  5HW8 A;  5HUA A;  1BL4 A;  1Y0O A;  2VCD A;  4JFJ A;  3O5F A;  3NI6 A;  2LGO A;  4QIB A;  2MPH A;  1D7I A;  2XP5 A;  2L2S A;  2XP4 A;  3KAI A;  3PRB A;  4G50 A;  4LAY A;  1T11 A;  1P5Q A;  1JVW A;  1ZK6 A;  2KR7 A;  2K8I A;  4J4N A;  1FKS A;  3IKD A;  3JYJ A;  4ODL A;  4TW7 A;  2MNT A;  1L1P A;  1EQ3 A;  1JNT A;  1D7J A;  4TNS A;  4U85 A;  4C02 B;  4LAV A;  4JFL A;  4FAP A;  2KGJ A;  2KO7 A;  4JFI A;  5D75 A;  1FKB A;  3VAW A;  4DRM A;  4QT2 A;  4ODN A;  1FKI A;  1NMV A;  2FKE A;  4TYO A;  1QZ2 A;  3ODK A;  3TDB A;  3O5G A;  2DG3 A;  2PV2 A;  4DRQ A;  1JNS A;  4W9O A;  1Q1C A;  3IK8 A;  3KAB A;  3KAD A;  4TX0 A;  2RUR A;  3IHZ A;  3JYM A;  4G2P A;  4JYS A;  5HWB A;  1M5Y A;  4DRJ A;  2ZQU A;  1FKT A;  3O5J A;  4JFM A;  5HKG A;  4U86 A; 
#chains in the Genus database with same CATH topology
 1ZBW A;  2FDM A;  4P8U A;  3UF8 A;  5HBF A;  1E9L A;  1GPF A;  3AS2 A;  4ODP A;  3O5P A;  1JND A;  2Q5A A;  4W9Q A;  3CGM A;  1J4I A;  4DWS C;  1B6C A;  4LGX A;  1LL7 A;  2PPN A;  2XP8 A;  1F8A B;  3RM9 A;  1NWU A;  2ZR6 A;  3JXV A;  1FD9 A;  3B8S A;  4ML4 A;  1HKJ A;  4P8X A;  4Z2H A;  2XPB A;  2F2D A;  1NSG A;  1FAP A;  1HXV A;  1ROU A;  4WKH A;  5I98 A;  3KAH A;  1FKF A;  4DRN A;  1J4H A;  3O5E A;  2KI3 A;  1FKD A;  1FKH A;  4HBE A;  2ESC A;  1W1V A;  1IX5 A;  3UI4 A;  3WD1 A;  4WKF A;  2ITK A;  3PRD A;  4DRI A;  3AS1 A;  4ODO A;  3AS0 A;  2XPA A;  4NNR A;  1TCO C;  1EYM A;  2LPV A;  1UR9 A;  2DSU A;  4XAK A;  2F21 A;  2M2A A;  1RD6 A;  5DIU A;  2ZQV A;  4LAX A;  1FJD A;  5DEZ A;  2XP9 A;  4DH0 A;  1VF8 A;  3B7X A;  4MPK A;  1KT1 A;  5HW6 A;  1HKM A;  3ARY A;  1FFR A;  2PV1 A;  2OFN A;  3AS3 A;  3G6L A;  1E6N A;  3GPK A;  1GUV A;  1YAT A;  4ODK A;  3WD0 A;  2DPE A;  1W26 A;  5HW8 A;  1OGG A;  4JFJ A;  5JH8 A;  1XHG A;  3KAI A;  4ZPV R;  1LL6 A;  1E6Z A;  4Q7N A;  4J4N A;  1W9V A;  1L1P A;  3IKD A;  4C02 B;  4FAP A;  1FKB A;  1O6I A;  1FFQ A;  3WD3 A;  1FKI A;  2FKE A;  3ODK A;  2P4V A;  3TDB A;  1JNS A;  1WB0 A;  3RME A;  4DRQ A;  3KAD A;  3CH9 A;  3IHZ A;  3JYM A;  4W5U A;  4WK9 A;  1X6N A;  4MNK A;  2ZQU A;  1FKT A;  3O5J A;  4MNJ A;  4P8W A;  1XRV A;  2VN1 A;  2XP3 A;  4NZC A;  3GU0 A;  1N1A A;  4L3N A;  1PBK A;  1ITX A;  3NTP A;  2ETN A;  2YBT A;  1ROT A;  2PPO A;  4MGV A;  2AOS A;  2UZ5 A;  3OOB A;  1GOI A;  4DZ3 A;  3TCZ A;  2RUQ A;  4KQZ A;  3ARP A;  1OWQ A;  4DRH A;  1FKR A;  2XP6 A;  2XP7 A;  1FKL A;  1D6O A;  2O9O A;  1TFV A;  3B9A A;  2RUD A;  4R5E A;  3TC5 A;  1UR8 A;  3O5M A;  1A7X A;  3ARS A;  4HBO A;  1C9H A;  1HJX A;  3ARQ A;  3RM8 A;  3EIP A;  3UQA A;  1Q6I A;  1QPL A;  3PA7 A;  5HW7 A;  4NSB A;  3FY1 A;  2JZV A;  4MNL A;  3WD4 A;  4DWS A;  4IT4 A;  4ODQ A;  4DRO A;  3RGC A;  1LJY A;  2G8Z A;  2RUC A;  1SR0 A;  3ARV A;  3O5I A;  1H0I A;  4L72 B;  3RFW A;  1X6L A;  3FAP A;  2QF8 A;  3H9R B;  4BF8 A;  1PIN A;  4N19 A;  3O5R A;  3ARO A;  1E6P A;  1ZL1 A;  2ZQT A;  2MLY A;  4PTM A;  4TW6 A;  4S3J A;  3ARZ A;  2PBC A;  1J6Y A;  1W1T A;  4WJX A;  4IT6 A;  1FKG A;  3PR9 A;  1NWR A;  1LG2 A;  1QPF A;  4GGQ A;  2F4E A;  5GQB A;  4Z2L A;  1Y0O A;  2LGO A;  1HJW A;  1D7I A;  2XP5 A;  4G50 A;  3WL1 A;  1T11 A;  1P5Q A;  1JVW A;  2KR7 A;  1FKS A;  1EQ3 A;  2WLY A;  1EHN A;  4U85 A;  4JFL A;  2KGJ A;  3WQV A;  3G6M A;  4URI A;  4ODN A;  1E15 A;  1NMV A;  1QZ2 A;  1ZU8 A;  1LQ0 A;  3IK8 A;  3KAB A;  5HWB A;  1W1Y A;  4TX0 A;  1M5Y A;  3W4R A;  4U86 A;  3BMB A;  2B5U B;  5DIT A;  4Z2G A;  4DIP A;  1Q6H A;  5HWC A;  5GPG A;  4IQC A;  1W9P A;  2KE0 A;  2DG9 A;  3WIJ A;  2D9F A;  2A3C A;  2O92 A;  1K9T A;  4W9P A;  4MAV A;  3IKG A;  1CTN A;  1W9U A;  2DG4 A;  2B31 A;  2LKN A;  3EY6 A;  3KCE A;  5B8I C;  1SYT A;  1F40 A;  3CHF A;  2PN0 A;  3CHD A;  2LJ4 A;  3CGN A;  3UI5 A;  3UQI A;  4U84 A;  4MSP A;  1GRJ A;  2DT2 A;  2Y78 A;  1E6R A;  4TW8 A;  4WKA A;  2IUZ A;  3ARU A;  2KFW A;  1EDQ A;  1ZCN A;  2MLX A;  3LUO A;  4IQ2 A;  4ZS6 A;  4WIW A;  2IF4 A;  4IPX A;  2EUL A;  3AQU A;  3B9D A;  3KAG A;  2DT1 A;  3O5D A;  4O2T A;  4QZV B;  2DT0 A;  1WNO A;  1U79 A;  2RQS A;  3B9E A;  3UI6 A;  1NMW A;  4DRP A;  3OA5 A;  3QOK A;  4FN2 A;  1KT0 A;  4LAW A;  4ODR A;  4ITZ A;  1NH6 A;  1WAW A;  4DZ2 A;  2OLH A;  3ART A;  1NWS A;  4Z2K A;  5HUA A;  1BL4 A;  3WKZ A;  2L2S A;  3FXY A;  2K8I A;  1E44 A;  3CHE A;  2MNT A;  2DSZ A;  1D7J A;  4LAV A;  3GTY X;  3WL0 A;  4JFI A;  3RM4 A;  4QT2 A;  1HKI A;  4TYO A;  2WM0 A;  5DO2 A;  2PV2 A;  4AY1 A;  1Q1C A;  2RUR A;  2YBU A;  4G2P A;  4JYS A;  4DRJ A;  1EIB A;  1LG1 A;  4DWS B;  1D7H A;  1R9H A;  1JCH B;  4S3K A;  1D2K A;  3PRA A;  4ZPT R;  1FKJ A;  4UDM A;  2ZR5 A;  1W1P A;  4Z2J A;  3ALF A;  4DWS D;  1YW5 A;  4HAR A;  3UQB A;  5BXJ A;  1H0G A;  2AWG A;  2DSW A;  3ARR A;  2ZQS A;  1JNE A;  3O5Q A;  5HTG A;  2FAP A;  2WLZ A;  5DF0 A;  1ZBK A;  4J4O A;  3CHC A;  2PV3 A;  2G41 A;  2M08 A;  3WD2 A;  3O5O A;  2M1I A;  4R0X A;  2A3B A;  3O5K A;  2DSV A;  4DT4 A;  3I6C A;  4QT3 A;  2PPP A;  2MF9 A;  4GIV A;  2RSE A;  4Q22 A;  3WQW A;  2F23 A;  3O5L A;  3KAF A;  3KAC A;  4JFK A;  5DIV A;  3NRK A;  2ZR4 A;  1HJV A;  1KFW A;  4KR0 B;  4MNM A;  1HKK A;  2N87 A;  1LL4 A;  3BXW A;  1ZB5 A;  1BKF A;  1Q6U A;  3KZ7 A;  3WH0 A;  5HT1 A;  3ARX A;  1J4R A;  4P8V A;  5J6E A;  4DRK A;  1FKK A;  2MLZ A;  3MDY B;  4ZPW R;  5GPR A;  3ALG A;  4ODM A;  2DT3 A;  2VCD A;  3CZ8 A;  2WK2 A;  3O5F A;  3NI6 A;  4QIB A;  2MPH A;  2XP4 A;  3PRB A;  4LAY A;  1ZK6 A;  4ODL A;  4TW7 A;  3JYJ A;  1ZBV A;  1JNT A;  4TNS A;  2A3A A;  4MTV A;  2KO7 A;  5D75 A;  3VAW A;  4DRM A;  1NWT A;  2PI6 A;  3ARW A;  1OGB A;  3O5G A;  2DG3 A;  4W9O A;  1ZBC A;  4JFM A;  5HKG A;  4Z2I A;  2A3E A; 
#chains in the Genus database with same CATH homology
 1ZBW A;  2FDM A;  4P8U A;  3UF8 A;  5HBF A;  1E9L A;  1GPF A;  3AS2 A;  4ODP A;  3O5P A;  1JND A;  2Q5A A;  4W9Q A;  3CGM A;  1J4I A;  4DWS C;  1B6C A;  4LGX A;  1LL7 A;  2PPN A;  2XP8 A;  1F8A B;  3RM9 A;  1NWU A;  2ZR6 A;  3JXV A;  1FD9 A;  3B8S A;  4ML4 A;  1HKJ A;  4P8X A;  4Z2H A;  2XPB A;  2F2D A;  1NSG A;  1FAP A;  1HXV A;  1ROU A;  4WKH A;  5I98 A;  3KAH A;  1FKF A;  4DRN A;  1J4H A;  3O5E A;  2KI3 A;  1FKD A;  1FKH A;  4HBE A;  2ESC A;  1W1V A;  1IX5 A;  3UI4 A;  3WD1 A;  4WKF A;  2ITK A;  3PRD A;  4DRI A;  3AS1 A;  4ODO A;  3AS0 A;  2XPA A;  4NNR A;  1TCO C;  1EYM A;  2LPV A;  1UR9 A;  2DSU A;  4XAK A;  2F21 A;  2M2A A;  1RD6 A;  5DIU A;  2ZQV A;  4LAX A;  1FJD A;  5DEZ A;  2XP9 A;  4DH0 A;  1VF8 A;  3B7X A;  4MPK A;  1KT1 A;  5HW6 A;  1HKM A;  3ARY A;  1FFR A;  2PV1 A;  2OFN A;  3AS3 A;  3G6L A;  1E6N A;  3GPK A;  1GUV A;  1YAT A;  4ODK A;  3WD0 A;  2DPE A;  1W26 A;  5HW8 A;  1OGG A;  4JFJ A;  5JH8 A;  1XHG A;  3KAI A;  4ZPV R;  1LL6 A;  1E6Z A;  4Q7N A;  4J4N A;  1W9V A;  1L1P A;  3IKD A;  4C02 B;  4FAP A;  1FKB A;  1O6I A;  1FFQ A;  3WD3 A;  1FKI A;  2FKE A;  3ODK A;  3TDB A;  1JNS A;  1WB0 A;  3RME A;  4DRQ A;  3KAD A;  3CH9 A;  3IHZ A;  3JYM A;  4W5U A;  4WK9 A;  1X6N A;  4MNK A;  2ZQU A;  1FKT A;  3O5J A;  4MNJ A;  4P8W A;  1XRV A;  2VN1 A;  2XP3 A;  4NZC A;  1N1A A;  4L3N A;  1PBK A;  1ITX A;  3NTP A;  2YBT A;  1ROT A;  2PPO A;  4MGV A;  2AOS A;  2UZ5 A;  3OOB A;  1GOI A;  4DZ3 A;  3TCZ A;  2RUQ A;  4KQZ A;  3ARP A;  1OWQ A;  4DRH A;  1FKR A;  2XP6 A;  2XP7 A;  1FKL A;  1D6O A;  2O9O A;  1TFV A;  3B9A A;  2RUD A;  4R5E A;  3TC5 A;  1UR8 A;  3O5M A;  1A7X A;  3ARS A;  4HBO A;  1C9H A;  1HJX A;  3ARQ A;  3RM8 A;  3UQA A;  1Q6I A;  1QPL A;  3PA7 A;  5HW7 A;  4NSB A;  3FY1 A;  2JZV A;  4MNL A;  3WD4 A;  4DWS A;  4IT4 A;  4ODQ A;  4DRO A;  3RGC A;  1LJY A;  2G8Z A;  2RUC A;  1SR0 A;  3ARV A;  3O5I A;  1H0I A;  4L72 B;  3RFW A;  1X6L A;  3FAP A;  2QF8 A;  3H9R B;  4BF8 A;  1PIN A;  4N19 A;  3O5R A;  3ARO A;  1E6P A;  1ZL1 A;  2ZQT A;  2MLY A;  4PTM A;  4TW6 A;  4S3J A;  3ARZ A;  2PBC A;  1J6Y A;  1W1T A;  4WJX A;  4IT6 A;  1FKG A;  3PR9 A;  1NWR A;  1LG2 A;  1QPF A;  4GGQ A;  2F4E A;  5GQB A;  4Z2L A;  1Y0O A;  2LGO A;  1HJW A;  1D7I A;  2XP5 A;  4G50 A;  3WL1 A;  1T11 A;  1P5Q A;  1JVW A;  2KR7 A;  1FKS A;  1EQ3 A;  2WLY A;  1EHN A;  4U85 A;  4JFL A;  2KGJ A;  3WQV A;  3G6M A;  4URI A;  4ODN A;  1E15 A;  1NMV A;  1QZ2 A;  1ZU8 A;  1LQ0 A;  3IK8 A;  3KAB A;  5HWB A;  1W1Y A;  4TX0 A;  1M5Y A;  3W4R A;  4U86 A;  5DIT A;  4Z2G A;  4DIP A;  1Q6H A;  5HWC A;  5GPG A;  4IQC A;  1W9P A;  2KE0 A;  2DG9 A;  3WIJ A;  2D9F A;  2A3C A;  2O92 A;  1K9T A;  4W9P A;  4MAV A;  3IKG A;  1CTN A;  1W9U A;  2DG4 A;  2B31 A;  2LKN A;  3EY6 A;  3KCE A;  5B8I C;  1SYT A;  1F40 A;  3CHF A;  3CHD A;  2LJ4 A;  3CGN A;  3UI5 A;  3UQI A;  4U84 A;  4MSP A;  2Y78 A;  2DT2 A;  1E6R A;  4TW8 A;  4WKA A;  2IUZ A;  3ARU A;  2KFW A;  1EDQ A;  1ZCN A;  2MLX A;  3LUO A;  4IQ2 A;  4ZS6 A;  4WIW A;  2IF4 A;  4IPX A;  3AQU A;  3B9D A;  3KAG A;  2DT1 A;  3O5D A;  4O2T A;  4QZV B;  2DT0 A;  1WNO A;  1U79 A;  2RQS A;  3B9E A;  3UI6 A;  1NMW A;  4DRP A;  3OA5 A;  3QOK A;  4FN2 A;  1KT0 A;  4LAW A;  4ODR A;  4ITZ A;  1NH6 A;  1WAW A;  4DZ2 A;  2OLH A;  3ART A;  1NWS A;  4Z2K A;  5HUA A;  1BL4 A;  3WKZ A;  2L2S A;  3FXY A;  2K8I A;  3CHE A;  2MNT A;  2DSZ A;  1D7J A;  4LAV A;  3WL0 A;  4JFI A;  3RM4 A;  4QT2 A;  1HKI A;  4TYO A;  2WM0 A;  5DO2 A;  2PV2 A;  4AY1 A;  1Q1C A;  2RUR A;  2YBU A;  4G2P A;  4JYS A;  4DRJ A;  1EIB A;  1LG1 A;  4DWS B;  1D7H A;  1R9H A;  4S3K A;  1D2K A;  3PRA A;  4ZPT R;  1FKJ A;  2ZR5 A;  1W1P A;  4Z2J A;  3ALF A;  4DWS D;  1YW5 A;  4HAR A;  3UQB A;  5BXJ A;  1H0G A;  2AWG A;  2DSW A;  3ARR A;  2ZQS A;  1JNE A;  3O5Q A;  5HTG A;  2FAP A;  2WLZ A;  5DF0 A;  1ZBK A;  4J4O A;  3CHC A;  2PV3 A;  2G41 A;  2M08 A;  3WD2 A;  3O5O A;  2M1I A;  4R0X A;  2A3B A;  3O5K A;  2DSV A;  4DT4 A;  3I6C A;  4QT3 A;  2PPP A;  2MF9 A;  4GIV A;  2RSE A;  4Q22 A;  3WQW A;  3O5L A;  3KAF A;  3KAC A;  4JFK A;  5DIV A;  3NRK A;  2ZR4 A;  1HJV A;  1KFW A;  4KR0 B;  4MNM A;  1HKK A;  2N87 A;  1LL4 A;  3BXW A;  1ZB5 A;  1BKF A;  1Q6U A;  3KZ7 A;  3WH0 A;  5HT1 A;  3ARX A;  1J4R A;  4P8V A;  5J6E A;  4DRK A;  1FKK A;  2MLZ A;  3MDY B;  4ZPW R;  5GPR A;  3ALG A;  4ODM A;  2DT3 A;  2VCD A;  3CZ8 A;  2WK2 A;  3O5F A;  3NI6 A;  4QIB A;  2MPH A;  2XP4 A;  3PRB A;  4LAY A;  1ZK6 A;  4ODL A;  4TW7 A;  3JYJ A;  1ZBV A;  1JNT A;  4TNS A;  2A3A A;  4MTV A;  2KO7 A;  5D75 A;  3VAW A;  4DRM A;  1NWT A;  2PI6 A;  3ARW A;  1OGB A;  3O5G A;  2DG3 A;  4W9O A;  1ZBC A;  4JFM A;  5HKG A;  4Z2I A;  2A3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...