2LJ4A

Solution structure of the tbpin1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MSEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structural Analysis of the Single-Domain Parvulin TbPin1
doi rcsb
source organism Trypanosoma brucei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase/rotamase, putative
total genus 28
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lj4A00
2FKEA 1ZK6A 3O5QA 3TC5A 2RUQA 2LJ4A 5DIUA 3O5DA 2IF4A 2PPPA 4U85A 2PV3A 4NNRA 3H9RB 1ROUA 4MSPA 1YATA 1FKDA 2KGJA 2KO7A 3O5OA 2DG4A 3PA7A 1HXVA 3CGNA 4JFLA 1FKGA 1FKHA 4JFMA 3KCEA 4TW8A 1KT0A 3KAHA 2F4EA 3NI6A 4U84A 2K8IA 2ZR6A 3O5PA 2PBCA 1J4HA 4DRMA 2XP7A 3O5JA 4W9QA 4GGQA 2PV2A 5J6EA 1EQ3A 3IKDA 4JFJA 1B6CA 4JYSA 2OFNA 1NSGA 1FKLA 5D75A 1N1AA 3UQIA 1ZCNA 3KADA 3TDBA 3IKGA 4G2PA 1FAPA 1QPFA 4ITZA 4TW7A 4DRNA 3NRKA 4ODMA 4FAPA 3KABA 4DIPA 1M5YA 4DT4A 2F2DA 4U86A 4DRIA 2ITKA 2Y78A 1D7JA 2XP5A 4G50A 4LAYA 5BXJA 1FKRA 5HW6A 4O2TA 2XP4A 3JYJA 1Q1CA 1FJDA 2MNTA 2MPHA 1EYMA 2LPVA 1BL4A 3LUOA 3UQAA 4LAXA 1U79A 4DRJA 5I98A 2AWGA 2JZVA 1ROTA 1D7HA 3O5KA 2MLZA 1FKJA 1J4RA 5HWCA 2ZR5A 2RQSA 3IHZA 3KZ7A 1BKFA 2L2SA 4DRQA 2ZQVA 1JNSA 2DG3A 3JXVA 5HWBA 1FKKA 2PPNA 4DZ3A 1PINA 1D6OA 2ZQTA 4IPXA 2XPBA 2MF9A 2XP9A 3O5EA 2KR7A 3KAFA 4DZ2A 2RUDA 3ODKA 4DROA 3O5RA 3EY6A 1QPLA 2M1IA 4JFKA 2DG9A 4ODRA 2M08A 4IQ2A 1J4IA 4ODQA 2MLYA 5DIVA 5GPGA 5HW8A 5HTGA 4J4NA 4BF8A 5HW7A 4N19A 2XP8A 2LGOA 2Q5AA 3IK8A 3NTPA 1R9HA 4QIBA 5HT1A 3PRBA 3KAGA 4TYOA 4DRHA 2ZQSA 3PRDA 3FAPA 1TCOC 2UZ5A 3O5MA 3UF8A 3UI6A 1Q6HA 2RURA 3B7XA 5B8IC 4FN2A 4JFIA 3OOBA 1P5QA 1Q6IA 2D9FA 1FKFA 2ZR4A 3KAIA 1T11A 3O5FA 4ODNA 3KACA 3JYMA 4QT3A 4W9PA 3RFWA 1PBKA 1Q6UA 3O5IA 4LAWA 4ODOA 1JNTA 1YW5A 4ODPA 4TX0A 3UI5A 2KFWA 2N87A 4DRKA 4LAVA 2XP6A 2RUCA 2M2AA 3WH0A 1L1PA 2PPOA 3GPKA 3O5GA 4QT2A 4TNSA 4TW6A 2KE0A 1FKSA 4DRPA 2VCDA 2KI3A 1JVWA 2ZQUA 1FKBA 3UQBA 1FKTA 1Y0OA 3RGCA 3VAWA 1F40A 1NMWA 2FAPA 1D7IA 2F21A 1KT1A 2XPAA 2MLXA 1F8AB 2LKNA 3O5LA 2VN1A 1A7XA 4W9OA 4C02B 5HKGA 4GIVA 4MGVA 1NMVA 3UI4A 4IQCA 1FKIA 1W26A 5HUAA 1QZ2A 3I6CA 4ODLA 4J4OA 2PV1A 5DITA 3CGMA 1FD9A 3MDYB 1J6YA 1C9HA 4ODKA 3TCZA 4DH0A 2XP3A 4R0XA 2RSEA
chains in the Genus database with same CATH superfamily
2FKEA 3O5QA 3TC5A 4WKFA 2A3CA 1XRVA 4MNKA 4U85A 1OGBA 1HKJA 3WD1A 1GUVA 3ARRA 1K9TA 2DG4A 1E6ZA 4IT4A 2WK2A 4HBEA 3KCEA 4HBOA 4URIA 4U84A 3O5PA 1J4HA 3O5JA 3CHFA 2ESCA 5DEZA 4JYSA 4QZVB 1W1YA 3TDBA 3PR9A 4DRNA 3NRKA 4DIPA 4DRIA 3ARQA 2Y78A 2XP5A 1GOIA 1ZL1A 1FKRA 3RM9A 1H0IA 2XP4A 1FJDA 2MNTA 1BL4A 3LUOA 4Z2GA 4LAXA 1U79A 1H0GA 2AWGA 4DWSC 1FKJA 4DRQA 1GPFA 3JXVA 1WAWA 1UR9A 1VF8A 4P8WA 2O92A 4IPXA 1HJXA 3KAFA 3ODKA 3O5RA 2M1IA 1HJWA 3WD2A 4JFKA 3AS1A 4ZPVR 2MLYA 3G6LA 3ARXA 4J4NA 4BF8A 5HW7A 3B9EA 4L3NA 1R9HA 4P8UA 3PRBA 4TYOA 2ZQSA 3B7XA 3CHEA 4W5UA 1P5QA 2D9FA 2DSZA 4ODPA 3AROA 3ALFA 4QT2A 4TNSA 4TW6A 2ZQUA 2DT3A 1JNDA 3UQBA 1E9LA 1D7IA 1ITXA 2MLXA 1W9PA 4Q7NA 3WQVA 3FXYA 4C02B 3G6MA 1NMVA 4KR0B 1W26A 4MNLA 5DITA 4P8XA 1FD9A 1J6YA 4DH0A 2RSEA 1TFVA 2RUQA 1X6NA 3O5DA 2PV3A 2WLZA 4NNRA 1FKDA 3O5OA 1SYTA 2KO7A 2OLHA 1HXVA 1NWTA 1WB0A 1W1PA 2G8ZA 3WIJA 1KT0A 3KAHA 4AY1A 1ZBKA 4W9QA 1EQ3A 2PV2A 2WM0A 4JFJA 2OFNA 1NSGA 2G41A 1EDQA 4G2PA 1QPFA 4MPKA 2DT2A 4FAPA 4DT4A 4U86A 2ITKA 5BXJA 5HW6A 3ARYA 3FY1A 1XHGA 3ARSA 3UQAA 4DRJA 1ROTA 3O5KA 2MLZA 1SR0A 3WL1A 5HWCA 2L2SA 2A3AA 1JNSA 2ZQVA 4WIWA 1NWUA 1FKKA 1ZBWA 3CZ8A 1W1TA 2ZQTA 4DWSD 2RUDA 4DROA 1LJYA 4ZPWR 3EIPA 2M08A 3ARVA 3AS0A 5DIVA 5HW8A 3ARZA 2A3EA 4Z2LA 4N19A 2XP8A 4Z2HA 3RM8A 3KAGA 3FAPA 1LL6A 3O5MA 3UI6A 4DWSA 1CTNA 1Q6HA 2EULA 3ARUA 1LL7A 3OOBA 4IT6A 4ODNA 4QT3A 1FKFA 2ZR4A 3RM4A 3JYMA 3WD4A 1PBKA 3O5IA 4TX0A 1NWRA 4WJXA 3W4RA 4LAVA 4S3JA 2RUCA 4Z2JA 1NH6A 2VCDA 1LQ0A 1FKTA 3RGCA 1RD6A 3VAWA 1F40A 4MAVA 2FAPA 2PN0A 1OWQA 2F21A 1KFWA 2A3BA 2DT0A 4MTVA 2WLYA 5HKGA 4MGVA 4IQCA 3B9AA 2PI6A 2PV1A 1JCHB 3MDYB 3ALGA 2XP3A 4KQZA 2LJ4A 1UR8A 1ZBCA 2IF4A 3WD3A 1LG2A 1X6LA 1YATA 2KGJA 3ARWA 3PA7A 1E44A 4S3KA 4ZS6A 1FKHA 4JFMA 4TW8A 3GTYX 2F4EA 2K8IA 2XP7A 3RMEA 4GGQA 1W9VA 1B6CA 1LG1A 5D75A 3CHDA 1ZCNA 2QF8A 1FAPA 4ITZA 5JH8A 1JNEA 4ODMA 1IX5A 3OA5A 1M5YA 4ZPTR 2ETNA 4LAYA 3JYJA 1Q1CA 5HBFA 4Z2IA 2MPHA 2LPVA 3AQUA 2P4VA 3ARTA 2JZVA 1D7HA 2DSUA 1J4RA 3KZ7A 1BKFA 3WQWA 5HWBA 1LL4A 2IUZA 4DZ3A 1PINA 2O9OA 2XPBA 3CHCA 3AS2A 3EY6A 4ODRA 2DG9A 4IQ2A 1J4IA 4ODQA 5HTGA 1O6IA 3BMBA 3IK8A 2DT1A 3QOKA 5GPRA 4PTMA 3PRDA 4Z2KA 1TCOC 2UZ5A 2B5UB 1W1VA 3UF8A 1ZB5A 4JFIA 3O5FA 3KAIA 1T11A 1ZU8A 3ARPA 1YW5A 4XAKA 1EIBA 3UI5A 2KFWA 1E15A 1OGGA 1EHNA 2XP6A 2M2AA 3WH0A 1L1PA 3WL0A 4MNMA 2YBTA 1W9UA 2PPOA 3GPKA 3O5GA 2KE0A 2DPEA 4DWSB 1Y0OA 1KT1A 2XPAA 3O5LA 2VN1A 4L72B 4W9OA 3UI4A 1E6PA 1ZBVA 5HUAA 3I6CA 4J4OA 3BXWA 4ODKA 3TCZA 3CH9A 4DRKA 4R0XA 1ZK6A 1E6NA 5DIUA 4MNJA 2PPPA 3H9RB 1ROUA 4MSPA 1FFRA 3CGNA 4JFLA 1FKGA 1HJVA 3WKZA 4UDMA 3NI6A 2ZR6A 2PBCA 4DRMA 5J6EA 3IKDA 1FKLA 1N1AA 3UQIA 3KADA 3IKGA 4TW7A 3KABA 5DF0A 2F2DA 4G50A 1HKIA 1D7JA 4O2TA 2DSVA 1EYMA 1FFQA 5I98A 5GQBA 4WKAA 2ZR5A 2RQSA 3IHZA 2DG3A 2PPNA 2AOSA 1D6OA 3WD0A 2MF9A 2XP9A 3O5EA 2KR7A 4DZ2A 1QPLA 5DO2A 4WKHA 5GPGA 1GRJA 2DSWA 2FDMA 2LGOA 2Q5AA 4LGXA 3NTPA 4QIBA 5HT1A 4DRHA 1HKMA 2RURA 5B8IC 4FN2A 1Q6IA 4Q22A 3RFWA 2F23A 3KACA 4W9PA 1Q6UA 4LAWA 4ODOA 1D2KA 1E6RA 1WNOA 1JNTA 2N87A 3PRAA 4ML4A 1NWSA 4R5EA 3B8SA 2YBUA 1FKSA 3AS3A 4DRPA 2KI3A 1JVWA 1FKBA 1HKKA 1NMWA 3B9DA 4NZCA 4P8VA 1F8AB 2LKNA 1A7XA 4GIVA 1FKIA 2B31A 4HARA 1QZ2A 4ODLA 4WK9A 3CGMA 1C9HA 3GU0A 4NSBA
chains in the Genus database with same CATH topology
2FKEA 3O5QA 3TC5A 4WKFA 2A3CA 1XRVA 4MNKA 4U85A 1OGBA 1HKJA 3WD1A 1GUVA 3ARRA 1K9TA 2DG4A 1E6ZA 4IT4A 2WK2A 4HBEA 3KCEA 4HBOA 4URIA 4U84A 3O5PA 1J4HA 3O5JA 3CHFA 2ESCA 5DEZA 4JYSA 4QZVB 1W1YA 3TDBA 3PR9A 4DRNA 3NRKA 4DIPA 4DRIA 3ARQA 2Y78A 2XP5A 1GOIA 1ZL1A 1FKRA 3RM9A 1H0IA 2XP4A 1FJDA 2MNTA 1BL4A 3LUOA 4Z2GA 4LAXA 1U79A 1H0GA 2AWGA 4DWSC 1FKJA 4DRQA 1GPFA 3JXVA 1WAWA 1UR9A 1VF8A 4P8WA 2O92A 4IPXA 1HJXA 3KAFA 3ODKA 3O5RA 2M1IA 1HJWA 3WD2A 4JFKA 3AS1A 4ZPVR 2MLYA 3G6LA 3ARXA 4J4NA 4BF8A 5HW7A 3B9EA 4L3NA 1R9HA 4P8UA 3PRBA 4TYOA 2ZQSA 3B7XA 3CHEA 4W5UA 1P5QA 2D9FA 2DSZA 4ODPA 3AROA 3ALFA 4QT2A 4TNSA 4TW6A 2ZQUA 2DT3A 1JNDA 3UQBA 1E9LA 1D7IA 1ITXA 2MLXA 1W9PA 4Q7NA 3WQVA 3FXYA 4C02B 3G6MA 1NMVA 4KR0B 1W26A 4MNLA 5DITA 4P8XA 1FD9A 1J6YA 4DH0A 2RSEA 1TFVA 2RUQA 1X6NA 3O5DA 2PV3A 2WLZA 4NNRA 1FKDA 3O5OA 1SYTA 2KO7A 2OLHA 1HXVA 1NWTA 1WB0A 1W1PA 2G8ZA 3WIJA 1KT0A 3KAHA 4AY1A 1ZBKA 4W9QA 1EQ3A 2PV2A 2WM0A 4JFJA 2OFNA 1NSGA 2G41A 1EDQA 4G2PA 1QPFA 4MPKA 2DT2A 4FAPA 4DT4A 4U86A 2ITKA 5BXJA 5HW6A 3ARYA 3FY1A 1XHGA 3ARSA 3UQAA 4DRJA 1ROTA 3O5KA 2MLZA 1SR0A 3WL1A 5HWCA 2L2SA 2A3AA 1JNSA 2ZQVA 4WIWA 1NWUA 1FKKA 1ZBWA 3CZ8A 1W1TA 2ZQTA 4DWSD 2RUDA 4DROA 1LJYA 4ZPWR 2M08A 3ARVA 3AS0A 5DIVA 5HW8A 3ARZA 2A3EA 4Z2LA 4N19A 2XP8A 4Z2HA 3RM8A 3KAGA 3FAPA 1LL6A 3O5MA 3UI6A 4DWSA 1CTNA 1Q6HA 3ARUA 1LL7A 3OOBA 4IT6A 4ODNA 4QT3A 1FKFA 2ZR4A 3RM4A 3JYMA 3WD4A 1PBKA 3O5IA 4TX0A 1NWRA 4WJXA 3W4RA 4LAVA 4S3JA 2RUCA 4Z2JA 1NH6A 2VCDA 1LQ0A 1FKTA 3RGCA 1RD6A 3VAWA 1F40A 4MAVA 2FAPA 1OWQA 2F21A 1KFWA 2A3BA 2DT0A 4MTVA 2WLYA 5HKGA 4MGVA 4IQCA 3B9AA 2PI6A 2PV1A 3MDYB 3ALGA 4KQZA 2XP3A 2LJ4A 1UR8A 1ZBCA 2IF4A 3WD3A 1LG2A 1X6LA 1YATA 2KGJA 3ARWA 3PA7A 4S3KA 4ZS6A 1FKHA 4JFMA 4TW8A 2F4EA 2K8IA 2XP7A 3RMEA 4GGQA 1W9VA 1B6CA 1LG1A 5D75A 3CHDA 1ZCNA 2QF8A 1FAPA 4ITZA 5JH8A 1JNEA 4ODMA 1IX5A 3OA5A 1M5YA 4ZPTR 4LAYA 3JYJA 1Q1CA 5HBFA 4Z2IA 2MPHA 2LPVA 3AQUA 3ARTA 2JZVA 1D7HA 2DSUA 1J4RA 3KZ7A 1BKFA 3WQWA 5HWBA 1LL4A 2IUZA 4DZ3A 1PINA 2O9OA 2XPBA 3CHCA 3AS2A 3EY6A 4ODRA 2DG9A 4IQ2A 1J4IA 4ODQA 5HTGA 1O6IA 3IK8A 2DT1A 3QOKA 5GPRA 4PTMA 3PRDA 4Z2KA 1TCOC 2UZ5A 3UF8A 1W1VA 1ZB5A 4JFIA 3O5FA 3KAIA 1T11A 1ZU8A 3ARPA 1YW5A 4XAKA 1EIBA 3UI5A 2KFWA 1E15A 1OGGA 1EHNA 2XP6A 2M2AA 3WH0A 1L1PA 3WL0A 4MNMA 2YBTA 1W9UA 2PPOA 3GPKA 3O5GA 2KE0A 2DPEA 4DWSB 1Y0OA 1KT1A 2XPAA 3O5LA 2VN1A 4L72B 4W9OA 3UI4A 1E6PA 1ZBVA 5HUAA 3I6CA 4J4OA 3BXWA 4ODKA 3TCZA 3CH9A 4DRKA 4R0XA 1ZK6A 1E6NA 5DIUA 4MNJA 2PPPA 3H9RB 1ROUA 4MSPA 1FFRA 3CGNA 4JFLA 1FKGA 1HJVA 3WKZA 3NI6A 2ZR6A 2PBCA 4DRMA 5J6EA 3IKDA 1FKLA 1N1AA 3UQIA 3KADA 3IKGA 4TW7A 3KABA 5DF0A 2F2DA 4G50A 1HKIA 1D7JA 4O2TA 2DSVA 1EYMA 1FFQA 5I98A 5GQBA 4WKAA 2ZR5A 2RQSA 3IHZA 2DG3A 2PPNA 2AOSA 1D6OA 3WD0A 2MF9A 2XP9A 3O5EA 2KR7A 4DZ2A 1QPLA 5DO2A 4WKHA 5GPGA 2DSWA 2FDMA 2LGOA 2Q5AA 4LGXA 3NTPA 4QIBA 5HT1A 4DRHA 1HKMA 2RURA 5B8IC 4FN2A 1Q6IA 4Q22A 3RFWA 3KACA 4W9PA 1Q6UA 4LAWA 4ODOA 1D2KA 1E6RA 1WNOA 1JNTA 2N87A 3PRAA 4ML4A 1NWSA 4R5EA 3B8SA 2YBUA 1FKSA 3AS3A 4DRPA 2KI3A 1JVWA 1FKBA 1HKKA 1NMWA 3B9DA 4NZCA 4P8VA 1F8AB 2LKNA 1A7XA 4GIVA 1FKIA 2B31A 4HARA 1QZ2A 4ODLA 4WK9A 3CGMA 1C9HA 4NSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  1ZK6 A;  3O5Q A;  3TC5 A;  2RUQ A;  2LJ4 A;  5DIU A;  3O5D A;  2IF4 A;  2PPP A;  4U85 A;  2PV3 A;  4NNR A;  3H9R B;  1ROU A;  4MSP A;  1YAT A;  1FKD A;  2KGJ A;  2KO7 A;  3O5O A;  2DG4 A;  3PA7 A;  1HXV A;  3CGN A;  4JFL A;  1FKG A;  1FKH A;  4JFM A;  3KCE A;  4TW8 A;  1KT0 A;  3KAH A;  2F4E A;  3NI6 A;  4U84 A;  2K8I A;  2ZR6 A;  3O5P A;  2PBC A;  1J4H A;  4DRM A;  2XP7 A;  3O5J A;  4W9Q A;  4GGQ A;  2PV2 A;  5J6E A;  1EQ3 A;  3IKD A;  4JFJ A;  1B6C A;  4JYS A;  2OFN A;  1NSG A;  1FKL A;  5D75 A;  1N1A A;  3UQI A;  1ZCN A;  3KAD A;  3TDB A;  3IKG A;  4G2P A;  1FAP A;  1QPF A;  4ITZ A;  4TW7 A;  4DRN A;  3NRK A;  4ODM A;  4FAP A;  3KAB A;  4DIP A;  1M5Y A;  4DT4 A;  2F2D A;  4U86 A;  4DRI A;  2ITK A;  2Y78 A;  1D7J A;  2XP5 A;  4G50 A;  4LAY A;  5BXJ A;  1FKR A;  5HW6 A;  4O2T A;  2XP4 A;  3JYJ A;  1Q1C A;  1FJD A;  2MNT A;  2MPH A;  1EYM A;  2LPV A;  1BL4 A;  3LUO A;  3UQA A;  4LAX A;  1U79 A;  4DRJ A;  5I98 A;  2AWG A;  2JZV A;  1ROT A;  1D7H A;  3O5K A;  2MLZ A;  1FKJ A;  1J4R A;  5HWC A;  2ZR5 A;  2RQS A;  3IHZ A;  3KZ7 A;  1BKF A;  2L2S A;  4DRQ A;  2ZQV A;  1JNS A;  2DG3 A;  3JXV A;  5HWB A;  1FKK A;  2PPN A;  4DZ3 A;  1PIN A;  1D6O A;  2ZQT A;  4IPX A;  2XPB A;  2MF9 A;  2XP9 A;  3O5E A;  2KR7 A;  3KAF A;  4DZ2 A;  2RUD A;  3ODK A;  4DRO A;  3O5R A;  3EY6 A;  1QPL A;  2M1I A;  4JFK A;  2DG9 A;  4ODR A;  2M08 A;  4IQ2 A;  1J4I A;  4ODQ A;  2MLY A;  5DIV A;  5GPG A;  5HW8 A;  5HTG A;  4J4N A;  4BF8 A;  5HW7 A;  4N19 A;  2XP8 A;  2LGO A;  2Q5A A;  3IK8 A;  3NTP A;  1R9H A;  4QIB A;  5HT1 A;  3PRB A;  3KAG A;  4TYO A;  4DRH A;  2ZQS A;  3PRD A;  3FAP A;  1TCO C;  2UZ5 A;  3O5M A;  3UF8 A;  3UI6 A;  1Q6H A;  2RUR A;  3B7X A;  5B8I C;  4FN2 A;  4JFI A;  3OOB A;  1P5Q A;  1Q6I A;  2D9F A;  1FKF A;  2ZR4 A;  3KAI A;  1T11 A;  3O5F A;  4ODN A;  3KAC A;  3JYM A;  4QT3 A;  4W9P A;  3RFW A;  1PBK A;  1Q6U A;  3O5I A;  4LAW A;  4ODO A;  1JNT A;  1YW5 A;  4ODP A;  4TX0 A;  3UI5 A;  2KFW A;  2N87 A;  4DRK A;  4LAV A;  2XP6 A;  2RUC A;  2M2A A;  3WH0 A;  1L1P A;  2PPO A;  3GPK A;  3O5G A;  4QT2 A;  4TNS A;  4TW6 A;  2KE0 A;  1FKS A;  4DRP A;  2VCD A;  2KI3 A;  1JVW A;  2ZQU A;  1FKB A;  3UQB A;  1FKT A;  1Y0O A;  3RGC A;  3VAW A;  1F40 A;  1NMW A;  2FAP A;  1D7I A;  2F21 A;  1KT1 A;  2XPA A;  2MLX A;  1F8A B;  2LKN A;  3O5L A;  2VN1 A;  1A7X A;  4W9O A;  4C02 B;  5HKG A;  4GIV A;  4MGV A;  1NMV A;  3UI4 A;  4IQC A;  1FKI A;  1W26 A;  5HUA A;  1QZ2 A;  3I6C A;  4ODL A;  4J4O A;  2PV1 A;  5DIT A;  3CGM A;  1FD9 A;  3MDY B;  1J6Y A;  1C9H A;  4ODK A;  3TCZ A;  4DH0 A;  2XP3 A;  4R0X A;  2RSE A; 
#chains in the Genus database with same CATH topology
 2FKE A;  3O5Q A;  3TC5 A;  4WKF A;  2A3C A;  1XRV A;  4MNK A;  4U85 A;  1OGB A;  1HKJ A;  3WD1 A;  1GUV A;  3ARR A;  1K9T A;  2DG4 A;  1E6Z A;  4IT4 A;  2WK2 A;  4HBE A;  3KCE A;  4HBO A;  4URI A;  4U84 A;  3O5P A;  1J4H A;  3O5J A;  3CHF A;  2ESC A;  5DEZ A;  4JYS A;  4QZV B;  1W1Y A;  3TDB A;  3PR9 A;  4DRN A;  3NRK A;  4DIP A;  4DRI A;  3ARQ A;  2Y78 A;  2XP5 A;  1GOI A;  1ZL1 A;  1FKR A;  3RM9 A;  1H0I A;  2XP4 A;  1FJD A;  2MNT A;  1BL4 A;  3LUO A;  4Z2G A;  4LAX A;  1U79 A;  1H0G A;  2AWG A;  4DWS C;  1FKJ A;  4DRQ A;  1GPF A;  3JXV A;  1WAW A;  1UR9 A;  1VF8 A;  4P8W A;  2O92 A;  4IPX A;  1HJX A;  3KAF A;  3ODK A;  3O5R A;  2M1I A;  1HJW A;  3WD2 A;  4JFK A;  3AS1 A;  4ZPV R;  2MLY A;  3G6L A;  3ARX A;  4J4N A;  4BF8 A;  5HW7 A;  3B9E A;  4L3N A;  1R9H A;  4P8U A;  3PRB A;  4TYO A;  2ZQS A;  3B7X A;  3CHE A;  4W5U A;  1P5Q A;  2D9F A;  2DSZ A;  4ODP A;  3ARO A;  3ALF A;  4QT2 A;  4TNS A;  4TW6 A;  2ZQU A;  2DT3 A;  1JND A;  3UQB A;  1E9L A;  1D7I A;  1ITX A;  2MLX A;  1W9P A;  4Q7N A;  3WQV A;  3FXY A;  4C02 B;  3G6M A;  1NMV A;  4KR0 B;  1W26 A;  4MNL A;  5DIT A;  4P8X A;  1FD9 A;  1J6Y A;  4DH0 A;  2RSE A;  1TFV A;  2RUQ A;  1X6N A;  3O5D A;  2PV3 A;  2WLZ A;  4NNR A;  1FKD A;  3O5O A;  1SYT A;  2KO7 A;  2OLH A;  1HXV A;  1NWT A;  1WB0 A;  1W1P A;  2G8Z A;  3WIJ A;  1KT0 A;  3KAH A;  4AY1 A;  1ZBK A;  4W9Q A;  1EQ3 A;  2PV2 A;  2WM0 A;  4JFJ A;  2OFN A;  1NSG A;  2G41 A;  1EDQ A;  4G2P A;  1QPF A;  4MPK A;  2DT2 A;  4FAP A;  4DT4 A;  4U86 A;  2ITK A;  5BXJ A;  5HW6 A;  3ARY A;  3FY1 A;  1XHG A;  3ARS A;  3UQA A;  4DRJ A;  1ROT A;  3O5K A;  2MLZ A;  1SR0 A;  3WL1 A;  5HWC A;  2L2S A;  2A3A A;  1JNS A;  2ZQV A;  4WIW A;  1NWU A;  1FKK A;  1ZBW A;  3CZ8 A;  1W1T A;  2ZQT A;  4DWS D;  2RUD A;  4DRO A;  1LJY A;  4ZPW R;  3EIP A;  2M08 A;  3ARV A;  3AS0 A;  5DIV A;  5HW8 A;  3ARZ A;  2A3E A;  4Z2L A;  4N19 A;  2XP8 A;  4Z2H A;  3RM8 A;  3KAG A;  3FAP A;  1LL6 A;  3O5M A;  3UI6 A;  4DWS A;  1CTN A;  1Q6H A;  2EUL A;  3ARU A;  1LL7 A;  3OOB A;  4IT6 A;  4ODN A;  4QT3 A;  1FKF A;  2ZR4 A;  3RM4 A;  3JYM A;  3WD4 A;  1PBK A;  3O5I A;  4TX0 A;  1NWR A;  4WJX A;  3W4R A;  4LAV A;  4S3J A;  2RUC A;  4Z2J A;  1NH6 A;  2VCD A;  1LQ0 A;  1FKT A;  3RGC A;  1RD6 A;  3VAW A;  1F40 A;  4MAV A;  2FAP A;  2PN0 A;  1OWQ A;  2F21 A;  1KFW A;  2A3B A;  2DT0 A;  4MTV A;  2WLY A;  5HKG A;  4MGV A;  4IQC A;  3B9A A;  2PI6 A;  2PV1 A;  1JCH B;  3MDY B;  3ALG A;  2XP3 A;  4KQZ A;  2LJ4 A;  1UR8 A;  1ZBC A;  2IF4 A;  3WD3 A;  1LG2 A;  1X6L A;  1YAT A;  2KGJ A;  3ARW A;  3PA7 A;  1E44 A;  4S3K A;  4ZS6 A;  1FKH A;  4JFM A;  4TW8 A;  3GTY X;  2F4E A;  2K8I A;  2XP7 A;  3RME A;  4GGQ A;  1W9V A;  1B6C A;  1LG1 A;  5D75 A;  3CHD A;  1ZCN A;  2QF8 A;  1FAP A;  4ITZ A;  5JH8 A;  1JNE A;  4ODM A;  1IX5 A;  3OA5 A;  1M5Y A;  4ZPT R;  2ETN A;  4LAY A;  3JYJ A;  1Q1C A;  5HBF A;  4Z2I A;  2MPH A;  2LPV A;  3AQU A;  2P4V A;  3ART A;  2JZV A;  1D7H A;  2DSU A;  1J4R A;  3KZ7 A;  1BKF A;  3WQW A;  5HWB A;  1LL4 A;  2IUZ A;  4DZ3 A;  1PIN A;  2O9O A;  2XPB A;  3CHC A;  3AS2 A;  3EY6 A;  4ODR A;  2DG9 A;  4IQ2 A;  1J4I A;  4ODQ A;  5HTG A;  1O6I A;  3BMB A;  3IK8 A;  2DT1 A;  3QOK A;  5GPR A;  4PTM A;  3PRD A;  4Z2K A;  1TCO C;  2UZ5 A;  2B5U B;  1W1V A;  3UF8 A;  1ZB5 A;  4JFI A;  3O5F A;  3KAI A;  1T11 A;  1ZU8 A;  3ARP A;  1YW5 A;  4XAK A;  1EIB A;  3UI5 A;  2KFW A;  1E15 A;  1OGG A;  1EHN A;  2XP6 A;  2M2A A;  3WH0 A;  1L1P A;  3WL0 A;  4MNM A;  2YBT A;  1W9U A;  2PPO A;  3GPK A;  3O5G A;  2KE0 A;  2DPE A;  4DWS B;  1Y0O A;  1KT1 A;  2XPA A;  3O5L A;  2VN1 A;  4L72 B;  4W9O A;  3UI4 A;  1E6P A;  1ZBV A;  5HUA A;  3I6C A;  4J4O A;  3BXW A;  4ODK A;  3TCZ A;  3CH9 A;  4DRK A;  4R0X A;  1ZK6 A;  1E6N A;  5DIU A;  4MNJ A;  2PPP A;  3H9R B;  1ROU A;  4MSP A;  1FFR A;  3CGN A;  4JFL A;  1FKG A;  1HJV A;  3WKZ A;  4UDM A;  3NI6 A;  2ZR6 A;  2PBC A;  4DRM A;  5J6E A;  3IKD A;  1FKL A;  1N1A A;  3UQI A;  3KAD A;  3IKG A;  4TW7 A;  3KAB A;  5DF0 A;  2F2D A;  4G50 A;  1HKI A;  1D7J A;  4O2T A;  2DSV A;  1EYM A;  1FFQ A;  5I98 A;  5GQB A;  4WKA A;  2ZR5 A;  2RQS A;  3IHZ A;  2DG3 A;  2PPN A;  2AOS A;  1D6O A;  3WD0 A;  2MF9 A;  2XP9 A;  3O5E A;  2KR7 A;  4DZ2 A;  1QPL A;  5DO2 A;  4WKH A;  5GPG A;  1GRJ A;  2DSW A;  2FDM A;  2LGO A;  2Q5A A;  4LGX A;  3NTP A;  4QIB A;  5HT1 A;  4DRH A;  1HKM A;  2RUR A;  5B8I C;  4FN2 A;  1Q6I A;  4Q22 A;  3RFW A;  2F23 A;  3KAC A;  4W9P A;  1Q6U A;  4LAW A;  4ODO A;  1D2K A;  1E6R A;  1WNO A;  1JNT A;  2N87 A;  3PRA A;  4ML4 A;  1NWS A;  4R5E A;  3B8S A;  2YBU A;  1FKS A;  3AS3 A;  4DRP A;  2KI3 A;  1JVW A;  1FKB A;  1HKK A;  1NMW A;  3B9D A;  4NZC A;  4P8V A;  1F8A B;  2LKN A;  1A7X A;  4GIV A;  1FKI A;  2B31 A;  4HAR A;  1QZ2 A;  4ODL A;  4WK9 A;  3CGM A;  1C9H A;  3GU0 A;  4NSB A; 
#chains in the Genus database with same CATH homology
 2FKE A;  3O5Q A;  3TC5 A;  4WKF A;  2A3C A;  1XRV A;  4MNK A;  4U85 A;  1OGB A;  1HKJ A;  3WD1 A;  1GUV A;  3ARR A;  1K9T A;  2DG4 A;  1E6Z A;  4IT4 A;  2WK2 A;  4HBE A;  3KCE A;  4HBO A;  4URI A;  4U84 A;  3O5P A;  1J4H A;  3O5J A;  3CHF A;  2ESC A;  5DEZ A;  4JYS A;  4QZV B;  1W1Y A;  3TDB A;  3PR9 A;  4DRN A;  3NRK A;  4DIP A;  4DRI A;  3ARQ A;  2Y78 A;  2XP5 A;  1GOI A;  1ZL1 A;  1FKR A;  3RM9 A;  1H0I A;  2XP4 A;  1FJD A;  2MNT A;  1BL4 A;  3LUO A;  4Z2G A;  4LAX A;  1U79 A;  1H0G A;  2AWG A;  4DWS C;  1FKJ A;  4DRQ A;  1GPF A;  3JXV A;  1WAW A;  1UR9 A;  1VF8 A;  4P8W A;  2O92 A;  4IPX A;  1HJX A;  3KAF A;  3ODK A;  3O5R A;  2M1I A;  1HJW A;  3WD2 A;  4JFK A;  3AS1 A;  4ZPV R;  2MLY A;  3G6L A;  3ARX A;  4J4N A;  4BF8 A;  5HW7 A;  3B9E A;  4L3N A;  1R9H A;  4P8U A;  3PRB A;  4TYO A;  2ZQS A;  3B7X A;  3CHE A;  4W5U A;  1P5Q A;  2D9F A;  2DSZ A;  4ODP A;  3ARO A;  3ALF A;  4QT2 A;  4TNS A;  4TW6 A;  2ZQU A;  2DT3 A;  1JND A;  3UQB A;  1E9L A;  1D7I A;  1ITX A;  2MLX A;  1W9P A;  4Q7N A;  3WQV A;  3FXY A;  4C02 B;  3G6M A;  1NMV A;  4KR0 B;  1W26 A;  4MNL A;  5DIT A;  4P8X A;  1FD9 A;  1J6Y A;  4DH0 A;  2RSE A;  1TFV A;  2RUQ A;  1X6N A;  3O5D A;  2PV3 A;  2WLZ A;  4NNR A;  1FKD A;  3O5O A;  1SYT A;  2KO7 A;  2OLH A;  1HXV A;  1NWT A;  1WB0 A;  1W1P A;  2G8Z A;  3WIJ A;  1KT0 A;  3KAH A;  4AY1 A;  1ZBK A;  4W9Q A;  1EQ3 A;  2PV2 A;  2WM0 A;  4JFJ A;  2OFN A;  1NSG A;  2G41 A;  1EDQ A;  4G2P A;  1QPF A;  4MPK A;  2DT2 A;  4FAP A;  4DT4 A;  4U86 A;  2ITK A;  5BXJ A;  5HW6 A;  3ARY A;  3FY1 A;  1XHG A;  3ARS A;  3UQA A;  4DRJ A;  1ROT A;  3O5K A;  2MLZ A;  1SR0 A;  3WL1 A;  5HWC A;  2L2S A;  2A3A A;  1JNS A;  2ZQV A;  4WIW A;  1NWU A;  1FKK A;  1ZBW A;  3CZ8 A;  1W1T A;  2ZQT A;  4DWS D;  2RUD A;  4DRO A;  1LJY A;  4ZPW R;  2M08 A;  3ARV A;  3AS0 A;  5DIV A;  5HW8 A;  3ARZ A;  2A3E A;  4Z2L A;  4N19 A;  2XP8 A;  4Z2H A;  3RM8 A;  3KAG A;  3FAP A;  1LL6 A;  3O5M A;  3UI6 A;  4DWS A;  1CTN A;  1Q6H A;  3ARU A;  1LL7 A;  3OOB A;  4IT6 A;  4ODN A;  4QT3 A;  1FKF A;  2ZR4 A;  3RM4 A;  3JYM A;  3WD4 A;  1PBK A;  3O5I A;  4TX0 A;  1NWR A;  4WJX A;  3W4R A;  4LAV A;  4S3J A;  2RUC A;  4Z2J A;  1NH6 A;  2VCD A;  1LQ0 A;  1FKT A;  3RGC A;  1RD6 A;  3VAW A;  1F40 A;  4MAV A;  2FAP A;  1OWQ A;  2F21 A;  1KFW A;  2A3B A;  2DT0 A;  4MTV A;  2WLY A;  5HKG A;  4MGV A;  4IQC A;  3B9A A;  2PI6 A;  2PV1 A;  3MDY B;  3ALG A;  4KQZ A;  2XP3 A;  2LJ4 A;  1UR8 A;  1ZBC A;  2IF4 A;  3WD3 A;  1LG2 A;  1X6L A;  1YAT A;  2KGJ A;  3ARW A;  3PA7 A;  4S3K A;  4ZS6 A;  1FKH A;  4JFM A;  4TW8 A;  2F4E A;  2K8I A;  2XP7 A;  3RME A;  4GGQ A;  1W9V A;  1B6C A;  1LG1 A;  5D75 A;  3CHD A;  1ZCN A;  2QF8 A;  1FAP A;  4ITZ A;  5JH8 A;  1JNE A;  4ODM A;  1IX5 A;  3OA5 A;  1M5Y A;  4ZPT R;  4LAY A;  3JYJ A;  1Q1C A;  5HBF A;  4Z2I A;  2MPH A;  2LPV A;  3AQU A;  3ART A;  2JZV A;  1D7H A;  2DSU A;  1J4R A;  3KZ7 A;  1BKF A;  3WQW A;  5HWB A;  1LL4 A;  2IUZ A;  4DZ3 A;  1PIN A;  2O9O A;  2XPB A;  3CHC A;  3AS2 A;  3EY6 A;  4ODR A;  2DG9 A;  4IQ2 A;  1J4I A;  4ODQ A;  5HTG A;  1O6I A;  3IK8 A;  2DT1 A;  3QOK A;  5GPR A;  4PTM A;  3PRD A;  4Z2K A;  1TCO C;  2UZ5 A;  3UF8 A;  1W1V A;  1ZB5 A;  4JFI A;  3O5F A;  3KAI A;  1T11 A;  1ZU8 A;  3ARP A;  1YW5 A;  4XAK A;  1EIB A;  3UI5 A;  2KFW A;  1E15 A;  1OGG A;  1EHN A;  2XP6 A;  2M2A A;  3WH0 A;  1L1P A;  3WL0 A;  4MNM A;  2YBT A;  1W9U A;  2PPO A;  3GPK A;  3O5G A;  2KE0 A;  2DPE A;  4DWS B;  1Y0O A;  1KT1 A;  2XPA A;  3O5L A;  2VN1 A;  4L72 B;  4W9O A;  3UI4 A;  1E6P A;  1ZBV A;  5HUA A;  3I6C A;  4J4O A;  3BXW A;  4ODK A;  3TCZ A;  3CH9 A;  4DRK A;  4R0X A;  1ZK6 A;  1E6N A;  5DIU A;  4MNJ A;  2PPP A;  3H9R B;  1ROU A;  4MSP A;  1FFR A;  3CGN A;  4JFL A;  1FKG A;  1HJV A;  3WKZ A;  3NI6 A;  2ZR6 A;  2PBC A;  4DRM A;  5J6E A;  3IKD A;  1FKL A;  1N1A A;  3UQI A;  3KAD A;  3IKG A;  4TW7 A;  3KAB A;  5DF0 A;  2F2D A;  4G50 A;  1HKI A;  1D7J A;  4O2T A;  2DSV A;  1EYM A;  1FFQ A;  5I98 A;  5GQB A;  4WKA A;  2ZR5 A;  2RQS A;  3IHZ A;  2DG3 A;  2PPN A;  2AOS A;  1D6O A;  3WD0 A;  2MF9 A;  2XP9 A;  3O5E A;  2KR7 A;  4DZ2 A;  1QPL A;  5DO2 A;  4WKH A;  5GPG A;  2DSW A;  2FDM A;  2LGO A;  2Q5A A;  4LGX A;  3NTP A;  4QIB A;  5HT1 A;  4DRH A;  1HKM A;  2RUR A;  5B8I C;  4FN2 A;  1Q6I A;  4Q22 A;  3RFW A;  3KAC A;  4W9P A;  1Q6U A;  4LAW A;  4ODO A;  1D2K A;  1E6R A;  1WNO A;  1JNT A;  2N87 A;  3PRA A;  4ML4 A;  1NWS A;  4R5E A;  3B8S A;  2YBU A;  1FKS A;  3AS3 A;  4DRP A;  2KI3 A;  1JVW A;  1FKB A;  1HKK A;  1NMW A;  3B9D A;  4NZC A;  4P8V A;  1F8A B;  2LKN A;  1A7X A;  4GIV A;  1FKI A;  2B31 A;  4HAR A;  1QZ2 A;  4ODL A;  4WK9 A;  3CGM A;  1C9H A;  4NSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...