2LJ4A

Solution structure of the tbpin1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MSEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase/rotamase, putative
publication title Solution Structural Analysis of the Single-Domain Parvulin TbPin1
doi rcsb
source organism Trypanosoma brucei
molecule tags Isomerase
total genus 28
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lj4A00
3O5MA 2KI3A 4U84A 5DITA 2D9FA 2L2SA 2ITKA 2MLZA 3OOBA 4JFJA 4U86A 1QPLA 2LGOA 2RQSA 4TYOA 3IKGA 3UQIA 4DROA 2ZQTA 5HW7A 4QT3A 1FD9A 3RGCA 2MNTA 4DRNA 2PPPA 4JFMA 1F40A 3O5IA 2XP8A 2F4EA 2RUCA 2KR7A 4G50A 4TW7A 3NI6A 4DZ2A 5DIUA 1FKKA 1PBKA 3O5RA 4W9OA 3JYJA 5D75A 2DG4A 2XP9A 2FKEA 3UI5A 2XP3A 3EY6A 4DT4A 2M1IA 1FKLA 3IHZA 4MSPA 4J4NA 2F2DA 4ODKA 2MPHA 3UF8A 1ROUA 3CGMA 1HXVA 2PPOA 1BL4A 2XP5A 5HT1A 4G2PA 3KADA 5HWBA 4TW8A 5B8IC 2XPBA 2PV3A 2FAPA 2RSEA 4JFKA 3VAWA 3LUOA 4MGVA 1L1PA 1D7HA 4DRKA 3B7XA 2XP7A 4DH0A 4DRJA 1M5YA 3KAGA 2F21A 1N1AA 5HUAA 4U85A 2MLXA 2ZQSA 3KAHA 4NNRA 4W9PA 2ZQUA 5GPGA 5I98A 3KAFA 2MLYA 1PINA 3H9RB 3O5FA 1FKGA 3UQBA 2XPAA 3RFWA 1KT1A 1EQ3A 4LAXA 4TX0A 1P5QA 2Q5AA 4FAPA 2Y78A 2N87A 3FAPA 2DG9A 2ZQVA 1FKHA 1FKBA 1D7JA 1QZ2A 4ITZA 1FJDA 4LAWA 1C9HA 2AWGA 2KE0A 1B6CA 2M08A 3UI4A 3UI6A 1FKSA 4TW6A 3JYMA 4DIPA 3O5QA 4W9QA 2ZR5A 2RUDA 3TCZA 4DRPA 4DRMA 3KACA 2RURA 1U79A 2ZR4A 1YATA 1YW5A 3PA7A 2JZVA 1FKJA 3IK8A 4QT2A 2KO7A 3UQAA 2KGJA 5BXJA 2MF9A 3O5DA 1Y0OA 2PV2A 1NMVA 1NMWA 4DRIA 1FKDA 5HKGA 3O5OA 2UZ5A 5J6EA 4ODMA 3I6CA 4TNSA 2LPVA 3O5KA 2LKNA 4IQ2A 4ODOA 1ZCNA 2KFWA 3PRDA 3MDYB 4IPXA 4GIVA 4ODLA 5DIVA 3WH0A 3GPKA 3JXVA 3KABA 3PRBA 1KT0A 4DRHA 2M2AA 2PBCA 3NRKA 4BF8A 2IF4A 1A7XA 3O5JA 5HTGA 3KAIA 1NSGA 4J4OA 4LAVA 4N19A 4ODRA 3TC5A 3O5LA 1Q1CA 5HWCA 3NTPA 3ODKA 2PPNA 1R9HA 2LJ4A 2OFNA 1JNSA 2DG3A 2K8IA 1FAPA 1D6OA 2XP6A 1TCOC 4LAYA 1F8AB 1ROTA 3KZ7A 3KCEA 4JFIA 4ODQA 5HW6A 1FKRA 3O5GA 4GGQA 1T11A 3TDBA 4DRQA 3O5EA 1EYMA 4ODNA 4C02B 4O2TA 4FN2A 1J4RA 4ODPA 1BKFA 1J4IA 2VN1A 2PV1A 1JNTA 1FKIA 2RUQA 4R0XA 4DZ3A 4JFLA 2VCDA 5HW8A 1J6YA 1JVWA 1J4HA 1W26A 1Q6UA 2ZR6A 1ZK6A 1Q6HA 2XP4A 1D7IA 4JYSA 3O5PA 3IKDA 4IQCA 1Q6IA 4QIBA 1QPFA 1FKFA 3CGNA 1FKTA
chains in the Genus database with same CATH superfamily
3O5MA 4ZPVR 1JCHB 2B5UB 1LL6A 2LGOA 4DROA 3WQWA 3RGCA 1OGGA 3O5IA 2ESCA 1HJXA 1PBKA 1W9PA 4W9OA 5DO2A 3UI5A 1ZB5A 1ZBCA 4DT4A 3GU0A 1BL4A 5HT1A 1FFQA 5HWBA 5B8IC 4JFKA 3VAWA 3LUOA 5JH8A 4R5EA 1L1PA 3B7XA 2A3BA 1NH6A 1M5YA 3AS3A 3KAGA 5HUAA 5I98A 3QOKA 3KAHA 4W9PA 3KAFA 1E6ZA 2MLYA 3O5FA 5DF0A 2XPAA 1IX5A 4LAXA 3WD0A 2QF8A 1W9UA 1FKBA 4LAWA 3UI4A 2M08A 4TW6A 3JYMA 2ZR5A 1WAWA 1YATA 3IK8A 1FKJA 3UQAA 5BXJA 3WD2A 1Y0OA 3W4RA 1NMVA 1NMWA 1FKDA 3O5OA 4ODMA 4IT4A 3O5KA 4IQ2A 4W5UA 3CHFA 2DT0A 3PRBA 4DRHA 1X6LA 1LQ0A 2M2AA 4WJXA 1A7XA 3KAIA 4NSBA 4ODRA 1H0GA 1W1TA 5HWCA 4HBOA 4IT6A 2O92A 1W1VA 1GRJA 2PPNA 1HKIA 1LJYA 2DG3A 1E6NA 1F8AB 1ROTA 4ODQA 3O5GA 1T11A 3TDBA 3O5EA 4C02B 2FDMA 1EIBA 4FN2A 1BKFA 1HXVA 2IUZA 5HW8A 3G6MA 4UDMA 2ZR6A 2DT2A 1ZK6A 2B31A 4ZPWR 1SYTA 1GPFA 1ZL1A 2ETNA 3RMEA 3AQUA 4QIBA 2DSWA 1UR8A 2D9FA 1X6NA 2MLZA 1QPLA 1W9VA 2RQSA 3IKGA 5HW7A 2DSZA 3WKZA 1ZU8A 4JFMA 2YBUA 2KR7A 1JNEA 4P8XA 1E15A 3JYJA 4WKHA 2XP9A 2DT3A 1E6PA 2F2DA 2MPHA 2PPOA 1ITXA 3EIPA 1ZBVA 4TW8A 2XPBA 2PV3A 1WNOA 1NWSA 2DPEA 2PN0A 4Z2GA 1D7HA 3ARUA 1H0IA 4DH0A 4DRJA 4MPKA 2MLXA 3RM9A 4DWSD 2Q5AA 1LL7A 2Y78A 2N87A 3FAPA 2ZQVA 1FKHA 1FJDA 4ITZA 2KE0A 1B6CA 3RM4A 1OWQA 3KACA 1NWTA 1U79A 1YW5A 2MF9A 4DRIA 2UZ5A 2WK2A 2AOSA 3I6CA 1TFVA 2DSUA 1KFWA 2LKNA 1ZCNA 2G41A 2KFWA 3MDYB 4GIVA 3JXVA 3WIJA 4Z2JA 1KT0A 1EDQA 3AS2A 4J4OA 4LAVA 4DWSA 4N19A 2A3EA 2OLHA 2OFNA 4P8UA 1JNSA 1W1PA 2WLZA 2K8IA 1HJVA 4LAYA 3WQVA 3KZ7A 3KCEA 4JFIA 4GGQA 4DRQA 1NWUA 1J4RA 4ODPA 2VN1A 2PV1A 1J6YA 4DZ3A 1JNDA 1Q6UA 2O9OA 1Q6HA 4WK9A 3B9EA 1LL4A 4IQCA 4MTVA 3TC5A 5DITA 2PBCA 1FKTA 2L2SA 2ITKA 4JFJA 3PR9A 1EHNA 4TYOA 4MNKA 2ZQTA 3ARSA 5HBFA 4QT3A 1FD9A 2MNTA 4DRNA 2PPPA 4ZPTR 2F4EA 2RUCA 4G50A 3ARXA 3O5RA 3B9AA 2FKEA 1XRVA 4MNLA 4Z2LA 4AY1A 2M1IA 3IHZA 4ML4A 2WLYA 2DSVA 4G2PA 3ARVA 4WIWA 2FAPA 4S3KA 4DRKA 1ZBWA 4Z2IA 5GPGA 3ARWA 4Q7NA 1HKJA 1FKGA 1KT1A 4TX0A 1P5QA 4FAPA 4URIA 3ARQA 2AWGA 3AROA 5GQBA 3CHEA 4DIPA 3B9DA 3O5QA 4KQZA 4W9QA 4Z2HA 2RUDA 3CZ8A 4QZVB 3WD4A 1FFRA 2KGJA 2PV2A 4Z2KA 5HKGA 4TNSA 3PRDA 1HKKA 4MNMA 4ODLA 4XAKA 2A3CA 3GPKA 2F23A 3ARPA 4BF8A 3NRKA 5HTGA 2IF4A 3O5JA 4S3JA 1NSGA 3WL1A 3ALGA 1D2KA 2G8ZA 5DEZA 3OA5A 3WD3A 1Q1CA 3NTPA 2LJ4A 2WM0A 3ARRA 4DWSB 1FAPA 2EULA 5HW6A 1FKRA 2PI6A 1EYMA 4O2TA 3RM8A 1J4IA 3CHCA 2RUQA 4JFLA 2VCDA 3G6LA 2XP4A 1D7IA 4JYSA 3IKDA 4L72B 2DT1A 2XP3A 1FKFA 3CGNA 2KI3A 4U84A 1LG1A 3OOBA 4LGXA 4U86A 3UQIA 1UR9A 1F40A 2XP8A 3ALFA 4TW7A 3NI6A 4DZ2A 5DIUA 1FKKA 5D75A 2DG4A 3PRAA 3EY6A 4MSPA 1FKLA 1K9TA 3UF8A 4J4NA 4ODKA 4P8VA 1GOIA 1ROUA 3CGMA 2A3AA 2XP5A 4ZS6A 3WL0A 3KADA 3ARZA 3AS0A 4HBEA 4L3NA 2RSEA 3FXYA 1HKMA 4MGVA 3CHDA 2XP7A 3BXWA 4HARA 3BMBA 1E9LA 2F21A 1N1AA 5GPRA 4U85A 2ZQSA 4NNRA 2ZQUA 3B8SA 1PINA 3H9RB 3UQBA 3RFWA 1EQ3A 4Q22A 2DG9A 1SR0A 1D7JA 1QZ2A 4KR0B 1C9HA 3GTYX 4MNJA 3UI6A 1FKSA 4DRPA 3TCZA 4DRMA 2RURA 2ZR4A 3PA7A 2JZVA 1W1YA 4QT2A 2KO7A 1HJWA 4WKFA 3O5DA 4P8WA 5J6EA 2YBTA 2LPVA 3ARYA 3CH9A 4ODOA 5DIVA 1E6RA 4IPXA 3WH0A 4PTMA 3KABA 3ARTA 4DWSC 2P4VA 1OGBA 1LG2A 3O5LA 1E44A 1CTNA 3ODKA 1GUVA 1R9HA 1ZBKA 2XP6A 1D6OA 3FY1A 1TCOC 1WB0A 3AS1A 1NWRA 1XHGA 4ODNA 1VF8A 1O6IA 1JNTA 1FKIA 4MAVA 4R0XA 1JVWA 1J4HA 1W26A 4NZCA 1RD6A 3WD1A 3O5PA 1Q6IA 1QPFA 4WKAA
chains in the Genus database with same CATH topology
3O5MA 4ZPVR 1LL6A 2LGOA 4DROA 3WQWA 3RGCA 1OGGA 3O5IA 2ESCA 1HJXA 1PBKA 1W9PA 4W9OA 5DO2A 3UI5A 1ZB5A 1ZBCA 4DT4A 1BL4A 5HT1A 1FFQA 5HWBA 5B8IC 4JFKA 3VAWA 3LUOA 5JH8A 4R5EA 1L1PA 3B7XA 2A3BA 1NH6A 1M5YA 3AS3A 3KAGA 5HUAA 5I98A 3QOKA 3KAHA 4W9PA 3KAFA 1E6ZA 2MLYA 3O5FA 5DF0A 2XPAA 1IX5A 4LAXA 3WD0A 2QF8A 1W9UA 1FKBA 4LAWA 3UI4A 2M08A 4TW6A 3JYMA 2ZR5A 1WAWA 1YATA 3IK8A 1FKJA 3UQAA 5BXJA 3WD2A 1Y0OA 3W4RA 1NMVA 1NMWA 1FKDA 3O5OA 4ODMA 4IT4A 3O5KA 4IQ2A 4W5UA 3CHFA 2DT0A 3PRBA 4DRHA 1X6LA 1LQ0A 2M2AA 4WJXA 1A7XA 3KAIA 4NSBA 4ODRA 1H0GA 1W1TA 5HWCA 4HBOA 4IT6A 2O92A 1W1VA 2PPNA 1HKIA 1LJYA 2DG3A 1E6NA 1F8AB 1ROTA 4ODQA 3O5GA 1T11A 3TDBA 3O5EA 4C02B 2FDMA 1EIBA 4FN2A 1BKFA 1HXVA 2IUZA 5HW8A 3G6MA 2ZR6A 2DT2A 1ZK6A 2B31A 4ZPWR 1SYTA 1GPFA 1ZL1A 3RMEA 3AQUA 4QIBA 2DSWA 1UR8A 2D9FA 1X6NA 2MLZA 1QPLA 1W9VA 2RQSA 3IKGA 5HW7A 2DSZA 3WKZA 1ZU8A 4JFMA 2YBUA 2KR7A 1JNEA 4P8XA 1E15A 3JYJA 4WKHA 2XP9A 2DT3A 1E6PA 2F2DA 2MPHA 2PPOA 1ITXA 1ZBVA 4TW8A 2XPBA 2PV3A 1WNOA 1NWSA 2DPEA 4Z2GA 1D7HA 3ARUA 1H0IA 4DH0A 4DRJA 4MPKA 2MLXA 3RM9A 4DWSD 2Q5AA 1LL7A 2Y78A 2N87A 3FAPA 2ZQVA 1FKHA 1FJDA 4ITZA 2KE0A 1B6CA 3RM4A 1OWQA 3KACA 1NWTA 1U79A 1YW5A 2MF9A 4DRIA 2UZ5A 2WK2A 2AOSA 3I6CA 1TFVA 2DSUA 1KFWA 2LKNA 1ZCNA 2G41A 2KFWA 3MDYB 4GIVA 3JXVA 3WIJA 4Z2JA 1KT0A 1EDQA 3AS2A 4J4OA 4LAVA 4DWSA 4N19A 2A3EA 2OLHA 2OFNA 4P8UA 1JNSA 1W1PA 2WLZA 2K8IA 1HJVA 4LAYA 3WQVA 3KZ7A 3KCEA 4JFIA 4GGQA 4DRQA 1NWUA 1J4RA 4ODPA 2VN1A 2PV1A 1J6YA 4DZ3A 1JNDA 1Q6UA 2O9OA 1Q6HA 4WK9A 3B9EA 1LL4A 4IQCA 4MTVA 3TC5A 5DITA 2PBCA 1FKTA 2L2SA 2ITKA 4JFJA 3PR9A 1EHNA 4TYOA 4MNKA 2ZQTA 3ARSA 5HBFA 4QT3A 1FD9A 2MNTA 4DRNA 2PPPA 4ZPTR 2F4EA 2RUCA 4G50A 3ARXA 3O5RA 3B9AA 2FKEA 1XRVA 4MNLA 4Z2LA 4AY1A 2M1IA 3IHZA 4ML4A 2WLYA 2DSVA 4G2PA 3ARVA 4WIWA 2FAPA 4S3KA 4DRKA 1ZBWA 4Z2IA 5GPGA 3ARWA 4Q7NA 1HKJA 1FKGA 1KT1A 4TX0A 1P5QA 4FAPA 4URIA 3ARQA 2AWGA 3AROA 5GQBA 3CHEA 4DIPA 3B9DA 3O5QA 4KQZA 4W9QA 4Z2HA 2RUDA 3CZ8A 4QZVB 3WD4A 1FFRA 2KGJA 2PV2A 4Z2KA 5HKGA 4TNSA 3PRDA 1HKKA 4MNMA 4ODLA 4XAKA 2A3CA 3GPKA 3ARPA 4BF8A 3NRKA 5HTGA 2IF4A 3O5JA 4S3JA 1NSGA 3WL1A 3ALGA 1D2KA 2G8ZA 5DEZA 3OA5A 3WD3A 1Q1CA 3NTPA 2LJ4A 2WM0A 3ARRA 4DWSB 1FAPA 5HW6A 1FKRA 2PI6A 1EYMA 4O2TA 3RM8A 1J4IA 3CHCA 2RUQA 4JFLA 2VCDA 3G6LA 2XP4A 1D7IA 4JYSA 3IKDA 4L72B 2DT1A 2XP3A 1FKFA 3CGNA 2KI3A 4U84A 1LG1A 3OOBA 4LGXA 4U86A 3UQIA 1UR9A 1F40A 2XP8A 3ALFA 4TW7A 3NI6A 4DZ2A 5DIUA 1FKKA 5D75A 2DG4A 3PRAA 3EY6A 4MSPA 1FKLA 1K9TA 3UF8A 4J4NA 4ODKA 4P8VA 1GOIA 1ROUA 3CGMA 2A3AA 2XP5A 4ZS6A 3WL0A 3KADA 3ARZA 3AS0A 4HBEA 4L3NA 2RSEA 3FXYA 1HKMA 4MGVA 3CHDA 2XP7A 3BXWA 4HARA 1E9LA 2F21A 1N1AA 5GPRA 4U85A 2ZQSA 4NNRA 2ZQUA 3B8SA 1PINA 3H9RB 3UQBA 3RFWA 1EQ3A 4Q22A 2DG9A 1SR0A 1D7JA 1QZ2A 4KR0B 1C9HA 4MNJA 3UI6A 1FKSA 4DRPA 3TCZA 4DRMA 2RURA 2ZR4A 3PA7A 2JZVA 1W1YA 4QT2A 2KO7A 1HJWA 4WKFA 3O5DA 4P8WA 5J6EA 2YBTA 2LPVA 3ARYA 3CH9A 4ODOA 5DIVA 1E6RA 4IPXA 3WH0A 4PTMA 3KABA 3ARTA 4DWSC 1OGBA 1LG2A 3O5LA 1CTNA 3ODKA 1GUVA 1R9HA 1ZBKA 2XP6A 1D6OA 3FY1A 1TCOC 1WB0A 3AS1A 1NWRA 1XHGA 4ODNA 1VF8A 1O6IA 1JNTA 1FKIA 4MAVA 4R0XA 1JVWA 1J4HA 1W26A 4NZCA 1RD6A 3WD1A 3O5PA 1Q6IA 1QPFA 4WKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  2KI3 A;  4U84 A;  5DIT A;  2D9F A;  2L2S A;  2ITK A;  2MLZ A;  3OOB A;  4JFJ A;  4U86 A;  1QPL A;  2LGO A;  2RQS A;  4TYO A;  3IKG A;  3UQI A;  4DRO A;  2ZQT A;  5HW7 A;  4QT3 A;  1FD9 A;  3RGC A;  2MNT A;  4DRN A;  2PPP A;  4JFM A;  1F40 A;  3O5I A;  2XP8 A;  2F4E A;  2RUC A;  2KR7 A;  4G50 A;  4TW7 A;  3NI6 A;  4DZ2 A;  5DIU A;  1FKK A;  1PBK A;  3O5R A;  4W9O A;  3JYJ A;  5D75 A;  2DG4 A;  2XP9 A;  2FKE A;  3UI5 A;  2XP3 A;  3EY6 A;  4DT4 A;  2M1I A;  1FKL A;  3IHZ A;  4MSP A;  4J4N A;  2F2D A;  4ODK A;  2MPH A;  3UF8 A;  1ROU A;  3CGM A;  1HXV A;  2PPO A;  1BL4 A;  2XP5 A;  5HT1 A;  4G2P A;  3KAD A;  5HWB A;  4TW8 A;  5B8I C;  2XPB A;  2PV3 A;  2FAP A;  2RSE A;  4JFK A;  3VAW A;  3LUO A;  4MGV A;  1L1P A;  1D7H A;  4DRK A;  3B7X A;  2XP7 A;  4DH0 A;  4DRJ A;  1M5Y A;  3KAG A;  2F21 A;  1N1A A;  5HUA A;  4U85 A;  2MLX A;  2ZQS A;  3KAH A;  4NNR A;  4W9P A;  2ZQU A;  5GPG A;  5I98 A;  3KAF A;  2MLY A;  1PIN A;  3H9R B;  3O5F A;  1FKG A;  3UQB A;  2XPA A;  3RFW A;  1KT1 A;  1EQ3 A;  4LAX A;  4TX0 A;  1P5Q A;  2Q5A A;  4FAP A;  2Y78 A;  2N87 A;  3FAP A;  2DG9 A;  2ZQV A;  1FKH A;  1FKB A;  1D7J A;  1QZ2 A;  4ITZ A;  1FJD A;  4LAW A;  1C9H A;  2AWG A;  2KE0 A;  1B6C A;  2M08 A;  3UI4 A;  3UI6 A;  1FKS A;  4TW6 A;  3JYM A;  4DIP A;  3O5Q A;  4W9Q A;  2ZR5 A;  2RUD A;  3TCZ A;  4DRP A;  4DRM A;  3KAC A;  2RUR A;  1U79 A;  2ZR4 A;  1YAT A;  1YW5 A;  3PA7 A;  2JZV A;  1FKJ A;  3IK8 A;  4QT2 A;  2KO7 A;  3UQA A;  2KGJ A;  5BXJ A;  2MF9 A;  3O5D A;  1Y0O A;  2PV2 A;  1NMV A;  1NMW A;  4DRI A;  1FKD A;  5HKG A;  3O5O A;  2UZ5 A;  5J6E A;  4ODM A;  3I6C A;  4TNS A;  2LPV A;  3O5K A;  2LKN A;  4IQ2 A;  4ODO A;  1ZCN A;  2KFW A;  3PRD A;  3MDY B;  4IPX A;  4GIV A;  4ODL A;  5DIV A;  3WH0 A;  3GPK A;  3JXV A;  3KAB A;  3PRB A;  1KT0 A;  4DRH A;  2M2A A;  2PBC A;  3NRK A;  4BF8 A;  2IF4 A;  1A7X A;  3O5J A;  5HTG A;  3KAI A;  1NSG A;  4J4O A;  4LAV A;  4N19 A;  4ODR A;  3TC5 A;  3O5L A;  1Q1C A;  5HWC A;  3NTP A;  3ODK A;  2PPN A;  1R9H A;  2LJ4 A;  2OFN A;  1JNS A;  2DG3 A;  2K8I A;  1FAP A;  1D6O A;  2XP6 A;  1TCO C;  4LAY A;  1F8A B;  1ROT A;  3KZ7 A;  3KCE A;  4JFI A;  4ODQ A;  5HW6 A;  1FKR A;  3O5G A;  4GGQ A;  1T11 A;  3TDB A;  4DRQ A;  3O5E A;  1EYM A;  4ODN A;  4C02 B;  4O2T A;  4FN2 A;  1J4R A;  4ODP A;  1BKF A;  1J4I A;  2VN1 A;  2PV1 A;  1JNT A;  1FKI A;  2RUQ A;  4R0X A;  4DZ3 A;  4JFL A;  2VCD A;  5HW8 A;  1J6Y A;  1JVW A;  1J4H A;  1W26 A;  1Q6U A;  2ZR6 A;  1ZK6 A;  1Q6H A;  2XP4 A;  1D7I A;  4JYS A;  3O5P A;  3IKD A;  4IQC A;  1Q6I A;  4QIB A;  1QPF A;  1FKF A;  3CGN A;  1FKT A; 
#chains in the Genus database with same CATH topology
 3O5M A;  4ZPV R;  1JCH B;  2B5U B;  1LL6 A;  2LGO A;  4DRO A;  3WQW A;  3RGC A;  1OGG A;  3O5I A;  2ESC A;  1HJX A;  1PBK A;  1W9P A;  4W9O A;  5DO2 A;  3UI5 A;  1ZB5 A;  1ZBC A;  4DT4 A;  3GU0 A;  1BL4 A;  5HT1 A;  1FFQ A;  5HWB A;  5B8I C;  4JFK A;  3VAW A;  3LUO A;  5JH8 A;  4R5E A;  1L1P A;  3B7X A;  2A3B A;  1NH6 A;  1M5Y A;  3AS3 A;  3KAG A;  5HUA A;  5I98 A;  3QOK A;  3KAH A;  4W9P A;  3KAF A;  1E6Z A;  2MLY A;  3O5F A;  5DF0 A;  2XPA A;  1IX5 A;  4LAX A;  3WD0 A;  2QF8 A;  1W9U A;  1FKB A;  4LAW A;  3UI4 A;  2M08 A;  4TW6 A;  3JYM A;  2ZR5 A;  1WAW A;  1YAT A;  3IK8 A;  1FKJ A;  3UQA A;  5BXJ A;  3WD2 A;  1Y0O A;  3W4R A;  1NMV A;  1NMW A;  1FKD A;  3O5O A;  4ODM A;  4IT4 A;  3O5K A;  4IQ2 A;  4W5U A;  3CHF A;  2DT0 A;  3PRB A;  4DRH A;  1X6L A;  1LQ0 A;  2M2A A;  4WJX A;  1A7X A;  3KAI A;  4NSB A;  4ODR A;  1H0G A;  1W1T A;  5HWC A;  4HBO A;  4IT6 A;  2O92 A;  1W1V A;  1GRJ A;  2PPN A;  1HKI A;  1LJY A;  2DG3 A;  1E6N A;  1F8A B;  1ROT A;  4ODQ A;  3O5G A;  1T11 A;  3TDB A;  3O5E A;  4C02 B;  2FDM A;  1EIB A;  4FN2 A;  1BKF A;  1HXV A;  2IUZ A;  5HW8 A;  3G6M A;  4UDM A;  2ZR6 A;  2DT2 A;  1ZK6 A;  2B31 A;  4ZPW R;  1SYT A;  1GPF A;  1ZL1 A;  2ETN A;  3RME A;  3AQU A;  4QIB A;  2DSW A;  1UR8 A;  2D9F A;  1X6N A;  2MLZ A;  1QPL A;  1W9V A;  2RQS A;  3IKG A;  5HW7 A;  2DSZ A;  3WKZ A;  1ZU8 A;  4JFM A;  2YBU A;  2KR7 A;  1JNE A;  4P8X A;  1E15 A;  3JYJ A;  4WKH A;  2XP9 A;  2DT3 A;  1E6P A;  2F2D A;  2MPH A;  2PPO A;  1ITX A;  3EIP A;  1ZBV A;  4TW8 A;  2XPB A;  2PV3 A;  1WNO A;  1NWS A;  2DPE A;  2PN0 A;  4Z2G A;  1D7H A;  3ARU A;  1H0I A;  4DH0 A;  4DRJ A;  4MPK A;  2MLX A;  3RM9 A;  4DWS D;  2Q5A A;  1LL7 A;  2Y78 A;  2N87 A;  3FAP A;  2ZQV A;  1FKH A;  1FJD A;  4ITZ A;  2KE0 A;  1B6C A;  3RM4 A;  1OWQ A;  3KAC A;  1NWT A;  1U79 A;  1YW5 A;  2MF9 A;  4DRI A;  2UZ5 A;  2WK2 A;  2AOS A;  3I6C A;  1TFV A;  2DSU A;  1KFW A;  2LKN A;  1ZCN A;  2G41 A;  2KFW A;  3MDY B;  4GIV A;  3JXV A;  3WIJ A;  4Z2J A;  1KT0 A;  1EDQ A;  3AS2 A;  4J4O A;  4LAV A;  4DWS A;  4N19 A;  2A3E A;  2OLH A;  2OFN A;  4P8U A;  1JNS A;  1W1P A;  2WLZ A;  2K8I A;  1HJV A;  4LAY A;  3WQV A;  3KZ7 A;  3KCE A;  4JFI A;  4GGQ A;  4DRQ A;  1NWU A;  1J4R A;  4ODP A;  2VN1 A;  2PV1 A;  1J6Y A;  4DZ3 A;  1JND A;  1Q6U A;  2O9O A;  1Q6H A;  4WK9 A;  3B9E A;  1LL4 A;  4IQC A;  4MTV A;  3TC5 A;  5DIT A;  2PBC A;  1FKT A;  2L2S A;  2ITK A;  4JFJ A;  3PR9 A;  1EHN A;  4TYO A;  4MNK A;  2ZQT A;  3ARS A;  5HBF A;  4QT3 A;  1FD9 A;  2MNT A;  4DRN A;  2PPP A;  4ZPT R;  2F4E A;  2RUC A;  4G50 A;  3ARX A;  3O5R A;  3B9A A;  2FKE A;  1XRV A;  4MNL A;  4Z2L A;  4AY1 A;  2M1I A;  3IHZ A;  4ML4 A;  2WLY A;  2DSV A;  4G2P A;  3ARV A;  4WIW A;  2FAP A;  4S3K A;  4DRK A;  1ZBW A;  4Z2I A;  5GPG A;  3ARW A;  4Q7N A;  1HKJ A;  1FKG A;  1KT1 A;  4TX0 A;  1P5Q A;  4FAP A;  4URI A;  3ARQ A;  2AWG A;  3ARO A;  5GQB A;  3CHE A;  4DIP A;  3B9D A;  3O5Q A;  4KQZ A;  4W9Q A;  4Z2H A;  2RUD A;  3CZ8 A;  4QZV B;  3WD4 A;  1FFR A;  2KGJ A;  2PV2 A;  4Z2K A;  5HKG A;  4TNS A;  3PRD A;  1HKK A;  4MNM A;  4ODL A;  4XAK A;  2A3C A;  3GPK A;  2F23 A;  3ARP A;  4BF8 A;  3NRK A;  5HTG A;  2IF4 A;  3O5J A;  4S3J A;  1NSG A;  3WL1 A;  3ALG A;  1D2K A;  2G8Z A;  5DEZ A;  3OA5 A;  3WD3 A;  1Q1C A;  3NTP A;  2LJ4 A;  2WM0 A;  3ARR A;  4DWS B;  1FAP A;  2EUL A;  5HW6 A;  1FKR A;  2PI6 A;  1EYM A;  4O2T A;  3RM8 A;  1J4I A;  3CHC A;  2RUQ A;  4JFL A;  2VCD A;  3G6L A;  2XP4 A;  1D7I A;  4JYS A;  3IKD A;  4L72 B;  2DT1 A;  2XP3 A;  1FKF A;  3CGN A;  2KI3 A;  4U84 A;  1LG1 A;  3OOB A;  4LGX A;  4U86 A;  3UQI A;  1UR9 A;  1F40 A;  2XP8 A;  3ALF A;  4TW7 A;  3NI6 A;  4DZ2 A;  5DIU A;  1FKK A;  5D75 A;  2DG4 A;  3PRA A;  3EY6 A;  4MSP A;  1FKL A;  1K9T A;  3UF8 A;  4J4N A;  4ODK A;  4P8V A;  1GOI A;  1ROU A;  3CGM A;  2A3A A;  2XP5 A;  4ZS6 A;  3WL0 A;  3KAD A;  3ARZ A;  3AS0 A;  4HBE A;  4L3N A;  2RSE A;  3FXY A;  1HKM A;  4MGV A;  3CHD A;  2XP7 A;  3BXW A;  4HAR A;  3BMB A;  1E9L A;  2F21 A;  1N1A A;  5GPR A;  4U85 A;  2ZQS A;  4NNR A;  2ZQU A;  3B8S A;  1PIN A;  3H9R B;  3UQB A;  3RFW A;  1EQ3 A;  4Q22 A;  2DG9 A;  1SR0 A;  1D7J A;  1QZ2 A;  4KR0 B;  1C9H A;  3GTY X;  4MNJ A;  3UI6 A;  1FKS A;  4DRP A;  3TCZ A;  4DRM A;  2RUR A;  2ZR4 A;  3PA7 A;  2JZV A;  1W1Y A;  4QT2 A;  2KO7 A;  1HJW A;  4WKF A;  3O5D A;  4P8W A;  5J6E A;  2YBT A;  2LPV A;  3ARY A;  3CH9 A;  4ODO A;  5DIV A;  1E6R A;  4IPX A;  3WH0 A;  4PTM A;  3KAB A;  3ART A;  4DWS C;  2P4V A;  1OGB A;  1LG2 A;  3O5L A;  1E44 A;  1CTN A;  3ODK A;  1GUV A;  1R9H A;  1ZBK A;  2XP6 A;  1D6O A;  3FY1 A;  1TCO C;  1WB0 A;  3AS1 A;  1NWR A;  1XHG A;  4ODN A;  1VF8 A;  1O6I A;  1JNT A;  1FKI A;  4MAV A;  4R0X A;  1JVW A;  1J4H A;  1W26 A;  4NZC A;  1RD6 A;  3WD1 A;  3O5P A;  1Q6I A;  1QPF A;  4WKA A; 
#chains in the Genus database with same CATH homology
 3O5M A;  4ZPV R;  1LL6 A;  2LGO A;  4DRO A;  3WQW A;  3RGC A;  1OGG A;  3O5I A;  2ESC A;  1HJX A;  1PBK A;  1W9P A;  4W9O A;  5DO2 A;  3UI5 A;  1ZB5 A;  1ZBC A;  4DT4 A;  1BL4 A;  5HT1 A;  1FFQ A;  5HWB A;  5B8I C;  4JFK A;  3VAW A;  3LUO A;  5JH8 A;  4R5E A;  1L1P A;  3B7X A;  2A3B A;  1NH6 A;  1M5Y A;  3AS3 A;  3KAG A;  5HUA A;  5I98 A;  3QOK A;  3KAH A;  4W9P A;  3KAF A;  1E6Z A;  2MLY A;  3O5F A;  5DF0 A;  2XPA A;  1IX5 A;  4LAX A;  3WD0 A;  2QF8 A;  1W9U A;  1FKB A;  4LAW A;  3UI4 A;  2M08 A;  4TW6 A;  3JYM A;  2ZR5 A;  1WAW A;  1YAT A;  3IK8 A;  1FKJ A;  3UQA A;  5BXJ A;  3WD2 A;  1Y0O A;  3W4R A;  1NMV A;  1NMW A;  1FKD A;  3O5O A;  4ODM A;  4IT4 A;  3O5K A;  4IQ2 A;  4W5U A;  3CHF A;  2DT0 A;  3PRB A;  4DRH A;  1X6L A;  1LQ0 A;  2M2A A;  4WJX A;  1A7X A;  3KAI A;  4NSB A;  4ODR A;  1H0G A;  1W1T A;  5HWC A;  4HBO A;  4IT6 A;  2O92 A;  1W1V A;  2PPN A;  1HKI A;  1LJY A;  2DG3 A;  1E6N A;  1F8A B;  1ROT A;  4ODQ A;  3O5G A;  1T11 A;  3TDB A;  3O5E A;  4C02 B;  2FDM A;  1EIB A;  4FN2 A;  1BKF A;  1HXV A;  2IUZ A;  5HW8 A;  3G6M A;  2ZR6 A;  2DT2 A;  1ZK6 A;  2B31 A;  4ZPW R;  1SYT A;  1GPF A;  1ZL1 A;  3RME A;  3AQU A;  4QIB A;  2DSW A;  1UR8 A;  2D9F A;  1X6N A;  2MLZ A;  1QPL A;  1W9V A;  2RQS A;  3IKG A;  5HW7 A;  2DSZ A;  3WKZ A;  1ZU8 A;  4JFM A;  2YBU A;  2KR7 A;  1JNE A;  4P8X A;  1E15 A;  3JYJ A;  4WKH A;  2XP9 A;  2DT3 A;  1E6P A;  2F2D A;  2MPH A;  2PPO A;  1ITX A;  1ZBV A;  4TW8 A;  2XPB A;  2PV3 A;  1WNO A;  1NWS A;  2DPE A;  4Z2G A;  1D7H A;  3ARU A;  1H0I A;  4DH0 A;  4DRJ A;  4MPK A;  2MLX A;  3RM9 A;  4DWS D;  2Q5A A;  1LL7 A;  2Y78 A;  2N87 A;  3FAP A;  2ZQV A;  1FKH A;  1FJD A;  4ITZ A;  2KE0 A;  1B6C A;  3RM4 A;  1OWQ A;  3KAC A;  1NWT A;  1U79 A;  1YW5 A;  2MF9 A;  4DRI A;  2UZ5 A;  2WK2 A;  2AOS A;  3I6C A;  1TFV A;  2DSU A;  1KFW A;  2LKN A;  1ZCN A;  2G41 A;  2KFW A;  3MDY B;  4GIV A;  3JXV A;  3WIJ A;  4Z2J A;  1KT0 A;  1EDQ A;  3AS2 A;  4J4O A;  4LAV A;  4DWS A;  4N19 A;  2A3E A;  2OLH A;  2OFN A;  4P8U A;  1JNS A;  1W1P A;  2WLZ A;  2K8I A;  1HJV A;  4LAY A;  3WQV A;  3KZ7 A;  3KCE A;  4JFI A;  4GGQ A;  4DRQ A;  1NWU A;  1J4R A;  4ODP A;  2VN1 A;  2PV1 A;  1J6Y A;  4DZ3 A;  1JND A;  1Q6U A;  2O9O A;  1Q6H A;  4WK9 A;  3B9E A;  1LL4 A;  4IQC A;  4MTV A;  3TC5 A;  5DIT A;  2PBC A;  1FKT A;  2L2S A;  2ITK A;  4JFJ A;  3PR9 A;  1EHN A;  4TYO A;  4MNK A;  2ZQT A;  3ARS A;  5HBF A;  4QT3 A;  1FD9 A;  2MNT A;  4DRN A;  2PPP A;  4ZPT R;  2F4E A;  2RUC A;  4G50 A;  3ARX A;  3O5R A;  3B9A A;  2FKE A;  1XRV A;  4MNL A;  4Z2L A;  4AY1 A;  2M1I A;  3IHZ A;  4ML4 A;  2WLY A;  2DSV A;  4G2P A;  3ARV A;  4WIW A;  2FAP A;  4S3K A;  4DRK A;  1ZBW A;  4Z2I A;  5GPG A;  3ARW A;  4Q7N A;  1HKJ A;  1FKG A;  1KT1 A;  4TX0 A;  1P5Q A;  4FAP A;  4URI A;  3ARQ A;  2AWG A;  3ARO A;  5GQB A;  3CHE A;  4DIP A;  3B9D A;  3O5Q A;  4KQZ A;  4W9Q A;  4Z2H A;  2RUD A;  3CZ8 A;  4QZV B;  3WD4 A;  1FFR A;  2KGJ A;  2PV2 A;  4Z2K A;  5HKG A;  4TNS A;  3PRD A;  1HKK A;  4MNM A;  4ODL A;  4XAK A;  2A3C A;  3GPK A;  3ARP A;  4BF8 A;  3NRK A;  5HTG A;  2IF4 A;  3O5J A;  4S3J A;  1NSG A;  3WL1 A;  3ALG A;  1D2K A;  2G8Z A;  5DEZ A;  3OA5 A;  3WD3 A;  1Q1C A;  3NTP A;  2LJ4 A;  2WM0 A;  3ARR A;  4DWS B;  1FAP A;  5HW6 A;  1FKR A;  2PI6 A;  1EYM A;  4O2T A;  3RM8 A;  1J4I A;  3CHC A;  2RUQ A;  4JFL A;  2VCD A;  3G6L A;  2XP4 A;  1D7I A;  4JYS A;  3IKD A;  4L72 B;  2DT1 A;  2XP3 A;  1FKF A;  3CGN A;  2KI3 A;  4U84 A;  1LG1 A;  3OOB A;  4LGX A;  4U86 A;  3UQI A;  1UR9 A;  1F40 A;  2XP8 A;  3ALF A;  4TW7 A;  3NI6 A;  4DZ2 A;  5DIU A;  1FKK A;  5D75 A;  2DG4 A;  3PRA A;  3EY6 A;  4MSP A;  1FKL A;  1K9T A;  3UF8 A;  4J4N A;  4ODK A;  4P8V A;  1GOI A;  1ROU A;  3CGM A;  2A3A A;  2XP5 A;  4ZS6 A;  3WL0 A;  3KAD A;  3ARZ A;  3AS0 A;  4HBE A;  4L3N A;  2RSE A;  3FXY A;  1HKM A;  4MGV A;  3CHD A;  2XP7 A;  3BXW A;  4HAR A;  1E9L A;  2F21 A;  1N1A A;  5GPR A;  4U85 A;  2ZQS A;  4NNR A;  2ZQU A;  3B8S A;  1PIN A;  3H9R B;  3UQB A;  3RFW A;  1EQ3 A;  4Q22 A;  2DG9 A;  1SR0 A;  1D7J A;  1QZ2 A;  4KR0 B;  1C9H A;  4MNJ A;  3UI6 A;  1FKS A;  4DRP A;  3TCZ A;  4DRM A;  2RUR A;  2ZR4 A;  3PA7 A;  2JZV A;  1W1Y A;  4QT2 A;  2KO7 A;  1HJW A;  4WKF A;  3O5D A;  4P8W A;  5J6E A;  2YBT A;  2LPV A;  3ARY A;  3CH9 A;  4ODO A;  5DIV A;  1E6R A;  4IPX A;  3WH0 A;  4PTM A;  3KAB A;  3ART A;  4DWS C;  1OGB A;  1LG2 A;  3O5L A;  1CTN A;  3ODK A;  1GUV A;  1R9H A;  1ZBK A;  2XP6 A;  1D6O A;  3FY1 A;  1TCO C;  1WB0 A;  3AS1 A;  1NWR A;  1XHG A;  4ODN A;  1VF8 A;  1O6I A;  1JNT A;  1FKI A;  4MAV A;  4R0X A;  1JVW A;  1J4H A;  1W26 A;  4NZC A;  1RD6 A;  3WD1 A;  3O5P A;  1Q6I A;  1QPF A;  4WKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...