2LJ4A

Solution structure of the tbpin1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'MSEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKRLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase/rotamase, putative
publication title Solution Structural Analysis of the Single-Domain Parvulin TbPin1
doi rcsb
source organism Trypanosoma brucei
molecule tags Isomerase
total genus 28
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lj4A00
5DIVA 1YW5A 3O5IA 1FKRA 1F8AB 1QPLA 3JYJA 4ODKA 5HUAA 3IKGA 2D9FA 1PINA 4ODRA 2FAPA 3O5MA 4TW7A 4DRIA 2M1IA 1U79A 3PA7A 4BF8A 3KAFA 4QT3A 4DH0A 4TYOA 5HW7A 5BXJA 1ZCNA 1ROUA 2KGJA 2ZQUA 1C9HA 2RURA 2XP6A 4DROA 3O5EA 3WH0A 2RUDA 3IK8A 3UI4A 4DRQA 1FKTA 4ODOA 4JFJA 4C02B 4TW8A 5I98A 4DZ3A 3O5OA 3JYMA 2RQSA 4W9QA 2XP8A 1P5QA 2LKNA 4JFMA 3KAIA 5HT1A 3KCEA 1J4RA 2MPHA 3O5DA 3O5RA 4U85A 1NMVA 2PBCA 1HXVA 4JYSA 5HW8A 2OFNA 2K8IA 2MF9A 3GPKA 4JFLA 2FKEA 1FKKA 4NNRA 4J4OA 2RUQA 2MLXA 4QIBA 5D75A 4FAPA 1J6YA 4LAVA 1ROTA 1FKGA 1FKSA 1KT0A 2F4EA 2ZR5A 2PPNA 4W9PA 1FD9A 1TCOC 4FN2A 3KAGA 4J4NA 5HTGA 2F2DA 4GGQA 2PV1A 2PV3A 2ZR6A 4DRKA 1EQ3A 2XP9A 5DIUA 1D7JA 3O5FA 2JZVA 3KACA 3O5GA 3OOBA 2DG3A 2KI3A 2MLZA 3O5JA 3LUOA 2UZ5A 4DIPA 4DT4A 1W26A 2ZQTA 3NRKA 4MGVA 3PRBA 4TNSA 1ZK6A 3ODKA 2ZQVA 1QPFA 4O2TA 1D7HA 2XPBA 3O5KA 3KAHA 4W9OA 1FKJA 1M5YA 1FJDA 1FKBA 4U84A 5J6EA 1D6OA 2MLYA 1FKIA 1J4HA 2XP5A 1T11A 4ITZA 1Y0OA 2KR7A 3TDBA 2XPAA 3KABA 3MDYB 1BL4A 1FKDA 2ITKA 2M2AA 3O5QA 5HWBA 3KZ7A 1D7IA 1N1AA 4DZ2A 5GPGA 4LAYA 4TX0A 2ZQSA 1B6CA 3RFWA 4N19A 4U86A 1R9HA 2VCDA 4ODMA 4DRNA 1Q6HA 4DRPA 2LPVA 1FKHA 3I6CA 4IQ2A 3KADA 1Q6IA 3UQAA 5HW6A 2Q5AA 2KFWA 4IPXA 2M08A 3B7XA 1EYMA 1JVWA 4JFIA 4IQCA 2LJ4A 3NTPA 4TW6A 1FKLA 1Q1CA 3TCZA 4ODLA 5B8IC 1JNSA 1A7XA 4DRMA 1JNTA 2F21A 3CGNA 3O5LA 3UQIA 3IHZA 2RSEA 1F40A 2KE0A 3UI5A 2XP3A 3VAWA 3JXVA 3UI6A 2N87A 4DRJA 2PPOA 3FAPA 4MSPA 1PBKA 3IKDA 3PRDA 1NSGA 2DG4A 4ODNA 4QT2A 5DITA 2PPPA 2MNTA 1FAPA 3UQBA 4DRHA 1Q6UA 3CGMA 2RUCA 4R0XA 3H9RB 4G2PA 1L1PA 2L2SA 2VN1A 4ODQA 5HKGA 1BKFA 4JFKA 5HWCA 2IF4A 3EY6A 2LGOA 3TC5A 3O5PA 1KT1A 2KO7A 2PV2A 2DG9A 4GIVA 4LAXA 1FKFA 2XP4A 4ODPA 1J4IA 3UF8A 1QZ2A 4LAWA 1NMWA 4G50A 2ZR4A 2AWGA 3RGCA 2Y78A 1YATA 3NI6A 2XP7A
chains in the Genus database with same CATH superfamily
2DT0A 1SYTA 3ARPA 3B8SA 5DIVA 5HUAA 4MNKA 2D9FA 4ODRA 1U79A 3PA7A 4DH0A 1H0IA 5BXJA 1ZCNA 1C9HA 1WB0A 4DROA 1HJXA 1WAWA 2RUDA 4URIA 1UR8A 4ZPWR 3UI4A 4DRQA 4WKFA 4JFJA 5JH8A 3AROA 1UR9A 4ML4A 3WD3A 4NZCA 1P5QA 4JFMA 4DWSD 2DT3A 1LL4A 2YBUA 3KAIA 1J4RA 5DO2A 1HXVA 4JYSA 2DT1A 3G6MA 2DPEA 1E15A 4Z2IA 4QIBA 5D75A 5HBFA 3WL1A 3ARSA 2F4EA 2ZR5A 3W4RA 2PPNA 1FD9A 4FN2A 2DSVA 1ZB5A 4DWSA 2ZR6A 1E9LA 4L72B 2KI3A 2MLZA 1TFVA 2UZ5A 4DT4A 1X6LA 3NRKA 1W1VA 1QPFA 3ARYA 3O5KA 1M5YA 4U84A 3UF8A 1FKIA 1T11A 3RM4A 2ITKA 3RM8A 5HWBA 1ZU8A 1SR0A 1N1AA 3CHEA 4LAYA 4WKHA 3QOKA 2ZQSA 4HARA 4Q7NA 2VCDA 4DRNA 1Q6HA 4DRPA 1FKHA 5HW6A 2LJ4A 1JNSA 4MNJA 3CGNA 3O5LA 3UQIA 1F40A 2XP3A 3VAWA 3JXVA 2N87A 1W9UA 2PPOA 3FAPA 5DITA 4ODNA 3IKDA 4QT2A 2PPPA 3UQBA 3CZ8A 1NWTA 2B5UB 4WKAA 2RUCA 3ARVA 2ESCA 5HWCA 3EY6A 1GUVA 1D2KA 2PV2A 1W9PA 2P4VA 4MTVA 4LAWA 2AWGA 1YATA 1YW5A 1FKRA 3JYJA 2EULA 1PINA 1LG2A 4TW7A 4DRIA 4TYOA 3ALGA 2A3CA 1ROUA 1GOIA 2RURA 2XP6A 4MPKA 3BMBA 1K9TA 1JNEA 1H0GA 4QZVB 4C02B 4TW8A 1HKKA 2OLHA 2LKNA 3ARTA 4Q22A 3O5DA 5HW8A 2MF9A 3GPKA 4MAVA 1FKKA 4J4OA 2RUQA 2MLXA 4Z2LA 4FAPA 4LGXA 4AY1A 4IT6A 1OWQA 5DIUA 2WM0A 2DG3A 5DF0A 2AOSA 3OA5A 1W26A 2ZQTA 1E6NA 1ZK6A 2B31A 2ZQVA 4S3KA 2XPBA 2FDMA 1FJDA 1RD6A 1D6OA 1Y0OA 2KR7A 3MDYB 1BL4A 1FKDA 2M2AA 3O5QA 3KZ7A 1D7IA 4DZ2A 5GPGA 4TX0A 3RFWA 4N19A 4U86A 3I6CA 4IQ2A 2Q5AA 4HBEA 2M08A 3B7XA 3NTPA 1Q1CA 4WJXA 5B8IC 4DRMA 2G8ZA 1LJYA 4KR0B 2RSEA 3CHCA 3WQVA 4W5UA 4DRJA 1PBKA 2DG4A 4DWSC 1W1PA 2MNTA 1W9VA 1Q6UA 4P8VA 3CGMA 1JCHB 2VN1A 5DEZA 4WIWA 1ZBVA 1BKFA 1ZBWA 3O5PA 1LL7A 4MNLA 1JNDA 4UDMA 2DG9A 4LAXA 1J4IA 3B9DA 4WK9A 1NMWA 4G50A 2PN0A 3RGCA 1L1PA 3O5IA 1NWSA 4ODKA 3ARRA 1W1YA 2M1IA 3RMEA 3KAFA 2KGJA 2ZQUA 3WH0A 3IK8A 1E6ZA 5I98A 4DZ3A 3JYMA 2RQSA 4W9QA 1KFWA 5HT1A 3KCEA 3WQWA 2WLZA 4U85A 1E6PA 3GU0A 2OFNA 2FKEA 2A3EA 4P8XA 4LAVA 4Z2GA 1FKGA 1FKSA 1KT0A 1E6RA 3B9EA 3WIJA 3CHDA 1EDQA 4ZPVR 1TCOC 2DSWA 2F2DA 3FY1A 4DRKA 1VF8A 1D7JA 2WLYA 3KACA 4ZS6A 3LUOA 1GRJA 3PRBA 3G6LA 2A3AA 1XRVA 4O2TA 3AQUA 3WKZA 1FKBA 4IT4A 1WNOA 3RM9A 3TDBA 4HBOA 2XP5A 4ITZA 3KABA 4KQZA 4XAKA 3WD2A 1B6CA 1HJVA 4ODMA 1ITXA 3ARWA 4P8UA 2LPVA 3EIPA 3KADA 1Q6IA 2QF8A 2KFWA 4IPXA 1EYMA 4IQCA 5GPRA 4TW6A 3TCZA 3ARQA 1A7XA 3BXWA 1JNTA 2ETNA 3AS0A 3IHZA 3CH9A 1HKIA 3WL0A 1HJWA 3ARZA 1ZBCA 3UI6A 4MSPA 3PRDA 4MNMA 3WD0A 1EHNA 4R0XA 3H9RB 4G2PA 1NH6A 1E44A 5HKGA 4JFKA 2IF4A 2LGOA 3TC5A 1HKJA 4S3JA 1FKFA 4ODPA 5GQBA 2Y78A 3NI6A 2XP7A 3AS1A 1F8AB 1QPLA 2G41A 3IKGA 1GPFA 2FAPA 3O5MA 3AS3A 4BF8A 4QT3A 5HW7A 2O9OA 1HKMA 3GTYX 3ALFA 3O5EA 1O6IA 1NWUA 1FKTA 1FFQA 4ODOA 2IUZA 3O5OA 2XP8A 2MPHA 3O5RA 1NMVA 2PBCA 1ZL1A 3PRAA 2K8IA 4JFLA 4NNRA 1J6YA 4R5EA 4Z2JA 2DT2A 1ROTA 4W9PA 4PTMA 4J4NA 3KAGA 5HTGA 4GGQA 2PV1A 2PV3A 1EQ3A 2XP9A 1OGGA 3O5FA 2JZVA 1CTNA 3O5GA 3OOBA 3B9AA 3O5JA 4Z2HA 3WD1A 4DIPA 4MGVA 2O92A 3FXYA 4TNSA 3ODKA 1D7HA 3KAHA 4W9OA 1FKJA 4DWSB 5J6EA 2MLYA 1J4HA 1LL6A 2XPAA 1ZBKA 1XHGA 1LG1A 1EIBA 3CHFA 4P8WA 3WD4A 1R9HA 3UQAA 2A3BA 1IX5A 1W1TA 2YBTA 4Z2KA 4JFIA 1JVWA 3AS2A 1FKLA 4ODLA 2F21A 2KE0A 3UI5A 2WK2A 1NSGA 1X6NA 2DSZA 1FFRA 1OGBA 1FAPA 4DRHA 3ARXA 4L3NA 4NSBA 2L2SA 4ODQA 1LQ0A 2PI6A 3ARUA 1KT1A 2KO7A 4GIVA 2XP4A 2F23A 1QZ2A 3PR9A 2DSUA 2ZR4A 1NWRA 4ZPTR
chains in the Genus database with same CATH topology
2DT0A 1SYTA 3ARPA 3B8SA 5DIVA 5HUAA 4MNKA 2D9FA 4ODRA 1U79A 3PA7A 4DH0A 1H0IA 5BXJA 1ZCNA 1C9HA 1WB0A 4DROA 1HJXA 1WAWA 2RUDA 4URIA 1UR8A 4ZPWR 3UI4A 4DRQA 4WKFA 4JFJA 5JH8A 3AROA 1UR9A 4ML4A 3WD3A 4NZCA 1P5QA 4JFMA 4DWSD 2DT3A 1LL4A 2YBUA 3KAIA 1J4RA 5DO2A 1HXVA 4JYSA 2DT1A 3G6MA 2DPEA 1E15A 4Z2IA 4QIBA 5D75A 5HBFA 3WL1A 3ARSA 2F4EA 2ZR5A 3W4RA 2PPNA 1FD9A 4FN2A 2DSVA 1ZB5A 4DWSA 2ZR6A 1E9LA 4L72B 2KI3A 2MLZA 1TFVA 2UZ5A 4DT4A 1X6LA 3NRKA 1W1VA 1QPFA 3ARYA 3O5KA 1M5YA 4U84A 3UF8A 1FKIA 1T11A 3RM4A 2ITKA 3RM8A 5HWBA 1ZU8A 1SR0A 1N1AA 3CHEA 4LAYA 4WKHA 3QOKA 2ZQSA 4HARA 4Q7NA 2VCDA 4DRNA 1Q6HA 4DRPA 1FKHA 5HW6A 2LJ4A 1JNSA 4MNJA 3CGNA 3O5LA 3UQIA 1F40A 2XP3A 3VAWA 3JXVA 2N87A 1W9UA 2PPOA 3FAPA 5DITA 4ODNA 3IKDA 4QT2A 2PPPA 3UQBA 3CZ8A 1NWTA 4WKAA 2RUCA 3ARVA 2ESCA 5HWCA 3EY6A 1GUVA 1D2KA 2PV2A 1W9PA 4MTVA 4LAWA 2AWGA 1YATA 1YW5A 1FKRA 3JYJA 1PINA 1LG2A 4TW7A 4DRIA 4TYOA 3ALGA 2A3CA 1ROUA 1GOIA 2RURA 2XP6A 4MPKA 1K9TA 1JNEA 1H0GA 4QZVB 4C02B 4TW8A 1HKKA 2OLHA 2LKNA 3ARTA 4Q22A 3O5DA 5HW8A 2MF9A 3GPKA 4MAVA 1FKKA 4J4OA 2RUQA 2MLXA 4Z2LA 4FAPA 4LGXA 4AY1A 4IT6A 1OWQA 5DIUA 2WM0A 2DG3A 5DF0A 2AOSA 3OA5A 1W26A 2ZQTA 1E6NA 1ZK6A 2B31A 2ZQVA 4S3KA 2XPBA 2FDMA 1FJDA 1RD6A 1D6OA 1Y0OA 2KR7A 3MDYB 1BL4A 1FKDA 2M2AA 3O5QA 3KZ7A 1D7IA 4DZ2A 5GPGA 4TX0A 3RFWA 4N19A 4U86A 3I6CA 4IQ2A 2Q5AA 4HBEA 2M08A 3B7XA 3NTPA 1Q1CA 4WJXA 5B8IC 4DRMA 2G8ZA 1LJYA 4KR0B 2RSEA 3CHCA 3WQVA 4W5UA 4DRJA 1PBKA 2DG4A 4DWSC 1W1PA 2MNTA 1W9VA 1Q6UA 4P8VA 3CGMA 2VN1A 5DEZA 4WIWA 1ZBVA 1BKFA 1ZBWA 3O5PA 1LL7A 4MNLA 1JNDA 2DG9A 4LAXA 1J4IA 3B9DA 4WK9A 1NMWA 4G50A 1L1PA 3RGCA 3O5IA 1NWSA 4ODKA 3ARRA 1W1YA 2M1IA 3RMEA 3KAFA 2KGJA 2ZQUA 3WH0A 3IK8A 1E6ZA 5I98A 4DZ3A 3JYMA 2RQSA 4W9QA 1KFWA 5HT1A 3KCEA 3WQWA 2WLZA 4U85A 1E6PA 2OFNA 2FKEA 2A3EA 4P8XA 4LAVA 4Z2GA 1FKGA 1FKSA 1KT0A 1E6RA 3B9EA 3WIJA 3CHDA 1EDQA 4ZPVR 1TCOC 2DSWA 2F2DA 3FY1A 4DRKA 1VF8A 1D7JA 2WLYA 3KACA 4ZS6A 3LUOA 3PRBA 3G6LA 2A3AA 1XRVA 4O2TA 3AQUA 3WKZA 1FKBA 4IT4A 1WNOA 3RM9A 3TDBA 4HBOA 2XP5A 4ITZA 3KABA 4KQZA 4XAKA 3WD2A 1B6CA 1HJVA 4ODMA 1ITXA 3ARWA 4P8UA 2LPVA 3KADA 1Q6IA 2QF8A 2KFWA 4IPXA 1EYMA 4IQCA 5GPRA 4TW6A 3TCZA 3ARQA 1A7XA 3BXWA 1JNTA 3AS0A 3IHZA 3CH9A 1HKIA 3WL0A 1HJWA 3ARZA 1ZBCA 3UI6A 4MSPA 3PRDA 4MNMA 3WD0A 1EHNA 4R0XA 3H9RB 4G2PA 1NH6A 5HKGA 4JFKA 2IF4A 2LGOA 3TC5A 1HKJA 4S3JA 1FKFA 4ODPA 5GQBA 2Y78A 3NI6A 2XP7A 3AS1A 1F8AB 1QPLA 2G41A 3IKGA 1GPFA 2FAPA 3O5MA 3AS3A 4BF8A 4QT3A 5HW7A 2O9OA 1HKMA 3ALFA 3O5EA 1O6IA 1NWUA 1FKTA 1FFQA 4ODOA 2IUZA 3O5OA 2XP8A 2MPHA 3O5RA 1NMVA 2PBCA 1ZL1A 3PRAA 2K8IA 4JFLA 4NNRA 1J6YA 4R5EA 4Z2JA 2DT2A 1ROTA 4W9PA 4PTMA 4J4NA 3KAGA 5HTGA 4GGQA 2PV1A 2PV3A 1EQ3A 2XP9A 1OGGA 3O5FA 2JZVA 1CTNA 3O5GA 3OOBA 3B9AA 3O5JA 4Z2HA 3WD1A 4DIPA 4MGVA 2O92A 3FXYA 4TNSA 3ODKA 1D7HA 3KAHA 4W9OA 1FKJA 4DWSB 5J6EA 2MLYA 1J4HA 1LL6A 2XPAA 1ZBKA 1XHGA 1LG1A 1EIBA 3CHFA 4P8WA 3WD4A 1R9HA 3UQAA 2A3BA 1IX5A 1W1TA 2YBTA 4Z2KA 4JFIA 1JVWA 3AS2A 1FKLA 4ODLA 2F21A 2KE0A 3UI5A 2WK2A 1NSGA 1X6NA 2DSZA 1FFRA 1OGBA 1FAPA 4DRHA 3ARXA 4L3NA 4NSBA 2L2SA 4ODQA 1LQ0A 2PI6A 3ARUA 1KT1A 2KO7A 4GIVA 2XP4A 1QZ2A 3PR9A 2DSUA 2ZR4A 1NWRA 4ZPTR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIV A;  1YW5 A;  3O5I A;  1FKR A;  1F8A B;  1QPL A;  3JYJ A;  4ODK A;  5HUA A;  3IKG A;  2D9F A;  1PIN A;  4ODR A;  2FAP A;  3O5M A;  4TW7 A;  4DRI A;  2M1I A;  1U79 A;  3PA7 A;  4BF8 A;  3KAF A;  4QT3 A;  4DH0 A;  4TYO A;  5HW7 A;  5BXJ A;  1ZCN A;  1ROU A;  2KGJ A;  2ZQU A;  1C9H A;  2RUR A;  2XP6 A;  4DRO A;  3O5E A;  3WH0 A;  2RUD A;  3IK8 A;  3UI4 A;  4DRQ A;  1FKT A;  4ODO A;  4JFJ A;  4C02 B;  4TW8 A;  5I98 A;  4DZ3 A;  3O5O A;  3JYM A;  2RQS A;  4W9Q A;  2XP8 A;  1P5Q A;  2LKN A;  4JFM A;  3KAI A;  5HT1 A;  3KCE A;  1J4R A;  2MPH A;  3O5D A;  3O5R A;  4U85 A;  1NMV A;  2PBC A;  1HXV A;  4JYS A;  5HW8 A;  2OFN A;  2K8I A;  2MF9 A;  3GPK A;  4JFL A;  2FKE A;  1FKK A;  4NNR A;  4J4O A;  2RUQ A;  2MLX A;  4QIB A;  5D75 A;  4FAP A;  1J6Y A;  4LAV A;  1ROT A;  1FKG A;  1FKS A;  1KT0 A;  2F4E A;  2ZR5 A;  2PPN A;  4W9P A;  1FD9 A;  1TCO C;  4FN2 A;  3KAG A;  4J4N A;  5HTG A;  2F2D A;  4GGQ A;  2PV1 A;  2PV3 A;  2ZR6 A;  4DRK A;  1EQ3 A;  2XP9 A;  5DIU A;  1D7J A;  3O5F A;  2JZV A;  3KAC A;  3O5G A;  3OOB A;  2DG3 A;  2KI3 A;  2MLZ A;  3O5J A;  3LUO A;  2UZ5 A;  4DIP A;  4DT4 A;  1W26 A;  2ZQT A;  3NRK A;  4MGV A;  3PRB A;  4TNS A;  1ZK6 A;  3ODK A;  2ZQV A;  1QPF A;  4O2T A;  1D7H A;  2XPB A;  3O5K A;  3KAH A;  4W9O A;  1FKJ A;  1M5Y A;  1FJD A;  1FKB A;  4U84 A;  5J6E A;  1D6O A;  2MLY A;  1FKI A;  1J4H A;  2XP5 A;  1T11 A;  4ITZ A;  1Y0O A;  2KR7 A;  3TDB A;  2XPA A;  3KAB A;  3MDY B;  1BL4 A;  1FKD A;  2ITK A;  2M2A A;  3O5Q A;  5HWB A;  3KZ7 A;  1D7I A;  1N1A A;  4DZ2 A;  5GPG A;  4LAY A;  4TX0 A;  2ZQS A;  1B6C A;  3RFW A;  4N19 A;  4U86 A;  1R9H A;  2VCD A;  4ODM A;  4DRN A;  1Q6H A;  4DRP A;  2LPV A;  1FKH A;  3I6C A;  4IQ2 A;  3KAD A;  1Q6I A;  3UQA A;  5HW6 A;  2Q5A A;  2KFW A;  4IPX A;  2M08 A;  3B7X A;  1EYM A;  1JVW A;  4JFI A;  4IQC A;  2LJ4 A;  3NTP A;  4TW6 A;  1FKL A;  1Q1C A;  3TCZ A;  4ODL A;  5B8I C;  1JNS A;  1A7X A;  4DRM A;  1JNT A;  2F21 A;  3CGN A;  3O5L A;  3UQI A;  3IHZ A;  2RSE A;  1F40 A;  2KE0 A;  3UI5 A;  2XP3 A;  3VAW A;  3JXV A;  3UI6 A;  2N87 A;  4DRJ A;  2PPO A;  3FAP A;  4MSP A;  1PBK A;  3IKD A;  3PRD A;  1NSG A;  2DG4 A;  4ODN A;  4QT2 A;  5DIT A;  2PPP A;  2MNT A;  1FAP A;  3UQB A;  4DRH A;  1Q6U A;  3CGM A;  2RUC A;  4R0X A;  3H9R B;  4G2P A;  1L1P A;  2L2S A;  2VN1 A;  4ODQ A;  5HKG A;  1BKF A;  4JFK A;  5HWC A;  2IF4 A;  3EY6 A;  2LGO A;  3TC5 A;  3O5P A;  1KT1 A;  2KO7 A;  2PV2 A;  2DG9 A;  4GIV A;  4LAX A;  1FKF A;  2XP4 A;  4ODP A;  1J4I A;  3UF8 A;  1QZ2 A;  4LAW A;  1NMW A;  4G50 A;  2ZR4 A;  2AWG A;  3RGC A;  2Y78 A;  1YAT A;  3NI6 A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 2DT0 A;  1SYT A;  3ARP A;  3B8S A;  5DIV A;  5HUA A;  4MNK A;  2D9F A;  4ODR A;  1U79 A;  3PA7 A;  4DH0 A;  1H0I A;  5BXJ A;  1ZCN A;  1C9H A;  1WB0 A;  4DRO A;  1HJX A;  1WAW A;  2RUD A;  4URI A;  1UR8 A;  4ZPW R;  3UI4 A;  4DRQ A;  4WKF A;  4JFJ A;  5JH8 A;  3ARO A;  1UR9 A;  4ML4 A;  3WD3 A;  4NZC A;  1P5Q A;  4JFM A;  4DWS D;  2DT3 A;  1LL4 A;  2YBU A;  3KAI A;  1J4R A;  5DO2 A;  1HXV A;  4JYS A;  2DT1 A;  3G6M A;  2DPE A;  1E15 A;  4Z2I A;  4QIB A;  5D75 A;  5HBF A;  3WL1 A;  3ARS A;  2F4E A;  2ZR5 A;  3W4R A;  2PPN A;  1FD9 A;  4FN2 A;  2DSV A;  1ZB5 A;  4DWS A;  2ZR6 A;  1E9L A;  4L72 B;  2KI3 A;  2MLZ A;  1TFV A;  2UZ5 A;  4DT4 A;  1X6L A;  3NRK A;  1W1V A;  1QPF A;  3ARY A;  3O5K A;  1M5Y A;  4U84 A;  3UF8 A;  1FKI A;  1T11 A;  3RM4 A;  2ITK A;  3RM8 A;  5HWB A;  1ZU8 A;  1SR0 A;  1N1A A;  3CHE A;  4LAY A;  4WKH A;  3QOK A;  2ZQS A;  4HAR A;  4Q7N A;  2VCD A;  4DRN A;  1Q6H A;  4DRP A;  1FKH A;  5HW6 A;  2LJ4 A;  1JNS A;  4MNJ A;  3CGN A;  3O5L A;  3UQI A;  1F40 A;  2XP3 A;  3VAW A;  3JXV A;  2N87 A;  1W9U A;  2PPO A;  3FAP A;  5DIT A;  4ODN A;  3IKD A;  4QT2 A;  2PPP A;  3UQB A;  3CZ8 A;  1NWT A;  2B5U B;  4WKA A;  2RUC A;  3ARV A;  2ESC A;  5HWC A;  3EY6 A;  1GUV A;  1D2K A;  2PV2 A;  1W9P A;  2P4V A;  4MTV A;  4LAW A;  2AWG A;  1YAT A;  1YW5 A;  1FKR A;  3JYJ A;  2EUL A;  1PIN A;  1LG2 A;  4TW7 A;  4DRI A;  4TYO A;  3ALG A;  2A3C A;  1ROU A;  1GOI A;  2RUR A;  2XP6 A;  4MPK A;  3BMB A;  1K9T A;  1JNE A;  1H0G A;  4QZV B;  4C02 B;  4TW8 A;  1HKK A;  2OLH A;  2LKN A;  3ART A;  4Q22 A;  3O5D A;  5HW8 A;  2MF9 A;  3GPK A;  4MAV A;  1FKK A;  4J4O A;  2RUQ A;  2MLX A;  4Z2L A;  4FAP A;  4LGX A;  4AY1 A;  4IT6 A;  1OWQ A;  5DIU A;  2WM0 A;  2DG3 A;  5DF0 A;  2AOS A;  3OA5 A;  1W26 A;  2ZQT A;  1E6N A;  1ZK6 A;  2B31 A;  2ZQV A;  4S3K A;  2XPB A;  2FDM A;  1FJD A;  1RD6 A;  1D6O A;  1Y0O A;  2KR7 A;  3MDY B;  1BL4 A;  1FKD A;  2M2A A;  3O5Q A;  3KZ7 A;  1D7I A;  4DZ2 A;  5GPG A;  4TX0 A;  3RFW A;  4N19 A;  4U86 A;  3I6C A;  4IQ2 A;  2Q5A A;  4HBE A;  2M08 A;  3B7X A;  3NTP A;  1Q1C A;  4WJX A;  5B8I C;  4DRM A;  2G8Z A;  1LJY A;  4KR0 B;  2RSE A;  3CHC A;  3WQV A;  4W5U A;  4DRJ A;  1PBK A;  2DG4 A;  4DWS C;  1W1P A;  2MNT A;  1W9V A;  1Q6U A;  4P8V A;  3CGM A;  1JCH B;  2VN1 A;  5DEZ A;  4WIW A;  1ZBV A;  1BKF A;  1ZBW A;  3O5P A;  1LL7 A;  4MNL A;  1JND A;  4UDM A;  2DG9 A;  4LAX A;  1J4I A;  3B9D A;  4WK9 A;  1NMW A;  4G50 A;  2PN0 A;  3RGC A;  1L1P A;  3O5I A;  1NWS A;  4ODK A;  3ARR A;  1W1Y A;  2M1I A;  3RME A;  3KAF A;  2KGJ A;  2ZQU A;  3WH0 A;  3IK8 A;  1E6Z A;  5I98 A;  4DZ3 A;  3JYM A;  2RQS A;  4W9Q A;  1KFW A;  5HT1 A;  3KCE A;  3WQW A;  2WLZ A;  4U85 A;  1E6P A;  3GU0 A;  2OFN A;  2FKE A;  2A3E A;  4P8X A;  4LAV A;  4Z2G A;  1FKG A;  1FKS A;  1KT0 A;  1E6R A;  3B9E A;  3WIJ A;  3CHD A;  1EDQ A;  4ZPV R;  1TCO C;  2DSW A;  2F2D A;  3FY1 A;  4DRK A;  1VF8 A;  1D7J A;  2WLY A;  3KAC A;  4ZS6 A;  3LUO A;  1GRJ A;  3PRB A;  3G6L A;  2A3A A;  1XRV A;  4O2T A;  3AQU A;  3WKZ A;  1FKB A;  4IT4 A;  1WNO A;  3RM9 A;  3TDB A;  4HBO A;  2XP5 A;  4ITZ A;  3KAB A;  4KQZ A;  4XAK A;  3WD2 A;  1B6C A;  1HJV A;  4ODM A;  1ITX A;  3ARW A;  4P8U A;  2LPV A;  3EIP A;  3KAD A;  1Q6I A;  2QF8 A;  2KFW A;  4IPX A;  1EYM A;  4IQC A;  5GPR A;  4TW6 A;  3TCZ A;  3ARQ A;  1A7X A;  3BXW A;  1JNT A;  2ETN A;  3AS0 A;  3IHZ A;  3CH9 A;  1HKI A;  3WL0 A;  1HJW A;  3ARZ A;  1ZBC A;  3UI6 A;  4MSP A;  3PRD A;  4MNM A;  3WD0 A;  1EHN A;  4R0X A;  3H9R B;  4G2P A;  1NH6 A;  1E44 A;  5HKG A;  4JFK A;  2IF4 A;  2LGO A;  3TC5 A;  1HKJ A;  4S3J A;  1FKF A;  4ODP A;  5GQB A;  2Y78 A;  3NI6 A;  2XP7 A;  3AS1 A;  1F8A B;  1QPL A;  2G41 A;  3IKG A;  1GPF A;  2FAP A;  3O5M A;  3AS3 A;  4BF8 A;  4QT3 A;  5HW7 A;  2O9O A;  1HKM A;  3GTY X;  3ALF A;  3O5E A;  1O6I A;  1NWU A;  1FKT A;  1FFQ A;  4ODO A;  2IUZ A;  3O5O A;  2XP8 A;  2MPH A;  3O5R A;  1NMV A;  2PBC A;  1ZL1 A;  3PRA A;  2K8I A;  4JFL A;  4NNR A;  1J6Y A;  4R5E A;  4Z2J A;  2DT2 A;  1ROT A;  4W9P A;  4PTM A;  4J4N A;  3KAG A;  5HTG A;  4GGQ A;  2PV1 A;  2PV3 A;  1EQ3 A;  2XP9 A;  1OGG A;  3O5F A;  2JZV A;  1CTN A;  3O5G A;  3OOB A;  3B9A A;  3O5J A;  4Z2H A;  3WD1 A;  4DIP A;  4MGV A;  2O92 A;  3FXY A;  4TNS A;  3ODK A;  1D7H A;  3KAH A;  4W9O A;  1FKJ A;  4DWS B;  5J6E A;  2MLY A;  1J4H A;  1LL6 A;  2XPA A;  1ZBK A;  1XHG A;  1LG1 A;  1EIB A;  3CHF A;  4P8W A;  3WD4 A;  1R9H A;  3UQA A;  2A3B A;  1IX5 A;  1W1T A;  2YBT A;  4Z2K A;  4JFI A;  1JVW A;  3AS2 A;  1FKL A;  4ODL A;  2F21 A;  2KE0 A;  3UI5 A;  2WK2 A;  1NSG A;  1X6N A;  2DSZ A;  1FFR A;  1OGB A;  1FAP A;  4DRH A;  3ARX A;  4L3N A;  4NSB A;  2L2S A;  4ODQ A;  1LQ0 A;  2PI6 A;  3ARU A;  1KT1 A;  2KO7 A;  4GIV A;  2XP4 A;  2F23 A;  1QZ2 A;  3PR9 A;  2DSU A;  2ZR4 A;  1NWR A;  4ZPT R; 
#chains in the Genus database with same CATH homology
 2DT0 A;  1SYT A;  3ARP A;  3B8S A;  5DIV A;  5HUA A;  4MNK A;  2D9F A;  4ODR A;  1U79 A;  3PA7 A;  4DH0 A;  1H0I A;  5BXJ A;  1ZCN A;  1C9H A;  1WB0 A;  4DRO A;  1HJX A;  1WAW A;  2RUD A;  4URI A;  1UR8 A;  4ZPW R;  3UI4 A;  4DRQ A;  4WKF A;  4JFJ A;  5JH8 A;  3ARO A;  1UR9 A;  4ML4 A;  3WD3 A;  4NZC A;  1P5Q A;  4JFM A;  4DWS D;  2DT3 A;  1LL4 A;  2YBU A;  3KAI A;  1J4R A;  5DO2 A;  1HXV A;  4JYS A;  2DT1 A;  3G6M A;  2DPE A;  1E15 A;  4Z2I A;  4QIB A;  5D75 A;  5HBF A;  3WL1 A;  3ARS A;  2F4E A;  2ZR5 A;  3W4R A;  2PPN A;  1FD9 A;  4FN2 A;  2DSV A;  1ZB5 A;  4DWS A;  2ZR6 A;  1E9L A;  4L72 B;  2KI3 A;  2MLZ A;  1TFV A;  2UZ5 A;  4DT4 A;  1X6L A;  3NRK A;  1W1V A;  1QPF A;  3ARY A;  3O5K A;  1M5Y A;  4U84 A;  3UF8 A;  1FKI A;  1T11 A;  3RM4 A;  2ITK A;  3RM8 A;  5HWB A;  1ZU8 A;  1SR0 A;  1N1A A;  3CHE A;  4LAY A;  4WKH A;  3QOK A;  2ZQS A;  4HAR A;  4Q7N A;  2VCD A;  4DRN A;  1Q6H A;  4DRP A;  1FKH A;  5HW6 A;  2LJ4 A;  1JNS A;  4MNJ A;  3CGN A;  3O5L A;  3UQI A;  1F40 A;  2XP3 A;  3VAW A;  3JXV A;  2N87 A;  1W9U A;  2PPO A;  3FAP A;  5DIT A;  4ODN A;  3IKD A;  4QT2 A;  2PPP A;  3UQB A;  3CZ8 A;  1NWT A;  4WKA A;  2RUC A;  3ARV A;  2ESC A;  5HWC A;  3EY6 A;  1GUV A;  1D2K A;  2PV2 A;  1W9P A;  4MTV A;  4LAW A;  2AWG A;  1YAT A;  1YW5 A;  1FKR A;  3JYJ A;  1PIN A;  1LG2 A;  4TW7 A;  4DRI A;  4TYO A;  3ALG A;  2A3C A;  1ROU A;  1GOI A;  2RUR A;  2XP6 A;  4MPK A;  1K9T A;  1JNE A;  1H0G A;  4QZV B;  4C02 B;  4TW8 A;  1HKK A;  2OLH A;  2LKN A;  3ART A;  4Q22 A;  3O5D A;  5HW8 A;  2MF9 A;  3GPK A;  4MAV A;  1FKK A;  4J4O A;  2RUQ A;  2MLX A;  4Z2L A;  4FAP A;  4LGX A;  4AY1 A;  4IT6 A;  1OWQ A;  5DIU A;  2WM0 A;  2DG3 A;  5DF0 A;  2AOS A;  3OA5 A;  1W26 A;  2ZQT A;  1E6N A;  1ZK6 A;  2B31 A;  2ZQV A;  4S3K A;  2XPB A;  2FDM A;  1FJD A;  1RD6 A;  1D6O A;  1Y0O A;  2KR7 A;  3MDY B;  1BL4 A;  1FKD A;  2M2A A;  3O5Q A;  3KZ7 A;  1D7I A;  4DZ2 A;  5GPG A;  4TX0 A;  3RFW A;  4N19 A;  4U86 A;  3I6C A;  4IQ2 A;  2Q5A A;  4HBE A;  2M08 A;  3B7X A;  3NTP A;  1Q1C A;  4WJX A;  5B8I C;  4DRM A;  2G8Z A;  1LJY A;  4KR0 B;  2RSE A;  3CHC A;  3WQV A;  4W5U A;  4DRJ A;  1PBK A;  2DG4 A;  4DWS C;  1W1P A;  2MNT A;  1W9V A;  1Q6U A;  4P8V A;  3CGM A;  2VN1 A;  5DEZ A;  4WIW A;  1ZBV A;  1BKF A;  1ZBW A;  3O5P A;  1LL7 A;  4MNL A;  1JND A;  2DG9 A;  4LAX A;  1J4I A;  3B9D A;  4WK9 A;  1NMW A;  4G50 A;  1L1P A;  3RGC A;  3O5I A;  1NWS A;  4ODK A;  3ARR A;  1W1Y A;  2M1I A;  3RME A;  3KAF A;  2KGJ A;  2ZQU A;  3WH0 A;  3IK8 A;  1E6Z A;  5I98 A;  4DZ3 A;  3JYM A;  2RQS A;  4W9Q A;  1KFW A;  5HT1 A;  3KCE A;  3WQW A;  2WLZ A;  4U85 A;  1E6P A;  2OFN A;  2FKE A;  2A3E A;  4P8X A;  4LAV A;  4Z2G A;  1FKG A;  1FKS A;  1KT0 A;  1E6R A;  3B9E A;  3WIJ A;  3CHD A;  1EDQ A;  4ZPV R;  1TCO C;  2DSW A;  2F2D A;  3FY1 A;  4DRK A;  1VF8 A;  1D7J A;  2WLY A;  3KAC A;  4ZS6 A;  3LUO A;  3PRB A;  3G6L A;  2A3A A;  1XRV A;  4O2T A;  3AQU A;  3WKZ A;  1FKB A;  4IT4 A;  1WNO A;  3RM9 A;  3TDB A;  4HBO A;  2XP5 A;  4ITZ A;  3KAB A;  4KQZ A;  4XAK A;  3WD2 A;  1B6C A;  1HJV A;  4ODM A;  1ITX A;  3ARW A;  4P8U A;  2LPV A;  3KAD A;  1Q6I A;  2QF8 A;  2KFW A;  4IPX A;  1EYM A;  4IQC A;  5GPR A;  4TW6 A;  3TCZ A;  3ARQ A;  1A7X A;  3BXW A;  1JNT A;  3AS0 A;  3IHZ A;  3CH9 A;  1HKI A;  3WL0 A;  1HJW A;  3ARZ A;  1ZBC A;  3UI6 A;  4MSP A;  3PRD A;  4MNM A;  3WD0 A;  1EHN A;  4R0X A;  3H9R B;  4G2P A;  1NH6 A;  5HKG A;  4JFK A;  2IF4 A;  2LGO A;  3TC5 A;  1HKJ A;  4S3J A;  1FKF A;  4ODP A;  5GQB A;  2Y78 A;  3NI6 A;  2XP7 A;  3AS1 A;  1F8A B;  1QPL A;  2G41 A;  3IKG A;  1GPF A;  2FAP A;  3O5M A;  3AS3 A;  4BF8 A;  4QT3 A;  5HW7 A;  2O9O A;  1HKM A;  3ALF A;  3O5E A;  1O6I A;  1NWU A;  1FKT A;  1FFQ A;  4ODO A;  2IUZ A;  3O5O A;  2XP8 A;  2MPH A;  3O5R A;  1NMV A;  2PBC A;  1ZL1 A;  3PRA A;  2K8I A;  4JFL A;  4NNR A;  1J6Y A;  4R5E A;  4Z2J A;  2DT2 A;  1ROT A;  4W9P A;  4PTM A;  4J4N A;  3KAG A;  5HTG A;  4GGQ A;  2PV1 A;  2PV3 A;  1EQ3 A;  2XP9 A;  1OGG A;  3O5F A;  2JZV A;  1CTN A;  3O5G A;  3OOB A;  3B9A A;  3O5J A;  4Z2H A;  3WD1 A;  4DIP A;  4MGV A;  2O92 A;  3FXY A;  4TNS A;  3ODK A;  1D7H A;  3KAH A;  4W9O A;  1FKJ A;  4DWS B;  5J6E A;  2MLY A;  1J4H A;  1LL6 A;  2XPA A;  1ZBK A;  1XHG A;  1LG1 A;  1EIB A;  3CHF A;  4P8W A;  3WD4 A;  1R9H A;  3UQA A;  2A3B A;  1IX5 A;  1W1T A;  2YBT A;  4Z2K A;  4JFI A;  1JVW A;  3AS2 A;  1FKL A;  4ODL A;  2F21 A;  2KE0 A;  3UI5 A;  2WK2 A;  1NSG A;  1X6N A;  2DSZ A;  1FFR A;  1OGB A;  1FAP A;  4DRH A;  3ARX A;  4L3N A;  4NSB A;  2L2S A;  4ODQ A;  1LQ0 A;  2PI6 A;  3ARU A;  1KT1 A;  2KO7 A;  4GIV A;  2XP4 A;  1QZ2 A;  3PR9 A;  2DSU A;  2ZR4 A;  1NWR A;  4ZPT R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...