2LJIA

Structure of a protein from haloferax volcanii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
total genus 5
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ljiA00
2L32A 2LJIA
chains in the Genus database with same CATH superfamily
2K39A 3AEDB 5JHBA 2O6VB 5J17A 4P1CC 1J0GA 2D3AA 1JALA 2DZKA 3M95A 4DHZB 1M4VA 3HK0A 4DDID 2GOWA 2WXKA 2V3PA 4C4VB 4JPSA 1V6EA 4HDQA 1BUIC 3UF8A 4ZRIA 1YJJA 4LNNA 1WGKA 1MG8A 2NMQA 3RN9C 1WGHA 1E9MA 4IWQA 1E7VA 1LGRA 1C78A 4B0EA 1JWBD 2K9XA 1AYFA 4JGHB 1D5XC 3ZKJC 1EM7A 3P42A 2GBRA 3DBSA 4OW0A 4MGYE 1HE8A 3EGRA 1ET6A 1Q10A 1WI0A 2KN4A 4KKJA 3GZNI 4BKSA 3AE7B 2L0FA 4BZAA 3BIID 2MEKA 2INCC 5FR3A 1UWMA 3NS8A 5JXVA 4WAAA 5C2TB 2WDTB 4RF1A 4N58A 2Z8LA 1UNSA 2V9HA 2A5UA 4GSWA 3KUCB 5E6JA 2HDEA 2RGFA 1DGJA 1E0ZA 1ZPSA 1KF6B 3P4PB 1FD6A 4J3OD 2UWQA 3PVLA 3RNCC 1XXGA 2V0GA 4MACA 1D3ZA 4J6IA 2R2QA 2PTLA 3BVZA 3GZNB 2KXJA 2LI5A 3Q69A 3ENEA 4W9JA 5D6JB 5GMVA 3SFDB 4KGRA 4E71A 1H8CA 3PREA 1WGGA 4YTNB 3S2AA 3ML8A 3HM3A 3M62B 3N1XC 1E5WA 1H4RA 1PYWD 3DWGC 4MM3A 1EU3A 1K8RB 4RGTA 1N61A 4IWPA 5EE3A 4IDIA 1CK1A 1VD2A 4XWWA 4JWSC 2HTHA 2NPTA 1N6ZA 1J8CA 2RSUA 2AQ3B 2L05A 2AQ2B 3Q8EA 3RI7C 4ANVA 3JSVA 4BBNF 3VTVA 1OEYA 2NCNA 1P0RA 1EO6A 1ESFA 2YLMA 5HHDG 4HCNB 4MGIE 5AZGA 4D2KA 3Q14C 3WA0A 4K7UA 1F2RC 2AYOB 4ZYSA 3RZFA 1YMHE 2JT4B 1TYGB 4WWNA 3VH3B 2BYTA 3RCZA 1FEHA 2V1YA 1VZ8A 4GN1A 3OJ3A 3O13A 1EWCA 2W3RA 2QC8A 4ZDVA 1FXTB 3JVZX 2DHZA 3PT2B 2ON8A 2MWSB 1I42A 2K5PA 1R4MB 1NYRA 3BYYB 1F1HA 1WXQA 3QK0A 2MJEA 1PGAA 3BVMA 5G5GA 1SB3C 3AE6B 1AW7A 3DBRI 2I2YA 5G2NA 4XC2A 4GDKA 2NR2A 3L17A 2V4IB 4NJ6A 5DCNA 4W9KA 3ZJTA 1WX7A 1FCCC 2KMCA 2WS3B 3B9JA 3P4SB 1ZGUB 3AV8A 2G4SA 2JZ3B 3N3KB 3KWVA 4CQNA 2JUOA 3L54A 3EECA 2I1JA 3ZVVA 3TJPA 1HTQA 2AWTA 1ZUD2 2PVGC 1WGDA 5D94A 3IT4B 3DBLI 3IHPC 1QOFA 3RNEC 1XD3B 2EKIA 3AECB 4ZOHC 1OTRB 4A55A 3GS2A 4OVZA 1A5RA 2GLSA 2KKCA 3ZUNA 3H7PB 3ZGZA 4HJGE 4US8A 1T5XD 2FAZA 1OQQA 3AE9B 3QA8A 1XLOA 1RFKA 1HZ6A 2X38A 3LYYA 1F2RI 3PLUA 3QX1A 5H8YE 1Y8RC 4TQ0A 2BYEA 2BF8B 1OEYJ 4W9EA 2G9HD 5BMIA 3PPAA 5AEKB 1TKYA 2DYOA 3WAPA 2DNFA 2WXFA 4RCOA 2WYQA 1GC6A 1I4RA 2KMMA 3NVZA 2IYDB 2L76A 4RF0A 3LXFA 3U7DA 3PLVA 4UDUC 1QOBA 3IG3A 1I4PA 2KX3A 3EHVA 2BVCA 3AXCA 3AE2B 3IAS1 1YIWA 1E6EB 5LXIB 4TMAB 1VRAB 2W55A 4IOIE 3ZNHB 2KWCA 2G1EA 3A9JB 3AE5B 3AEAB 5BO4B 3AU5A 3Q8CA 3W5VB 4PK1A 5JHAA 3MJ5A 1P3QU 4NAWB 1N60A 2MRPA 4YTMB 1DOYA 3NY5A 2MCNB 3U52E 2KQ4X 4XE0A 1GB4A 4FN2A 1WR1A 1HZ5A 2KACA 1WE6A 3H8HA 3B0AA 1ENFA 1OQYA 2J0KA 2WU2B 1UGMA 4EE2A 3NJTA 2L8JA 1SE4A 3AU4A 4YSXB 3OG5A 1FO4A 3BYTB 2N9KA 2R61A 5EE1A 3HVDA 4YL8A 3RT3B 1K52A 4RGMA 1JWAD 4MSQB 1KLUD 4LK0M 1JWUD 3PRMB 2MBHA 2ONQA 2JY6A 2VRRB 1CMXB 3N20C 1J7CA 2ZPNA 2KAJA 5G55A 1C79A 3VTWA 1T6BX 3RULA 2KDIA 2NVUI 3DPDA 2IY1B 1SE3A 5HKHA 1IGCA 3QJZA 4TSSA 1V49A 3CF6E 2GRIA 2NPTB 4L1BA 4MJSA 1E7UA 3DVGX 4LJPB 3VR9B 2RDHA 3V62A 1LM8B 2IBIB 4KVGB 1V1PB 3A1QA 3IXSA 2XBBC 4IC7B 2DWQA 3NZSA 5C3JB 2LGIA 3QAQA 2ZNVB 3L08A 2MHJA 1N5XA 2FCQA 3M63B 1ZP0B 2FE8A 2FNJB 3RYTA 2IDYA 2MJ3A 2IGGA 1L4ZB 1WR6E 2KX0A 2KN5A 2BB6A 2QIEB 1VR9A 4E74A 2LASA 4X57B 3BINA 3SEBA 3N32A 1TT5B 2KT7A 4IKGA 4MT5A 4MH0E 1KJTA 1RYJA 2FCMA 3ZDMC 3PGEA 2YEPF 4OZCA 1UD7A 2FIFA 2MP2A 2M19A 4EUTA 4NQLB 3WANA 4FJYA 2M17A 2MLBA 4G11A 1KRHA 2KC2A 1WJ4A 2IJ0A 2W82A 3RPFC 4RM9A 3UGBB 2BWES 1VJKA 1AWDA 3BY4B 5D2MB 5C23A 3ZO5B 4CO7A 3RNFC 3ZNGC 5L83A 5H92C 2GI9A 3PSEB 5CHWA 4FJZA 1UZXB 1LO5D 3GOEA 2L7RA 2BTEA 1YQ3B 5FR6A 1SBBB 3Q8BA 3TEZA 4ITKA 2VH2A 3U4EG 4C56C 1D4BA 1MFWA 3RD2A 4JQWC 4K3BA 1JCKB 4JX1C 2FCNA 3E9SA 4IM2A 5CTRC 2BYFA 1F9JA 1B9RA 2LJIA 4K7SA 1P9DU 2RMMA 2CJNA 1J7AA 3CSFA 1ZDXA 2D3GA 3L10B 5IP4D 1V5OA 2HE7A 2Y5BB 3N30A 4BBNC 2WGSA 3DVGY 2DX5B 2KDBA 3QARA 2FIDA 4BAXA 2G4DB 3IFWB 2KFJA 1HEZE 4XX5A 3AM9A 4YSYB 3ALBA 1KM7A 1J19A 1ACCA 1IBXB 3C8YA 4C7ZA 1FM0D 1ZKHA 1ZXHA 4P6VF 2V3SA 2K25A 3KH0A 3RNBC 2M1MA 5FK9C 4RM8A 1XLPA 2W54A 4MM3B 2PVOD 3NVYA 1FMAD 5MPOA 2ZVNA 1R4NB 3TUOA 4LCDE 3MTNB 5GXGB 2WXOA 3U8ZA 4L23A 5AZFA 4KDLB 3LB8C 2KYWA 2LJ5A 3DVNU 2D3CA 4A90A 2M56B 1V9JA 2CHXA 1ZOYB 2PE6B 3DVNV 1YD8U 3QQ8B 4AP4C 3NHEB 2N9LA 1V97A 2WDRB 1QILA 2BKRB 2EMSA 3DCGA 2MBQA 2CU1A 2MW5A 3W2DA 2KDEB 4WQMA 3KUZA 3ZYYX 4EZKA 4W9IA 3EA6A 3ECIA 1PGBA 1WE7A 3SD5A 1N5WA 1WJUA 2GBNA 1C4AA 1A70A 3VUYA 1YJIA 3T3NA 4I6LB 2UYZB 1PDXA 4JIOU 1WF9A 1V8CA 3N1YC 4HLEA 4KDIC 1E8ZA 3GP7A 2WHIA 2O6VD 1V86A 2K8BA 1TGZB 2CHWA 2OEDA 2KDMA 1NI3A 4XGAB 3PS6A 3A4RA 3P4QB 3R8BA 2TSSA 2EKEC 3Q8FA 3AE8B 4MELA 1V81A 3C0RB 2KJHB 3RFZB 2KO3A 1F52A 3URYA 3IVFA 3A33B 4HDOA 2KTFA 3PZ7A 2KQ7A 1V1OA 1K50A 4ICVA 1WSPA 3QCAA 4A3PA 3P1MA 2Z0DB 2JPHA 4NAMA 1LFDA 1WXAA 4KGTA 2B76B 1Q0WB 1YQ4B 2LGXA 4DXGA 3Q3OC 2DENB 3KYDD 2BT6A 2D2QA 2ZJDA 1TS4A 1JWMD 1QZEA 4DXFA 3ML9A 1BXTA 1HXYD 1PQSA 4US9A 2MX2A 2LGYA 3NVVA 2J53A 1SJHD 2M0XA 2ZVOA 3ZNID 1D5ZC 1C1YB 4WJOA 4FJVB 2KTRB 4NJCA 2OJRA 1IBXA 3VXWA 2JQRB 4BOZB 3Q8AA 4GMVA 4AWJA 2CR5A 4MGZE 4ZYNA 2BGFA 3MJWA 1TS3A 4LDTD 3UQAA 2GMIC 1SF0A 4AS1A 3TIXA 1T0SC 2L83A 2REXA 3SDLC 1VDVA 1T0QC 1D6EC 2WWZA 4W9DA 3AE4B 2QMTA 1IPGA 1P98A 2K1FA 5BYQA 2KFKA 3NZUA 1T0RC 2SEBD 4BKTA 3RNAC 1WXMA 2AL3A 3C19A 1C77A 1TY0A 3B08A 2MBOA 1TBEA 4XWTA 4DQOC 3VVWB 3TL5A 2Z59B 1I4HA 1ISNA 1TKGA 2NBUA 5J18A 1GUAB 1EF5A 4N6EB 1QF6A 5C1ZA 3NS1A 3HRDD 4G0NB 1TKEA 2IPKD 3P4RB 2N7JA 4FHKA 3ZTCA 2J0MA 5G5HA 1HQRD 4C80A 3A9KB 1UGJA 5TSSA 3D32A 4KKIA 1WIAA 3H7PA 1EU4A 2B3AA 2PW9A 1XO3A 3A9JA 2ZCBA 2FUHB 4K7WA 3Q3MC 4WWMA 1WX8A 3OJ4B 3VTUA 3AE3B 2KJ6A 4KV2A 4KIKA 2JWZA 4BKSD 3PHXB 5LLIA 5DPRA 4HPPA 1NI2A 2PKOA 3RZWC 4HWIB 5JZEB 4RGNA 2PLPA 3WIMA 1EWYC 5IN7A 2JSVX 3MHZA 3NZ3A 2DAJA 4P7IA 4YSZB 3TBLD 2YEPB 2ZW1A 5J2RA 3FAHA 3HIZA 3LJ3A 1MHXA 1WGRA 2JRIB 4ARIA 3V6EB 1RFAA 1R4MI 3KVFB 2LHEA 2E6XA 5D3IB 5AZHA 4L2YA 4OZAA 1TS5A 2WNMA 2AX5A 3R3MA 4M01A 2K8HA 3PTFC 3KUDB 1KOTA 1I4QA 3ONSA 3U2SC 4ASWC 5IOIA 4YT0B 5CX3A 2LVQA 1WYGA 4OHJA 3DHIC 1YJ1A 1VLBA 3N9YC 1WWTA 1L7YA 3RNGC 2MBEA 2J42A 3NG0A 3P63A 3TCAA 3X0WA 4EKUA 3APFA 1WM2A 2D07B 3HVZA 1P7FA 2LGSA 2K0PA 2CHZA 3B2FA 4EOYA 4RMAA 3ZQ4A 2KZRA 2KNBA 2KVZA 3A1QB 1UBQA 1GNUA 3WALA 5FKAC 2JF5A 1D5MC 1NYQA 1UUPA 1AARA 4M8NA 2MSED 4C00A 1FXAA 2JX5A 1K53A 1GB1A 4PYUA 1Q5WB 4RFBA 2IO0B 2FCSA 1P7EA 3W5UB 4NNJB 4E3CA 2RD0A 2PE9A 1S3SG 1JWSD 1WGYA 3SFEB 5BYSA 3R7RA 3R66C 1GPXA 2JVCA 3VAWA 2XN9C 2L00B 4TUUA 2C9WB 1G6JA 3ZW3A 4HKQA 1KLGD 1TJEA 2MH7A 1QLBB 2KK8A 2N7EA 3TEXA 3FILA 2JZZA 1HA5A 1LXDA 1V80A 4ICUA 4M8MA 3VHTC 3V05A 2YVCA 1ZXIA 4AUQC 2J7QB 2PIAA 2OOBB 2Z0EB 4FBJB 2EMTA 1E8WA 4JWUC 3V3XA 4OZBA 3U30A 3N1ZC 2KC1A 4GU2A 2ACZB 3CMMB 2PPHA 2HTME 4NY0A 2Y5PA 3PHWB 4AOFA 1C9FA 1CZPA 4IWOA 1WXSA 1YX5B 2EELA 4YTPB 3EUB2 4RH6A 3UINB 4WH4A 2HJ8A 5JH5C 1TZOA 1YQBA 2QEJC 2KJRA 3TEWA 3EC8A 2BPSA 3DBHI 1YN5A 5EE9A 2O2VA 4HXDA 2K8CA 1QOAA 2LVPA 1XCQL 2LHDA 4YXDB 1FNWA 3K9PB 3W1YA 3L16A 2BS3B 2KQSA 4MSMB 1I35A 4RGOS 2WDVB 2WXMA 5IKCM 2RPQA 1I4GA 3L0WB 3GE3C 4YWGG 3ZDTA 2GBJA 4ZHPA 5KHQA 4BKGA 3KLSX 1PUTA 3BZDB 4DHJB 2KMAA 1XLQA 4I6NB 4S17A 2JYEA 2QCZA 4KIKB 3Q3FA 3UIPB 3AEFB 4W9CA 1WZ3A 2LEKA 1N63A 1KH0A 3FKYA 5HFYA 2INNE 2V3NA 1ROEA 3PZDA 2ZCCA 2JXXA 4LDTB 4PS3A 2IO1B 4JL9A 1ZW7A 1WM3A 2BKFA 3RMKC 1MVKA 2AL6A 4A8XC 1TTNA 2WDQB 3WAMA 2BQQA 5T8IA 4AQ7A 2IO3B 4WJNA 3VUXA 2L1AA 3UI3A 4LTUA 3W1SA 1C76A 2KANA 2IO2B 2CJOA 2BBCA 1WX9A 1SXTA 4IG7B 1L5PA 1WYWB 2C7NB 3Q3NC 2KVRA 1FRRA 1UBIA 3A9KA 4PYZA 4HPLB 3APDA 1NEKB 2AEHA 4KZ0A 2G45B 1DOXA 3DDCB 4LNOA 2O2VB 4URKA 2BB5A 1VZ7A 1I4XA 1FNUA 3AEGB 4HROA 2CKHB 3R7QA 2C60A 4ANUA 4WQOB 3V61A 3ZNZB 1MG4A 4II2B 3NOBA 1SE9A 1V1PA 2D3BA 2XNAC 4C7YA 3I57A 3M3JA 4FULA 1QKZA 3KQ4A 3AEEB 2GB1A 1YOVB 4WIPA 2JRHA 4REZA 2I38A 5CHVC 3ZRFA 1ET9A 3E56A 4GXBA 1SIFA 2DYMA 2LFIA 3I63C 2INPE 2L52A 1WJ6A 2FUG1 1OFFA 2LWPA 1RLFA 4OVVA 1ZE3D 1B1ZA 2KWVB 2WQYB 4WJQA 2K6DB 2MA9B 4HKZE 1T0YA 2JWUA 4DXAB 3X23A 1WH3A 3WAOA 1UH6A 3DBRB 3MFGA 2ASQA 1HTOA 2ZNVC 4BFRA 1JRPA 4M0WB 4WWPA 4PT5A 2W3SA 3OAWA 2CU3A 4GGQA 3ZJUA 4DHZE 2WXIA 3BK2A 4W9LA 2D10A 2BS2B 4MDKE 4DHJD 3AE1B 3MHSD 2M4NA 1C3TA 4I6PA 3DBHB 3LDZE 1WMHA 4FXCA 3DQVA 1Q1OA 2WX1A 1BMLC 1SSNA 1BT0A 2MBBB 2WXNA 3Q3JA 4HVBA 2C7MB 2RDBC 5DPTA 2DBYA 1C4PA 1V2YA 2D11A 3DWMA 4G3XB 2MJDA 4NPNA 3SU8X 3I3TB 1FPYA 5E6OA 1QQRA 2KLGA 3HHMA 2QSDA 3VRAB 1YN3A 1IUEA 2WXRA 1UWXA 4NZLB 2OHFA 1JROA 3JW0X 2RR9A 2NBWB 4LNFA 2WX0A 4USAA 1FFVA 5E6NA 4XYCA 1XQQA 3VRBB 3VDZA 4C4VA 1SJED 3UIOB 1NDDA 3OLMD 1YN4A 2WU5B 2LZ6A 3ZIMA 3VQIA 2KWDA 1SGHA 5D7GA 3T9LA 2PEAA 3VFKA 1YNTE 1F0ZA 4M0WA 1ZDVA 5IAAC 4TQ1A 1L0XB 5AUIA 3IT6B 4B9KA 2L32A 2LRUA 2LUMA 3QWZB 3FC4A 2CS4A 1Y56A 3MC8A 2VH1A 4LJOB 2BYVE 3R2TA 2WXGA 1IP9A 3QIJA 3H9DA 2XEWA 4GDLA 3NRZA 5D3DA 2QJLA 1IYFA 1NBFC 2N9EB 2WXQA 4A20A 1V5TA 2J0JA 2LMCA 3EFUA 4KSKC 1E8YA 1FXIA 2D5GA 2PJHA 3VUWA 2DZMA 2ICIA 3PZ8A 3DBLB 1GC7A 3ABVB 2KDFB 5L95C 3L13A 3KW5B 4FHJA 4FADA 4EZJA 5TR5A 1C4CA 3ETRA 2IGDA 1UELA 4MEMA 4F1SA 4WWOA 1MHHE 3MC9A 3PRZA 4K81A 4ANWA 4B0MA 3AEBB 2M0AA 1PFDA 4JE3B 2E3TA 1Z5SB 2ZEQA 1FRDA 4GOCA 2VZKB 3PO0A 4HPMB 4QAYA 4BOSC 5LXHA 1WZ0A 4M02A 1E8XA 1F77A 3BVGA 2NTSA 4NQKE 4XZ4A 5LNK1 2J52A 2WXHA 4AJWA 2RPVA 1L2NA 2Y3AA 4ZRJA 1L0YB 5BMHA 3H6NA 4LLGM 4TKNA 5DPSA 3Q6BA 4W9HA 2NTTA 1FIQA 1S1QB 3VR8B 1CQVA 4DWFA 4FA6A 1WMHB 2QHOA 1R7SA 2N9XA 4XDDA 1EF1A 5IA7A 2JU6X 1M94A 5AUKA 5HG2A 1WRIA 2KTRA 2K22A 4FLHA 1IGDA 3AMZA 3W9CB 3T8MA 4NAWA 2JZPA 2J4XA 3GE8C 4AJYB 1MJDA 3W1SC 2SAKA 3DOWA 1SIJA 1RWSA 2FBWB 4O1NA 3BWUD 5IO9A 1FCLA 5KHOA 4B6WA 2LGDA 1XLNA 4P16A 4ZHOA 5CHFA 2KFKB 3DHGC 3I5JC 5EE0A 1OQRA 5I4DA 4A9AA 1T3QA 4HEA1 3L4PA 1Z2MA 2PMVA 3FILB 3CSTA 3CWIA 3PV1A 1VCBA 3B1LX 3V60A 4LNIA 3K9OB 3SR6A 2INDC 3MP9A 2RDGA 4H2AA 4W9GA 1TY2A 4JLCA 3TSSA 4HRSA 3TEYA 4GDKB 3QHTA 3HUIA 2BWFA 4WAFA 2AQ1B 1WRDB 2HJ1A 3WCQA 3OWEB 3QC8B 4GB9A 1JMLA 3A4SC 2G3QB 3AULA 1DYQA 2XK5A 2BW2A 4KZCA 3ZJVA 2L3ZA 1MI0A 4IUMB 1WY8A 3HM6X 3UQBA 2H89B 1I7HA 2V4LA 4DK5A 4G50A 1RAXA 4EEWA 2C7HA 2M8SA 2NBVB 3AI5A 1PGXA 2R2OA 4MH8A 4GIVA 4MJSB 2ZW0A 1P1AA 3U7ZA 2LD9A 1J7BA 2DLBA 2WP9B 1WFYA 3H1UA 3O65B 1L6VA 2QILA 4ACFA 2WLBA 2MQJA 2MP2B 3EFCA 4F8CB 4S0RA 4GDLB 4GLSC 2JXTA 2WXPA 1JQ4A 2LVOA 2LRWA 2LUEA 1E10A 1KTKA 2K3UA 4A3OA 4B95A 2WXJA 3RUIB 3ZXVA 3AN1A 1L6UA 1LQBA 3IBEA 1XT9B 4P1BC 4BVUC 1U4AA 1GG3A 3KWLA 4HJKA 4ZRQA 5BMGA 3APCA 4CYEA 3R2IA 1XF5L 4CHKA 1TS2A 2GBKA 2KHWB 2O6VA 2UU7A 3B2GA 3CIRB 4EFOA 3GB1A 3NVWA 1L4DB 3PRPB 2N1WA 3AB5A 1TIFA 2DAFA 2ZZPB 1SEBD 2NS5A 2IY0B 3Q2AC 3NUHB 1DOIA 2Q5WD 2N0SB 4OVUA 4M00A 1KLVA 4NJ7A 2K6QA 2LXCA 5BYRA 1QT9A 2C5LC 2OJWA 1K51A 1OGWA 1WXVA 2HD5B 3VH4B 2JYTA 2H88B 2KWUB 4K1RB 4R3DA 4ARCA 5DPWA 1WJNA 4PS8A 2Y5CA 3BK1A 1L0VB 2VZKD 4Q2JA 3P2BA 4RNAA 1GJZA 1X1MA 1KFYB 4DDGD 4ZRKA 3ZLZA 3V6CB 4XDCA 3TMPB 4W9FA 2DZIA 2KD0A 4II3B 1EUVB 5E6PA 1NENB 3ZRCA 1SE2A 4ZRPA 2XK5B 4KSLC 3H7SA 1NVID 2W9NA 3AH7A 4LNKA 4PS7A 3ZXRA 4WJPA 1STEA 1XCTL 4DBGA 1R4NI 2IZVB 4MGKE 3ZTDA 1GOZA 4HK2A 3T3OA 4KX6B 1TZ1A 4F7ZA 4ANXA 2N9PC 2N1VA 3JSVB 4KGSA 1UF0A 4A6QA 5EDSA 2DZJA 3MC0B 1VZ6A 4N9F4 2N7DA 2X8XX 1QOGA 2IGHA 1RRBA 1AN8A 1E7PB 2WXLA 3J9CA 4N59A 5HI1A 4HCPB 2KLCA 3SHQA 4WURA 2I1KA 2BS4B 2ZPYA 2DYBA 2N4FA 4K3CA 1YX6B 2QDFA 1FFUA 1GAQB 4IM3A 1MPEA 3IAM1 3DHHC 2KOXA 3I9V1 1N62A 1E90A 2L0TA 3JYUA 1JRUA 1XEEA 4IM0A 4TV3A 1RM6C 4EZLA 4IW0A 1JW9D 3KYCD 1CJEA 2LXAA 2GBMA 1FNVA 2A4ZA
chains in the Genus database with same CATH topology
3R2TA 2BB6A 2WXGA 3AEDB 2QIEB 2AX5A 1VR9A 1JALA 1I4QA 1M4VA 3SEBA 3U2SC 3NRZA 5D3DA 2QJLA 2WXKA 4YT0B 2V3PA 2WXQA 1WYGA 4OHJA 4IKGA 4JPSA 4MT5A 2LMCA 1VLBA 3N9YC 1BUIC 1WWTA 2J42A 1YJJA 1FXIA 2D5GA 3P63A 1WGKA 1RYJA 2ICIA 2NMQA 3PZ8A 3HVZA 1P7FA 2K0PA 2YEPF 1E9MA 3ABVB 3B2FA 4OZCA 3ZQ4A 1C78A 2M19A 4B0EA 1JWBD 2K9XA 1AYFA 1D5XC 1C4CA 1EM7A 1KRHA 5FKAC 2IJ0A 2W82A 3ETRA 2IGDA 3P42A 3RPFC 1D5MC 1MHHE 1NYQA 1UUPA 4OW0A 1VJKA 4B0MA 3AEBB 1AWDA 2M0AA 3EGRA 1ET6A 1Q10A 2KN4A 4KKJA 1FXAA 1PFDA 1K53A 2JX5A 3AE7B 5H92C 2GI9A 1GB1A 4JE3B 3BIID 2MEKA 2E3TA 4RFBA 1FRDA 2VZKB 3PO0A 1P7EA 3W5UB 5FR3A 1UWMA 1JWSD 1LO5D 2BTEA 1YQ3B 3SFEB 5BYSA 5JXVA 1F77A 1GPXA 5C2TB 1SBBB 3Q8BA 3BVGA 4RF1A 4N58A 2NTSA 2Z8LA 3TEZA 1UNSA 2XN9C 5LNK1 4ITKA 2J52A 3U4EG 4C56C 2WXHA 5E6JA 4HKQA 1KLGD 2RPVA 1D4BA 1TJEA 2MH7A 1QLBB 3TEXA 1JCKB 2Y3AA 2HDEA 4JX1C 1L0YB 3FILA 5BMHA 3E9SA 1HA5A 1DGJA 1E0ZA 1ZPSA 4LLGM 1KF6B 3P4PB 1B9RA 2LJIA 3V05A 1FD6A 4J3OD 2NTTA 1FIQA 2RMMA 1XXGA 2V0GA 4MACA 2CJNA 1J7AA 1ZXIA 2PTLA 1ZDXA 1CQVA 3VR8B 2PIAA 3BVZA 1R7SA 3Q69A 4XDDA 3SFDB 2JU6X 4JWUC 4KGRA 3V3XA 4OZBA 5AUKA 5HG2A 1WRIA 4YTNB 1FNVA 2K22A 1IGDA 3AMZA 3W9CB 2ACZB 2JZPA 1PYWD 2J4XA 3DWGC 2HTME 1EU3A 4RGTA 1N61A 1HEZE 2Y5PA 5EE3A 4IDIA 1CK1A 1CZPA 2SAKA 3AM9A 4JWSC 4XWWA 1C9FA 1SIJA 4YSYB 1RWSA 2FBWB 4O1NA 1ACCA 1IBXB 3BWUD 3C8YA 4C7ZA 2EELA 1FCLA 1FM0D 4YTPB 2AQ3B 3EUB2 4RH6A 1ZXHA 2AQ2B 3Q8EA 4P6VF 1XLNA 4P16A 4ZHOA 5FK9C 4WH4A 1XLPA 2W54A 5EE0A 4MM3B 1OQRA 5I4DA 2PVOD 3NVYA 4A9AA 1FMAD 1T3QA 1ESFA 4HEA1 5MPOA 1TZOA 3L4PA 5HHDG 2QEJC 3TUOA 3TEWA 5GXGB 4D2KA 2PMVA 3FILB 2WXOA 1YN5A 3CWIA 5EE9A 1F2RC 4ZYSA 1QOAA 1XCQL 4L23A 2LHDA 4YXDB 1YMHE 1TYGB 3LB8C 1FNWA 2BYTA 3SR6A 2BS3B 3MP9A 4A90A 2M56B 2RDGA 4H2AA 1ZOYB 1FEHA 4RGOS 1VZ8A 2WDVB 2WXMA 2N9LA 3O13A 1V97A 1TY2A 2WDRB 1EWCA 1QILA 3TSSA 2W3RA 1I4GA 4YWGG 4HRSA 3TEYA 4ZHPA 4GDKB 2ON8A 3HUIA 3KLSX 4WQMA 4WAFA 3W2DA 2AQ1B 2K5PA 1PUTA 3ZYYX 3BYYB 1NYRA 3BZDB 3WCQA 3EA6A 1WXQA 3OWEB 1PGBA 1N5WA 1XLQA 2MJEA 1PGAA 1JMLA 1C4AA 1A70A 3BVMA 2JYEA 5G5GA 1YJIA 1SB3C 3T3NA 3AE6B 1AW7A 1DYQA 2BW2A 3ZJVA 2I2YA 3AEFB 1PDXA 2LEKA 1N63A 1KH0A 1V8CA 5HFYA 2INNE 2V3NA 1ROEA 1MI0A 2V4IB 3GP7A 2H89B 1I7HA 3ZJTA 1FCCC 2KDMA 2OEDA 1NI3A 2WS3B 3B9JA 1MVKA 3P4SB 4A8XC 3P4QB 3R8BA 2TSSA 2WDQB 1PGXA 3AV8A 4MH8A 3Q8FA 3AE8B 3KWVA 5T8IA 4CQNA 2ZW0A 4AQ7A 3U7ZA 1J7BA 2DLBA 2WP9B 3RFZB 3URYA 2L1AA 3UI3A 4LTUA 3W1SA 1C76A 1L6VA 2CJOA 2QILA 3PZ7A 2BBCA 1SXTA 1ZUD2 1V1OA 1K50A 2WLBA 1WSPA 2PVGC 1L5PA 3IT4B 3P1MA 1FRRA 4GDLB 4GLSC 1QOFA 2JXTA 2EKIA 3AECB 4ZOHC 4A55A 2WXPA 1NEKB 3GS2A 4OVZA 4NAMA 1JQ4A 4KGTA 1DOXA 2B76B 1YQ4B 2BB5A 1VZ7A 4DXGA 1I4XA 1E10A 1FNUA 3AEGB 4HROA 3ZGZA 1KTKA 2BT6A 2K3UA 4HJGE 4US8A 1T5XD 2WXJA 1OQQA 3AN1A 1TS4A 1JWMD 3AE9B 1L6UA 1XLOA 1RFKA 4DXFA 1HZ6A 1BXTA 2X38A 1HXYD 1V1PA 3LYYA 1F2RI 3KWLA 4US9A 2XNAC 4C7YA 3I57A 4ZRQA 5BMGA 5H8YE 4TQ0A 1QKZA 3KQ4A 3AEEB 2GB1A 4WIPA 3R2IA 1XF5L 2J53A 2G9HD 1TS2A 3NVVA 2I38A 4REZA 5BMIA 1SJHD 1D5ZC 1ET9A 3E56A 3B2GA 2DYMA 1TKYA 3CIRB 2DYOA 4NJCA 2LFIA 2WXFA 2INPE 1IBXA 2L52A 3GB1A 3NVWA 4RCOA 2FUG1 1OFFA 2JQRB 1L4DB 1I4RA 3Q8AA 2KMMA 3NVZA 3AB5A 1ZE3D 1B1ZA 4RF0A 3LXFA 1SEBD 2WQYB 3NUHB 4HKZE 1DOIA 2JWUA 2Q5WD 2N0SB 4UDUC 1QOBA 1TS3A 1I4PA 3MFGA 5BYRA 3AE2B 1QT9A 3IAS1 1SF0A 4AS1A 1E6EB 1JRPA 2L83A 4PT5A 4TMAB 1VRAB 2W3SA 2CU3A 2W55A 4IOIE 1K51A 3ZJUA 1VDVA 2WXIA 2G1EA 2JYTA 3AE5B 2H88B 3AEAB 3BK2A 1D6EC 4R3DA 4ARCA 3Q8CA 3W5VB 3MJ5A 2Y5CA 3BK1A 4NAWB 1N60A 1L0VB 2VZKD 4Q2JA 4YTMB 1DOYA 4RNAA 3AE4B 2QMTA 2BS2B 3AE1B 1KFYB 5BYQA 3U52E 4XDCA 2SEBD 2KQ4X 4XE0A 1GB4A 4FXCA 1HZ5A 1C77A 1BMLC 1SSNA 1TY0A 1NENB 2KACA 3H8HA 2WXNA 1SE2A 1ENFA 4ZRPA 4XWTA 2WU2B 4EE2A 4DQOC 1NVID 1SE4A 3AH7A 1I4HA 2DBYA 4YSXB 1TKGA 1C4PA 1FO4A 1STEA 3BYTB 1XCTL 2N9KA 2R61A 3DWMA 3HVDA 2MJDA 5EE1A 4N6EB 1QF6A 1GOZA 3T3OA 1K52A 4KX6B 4RGMA 1JWAD 1QQRA 3HRDD 3NS1A 4LK0M 1KLUD 1TKEA 1JWUD 2IPKD 3P4RB 2N7JA 2QSDA 3VRAB 1YN3A 1IUEA 2WXRA 1HQRD 1UWXA 5G5HA 2ONQA 4C80A 1UGJA 4NZLB 2OHFA 1JROA 5TSSA 4KKIA 1EU4A 4KGSA 1J7CA 2PW9A 1XO3A 2KAJA 4A6QA 4USAA 1C79A 1FFVA 3MC0B 1T6BX 1VZ6A 4WWMA 3VRBB 3AE3B 1SE3A 1QOGA 1IGCA 2IGHA 1SJED 4TSSA 1AN8A 1E7PB 2GRIA 1YN4A 4L1BA 2WXLA 3J9CA 4N59A 3VR9B 2RDHA 5HI1A 2WU5B 4WURA 2PKOA 3VQIA 2KWDA 1V1PB 2BS4B 5D7GA 3IXSA 4RGNA 2PLPA 1EWYC 1YNTE 2JSVX 1F0ZA 3MHZA 2DWQA 3NZ3A 4M0WA 1FFUA 1GAQB 1ZDVA 2LGIA 5C3JB 1MPEA 3IAM1 4YSZB 2YEPB 2ZW1A 1N5XA 3FAHA 4TQ1A 1L0XB 3I9V1 1MHXA 5AUIA 1N62A 4ARIA 3IT6B 2L32A 2LUMA 1XEEA 3FC4A 2LHEA 2E6XA 5D3IB 1ZP0B 2FE8A 1RM6C 4L2YA 1JW9D 1Y56A 1CJEA 4OZAA 2IDYA 2MJ3A 1TS5A 2IGGA 2WNMA 1L4ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L32 A;  2LJI A; 
#chains in the Genus database with same CATH topology
 2K39 A;  3AED B;  5JHB A;  2O6V B;  5J17 A;  4P1C C;  1J0G A;  2D3A A;  1JAL A;  2DZK A;  3M95 A;  4DHZ B;  1M4V A;  3HK0 A;  4DDI D;  2GOW A;  2WXK A;  2V3P A;  4C4V B;  4JPS A;  1V6E A;  4HDQ A;  1BUI C;  3UF8 A;  4ZRI A;  1YJJ A;  4LNN A;  1WGK A;  1MG8 A;  2NMQ A;  3RN9 C;  1WGH A;  1E9M A;  4IWQ A;  1E7V A;  1LGR A;  1C78 A;  4B0E A;  1JWB D;  2K9X A;  1AYF A;  4JGH B;  1D5X C;  3ZKJ C;  1EM7 A;  3P42 A;  2GBR A;  3DBS A;  4OW0 A;  4MGY E;  1HE8 A;  3EGR A;  1ET6 A;  1Q10 A;  1WI0 A;  2KN4 A;  4KKJ A;  3GZN I;  4BKS A;  3AE7 B;  2L0F A;  4BZA A;  3BII D;  2MEK A;  2INC C;  5FR3 A;  1UWM A;  3NS8 A;  5JXV A;  4WAA A;  5C2T B;  2WDT B;  4RF1 A;  4N58 A;  2Z8L A;  1UNS A;  2V9H A;  2A5U A;  4GSW A;  3KUC B;  5E6J A;  2HDE A;  2RGF A;  1DGJ A;  1E0Z A;  1ZPS A;  1KF6 B;  3P4P B;  1FD6 A;  4J3O D;  2UWQ A;  3PVL A;  3RNC C;  1XXG A;  2V0G A;  4MAC A;  1D3Z A;  4J6I A;  2R2Q A;  2PTL A;  3BVZ A;  3GZN B;  2KXJ A;  2LI5 A;  3Q69 A;  3ENE A;  4W9J A;  5D6J B;  5GMV A;  3SFD B;  4KGR A;  4E71 A;  1H8C A;  3PRE A;  1WGG A;  4YTN B;  3S2A A;  3ML8 A;  3HM3 A;  3M62 B;  3N1X C;  1E5W A;  1H4R A;  1PYW D;  3DWG C;  4MM3 A;  1EU3 A;  1K8R B;  4RGT A;  1N61 A;  4IWP A;  5EE3 A;  4IDI A;  1CK1 A;  1VD2 A;  4XWW A;  4JWS C;  2HTH A;  2NPT A;  1N6Z A;  1J8C A;  2RSU A;  2AQ3 B;  2L05 A;  2AQ2 B;  3Q8E A;  3RI7 C;  4ANV A;  3JSV A;  4BBN F;  3VTV A;  1OEY A;  2NCN A;  1P0R A;  1EO6 A;  1ESF A;  2YLM A;  5HHD G;  4HCN B;  4MGI E;  5AZG A;  4D2K A;  3Q14 C;  3WA0 A;  4K7U A;  1F2R C;  2AYO B;  4ZYS A;  3RZF A;  1YMH E;  2JT4 B;  1TYG B;  4WWN A;  3VH3 B;  2BYT A;  3RCZ A;  1FEH A;  2V1Y A;  1VZ8 A;  4GN1 A;  3OJ3 A;  3O13 A;  1EWC A;  2W3R A;  2QC8 A;  4ZDV A;  1FXT B;  3JVZ X;  2DHZ A;  3PT2 B;  2ON8 A;  2MWS B;  1I42 A;  2K5P A;  1R4M B;  1NYR A;  3BYY B;  1F1H A;  1WXQ A;  3QK0 A;  2MJE A;  1PGA A;  3BVM A;  5G5G A;  1SB3 C;  3AE6 B;  1AW7 A;  3DBR I;  2I2Y A;  5G2N A;  4XC2 A;  4GDK A;  2NR2 A;  3L17 A;  2V4I B;  4NJ6 A;  5DCN A;  4W9K A;  3ZJT A;  1WX7 A;  1FCC C;  2KMC A;  2WS3 B;  3B9J A;  3P4S B;  1ZGU B;  3AV8 A;  2G4S A;  2JZ3 B;  3N3K B;  3KWV A;  4CQN A;  2JUO A;  3L54 A;  3EEC A;  2I1J A;  3ZVV A;  3TJP A;  1HTQ A;  2AWT A;  1ZUD 2;  2PVG C;  1WGD A;  5D94 A;  3IT4 B;  3DBL I;  3IHP C;  1QOF A;  3RNE C;  1XD3 B;  2EKI A;  3AEC B;  4ZOH C;  1OTR B;  4A55 A;  3GS2 A;  4OVZ A;  1A5R A;  2GLS A;  2KKC A;  3ZUN A;  3H7P B;  3ZGZ A;  4HJG E;  4US8 A;  1T5X D;  2FAZ A;  1OQQ A;  3AE9 B;  3QA8 A;  1XLO A;  1RFK A;  1HZ6 A;  2X38 A;  3LYY A;  1F2R I;  3PLU A;  3QX1 A;  5H8Y E;  1Y8R C;  4TQ0 A;  2BYE A;  2BF8 B;  1OEY J;  4W9E A;  2G9H D;  5BMI A;  3PPA A;  5AEK B;  1TKY A;  2DYO A;  3WAP A;  2DNF A;  2WXF A;  4RCO A;  2WYQ A;  1GC6 A;  1I4R A;  2KMM A;  3NVZ A;  2IYD B;  2L76 A;  4RF0 A;  3LXF A;  3U7D A;  3PLV A;  4UDU C;  1QOB A;  3IG3 A;  1I4P A;  2KX3 A;  3EHV A;  2BVC A;  3AXC A;  3AE2 B;  3IAS 1;  1YIW A;  1E6E B;  5LXI B;  4TMA B;  1VRA B;  2W55 A;  4IOI E;  3ZNH B;  2KWC A;  2G1E A;  3A9J B;  3AE5 B;  3AEA B;  5BO4 B;  3AU5 A;  3Q8C A;  3W5V B;  4PK1 A;  5JHA A;  3MJ5 A;  1P3Q U;  4NAW B;  1N60 A;  2MRP A;  4YTM B;  1DOY A;  3NY5 A;  2MCN B;  3U52 E;  2KQ4 X;  4XE0 A;  1GB4 A;  4FN2 A;  1WR1 A;  1HZ5 A;  2KAC A;  1WE6 A;  3H8H A;  3B0A A;  1ENF A;  1OQY A;  2J0K A;  2WU2 B;  1UGM A;  4EE2 A;  3NJT A;  2L8J A;  1SE4 A;  3AU4 A;  4YSX B;  3OG5 A;  1FO4 A;  3BYT B;  2N9K A;  2R61 A;  5EE1 A;  3HVD A;  4YL8 A;  3RT3 B;  1K52 A;  4RGM A;  1JWA D;  4MSQ B;  1KLU D;  4LK0 M;  1JWU D;  3PRM B;  2MBH A;  2ONQ A;  2JY6 A;  2VRR B;  1CMX B;  3N20 C;  1J7C A;  2ZPN A;  2KAJ A;  5G55 A;  1C79 A;  3VTW A;  1T6B X;  3RUL A;  2KDI A;  2NVU I;  3DPD A;  2IY1 B;  1SE3 A;  5HKH A;  1IGC A;  3QJZ A;  4TSS A;  1V49 A;  3CF6 E;  2GRI A;  2NPT B;  4L1B A;  4MJS A;  1E7U A;  3DVG X;  4LJP B;  3VR9 B;  2RDH A;  3V62 A;  1LM8 B;  2IBI B;  4KVG B;  1V1P B;  3A1Q A;  3IXS A;  2XBB C;  4IC7 B;  2DWQ A;  3NZS A;  5C3J B;  2LGI A;  3QAQ A;  2ZNV B;  3L08 A;  2MHJ A;  1N5X A;  2FCQ A;  3M63 B;  1ZP0 B;  2FE8 A;  2FNJ B;  3RYT A;  2IDY A;  2MJ3 A;  2IGG A;  1L4Z B;  1WR6 E;  2KX0 A;  2KN5 A;  2BB6 A;  2QIE B;  1VR9 A;  4E74 A;  2LAS A;  4X57 B;  3BIN A;  3SEB A;  3N32 A;  1TT5 B;  2KT7 A;  4IKG A;  4MT5 A;  4MH0 E;  1KJT A;  1RYJ A;  2FCM A;  3ZDM C;  3PGE A;  2YEP F;  4OZC A;  1UD7 A;  2FIF A;  2MP2 A;  2M19 A;  4EUT A;  4NQL B;  3WAN A;  4FJY A;  2M17 A;  2MLB A;  4G11 A;  1KRH A;  2KC2 A;  1WJ4 A;  2IJ0 A;  2W82 A;  3RPF C;  4RM9 A;  3UGB B;  2BWE S;  1VJK A;  1AWD A;  3BY4 B;  5D2M B;  5C23 A;  3ZO5 B;  4CO7 A;  3RNF C;  3ZNG C;  5L83 A;  5H92 C;  2GI9 A;  3PSE B;  5CHW A;  4FJZ A;  1UZX B;  1LO5 D;  3GOE A;  2L7R A;  2BTE A;  1YQ3 B;  5FR6 A;  1SBB B;  3Q8B A;  3TEZ A;  4ITK A;  2VH2 A;  3U4E G;  4C56 C;  1D4B A;  1MFW A;  3RD2 A;  4JQW C;  4K3B A;  1JCK B;  4JX1 C;  2FCN A;  3E9S A;  4IM2 A;  5CTR C;  2BYF A;  1F9J A;  1B9R A;  2LJI A;  4K7S A;  1P9D U;  2RMM A;  2CJN A;  1J7A A;  3CSF A;  1ZDX A;  2D3G A;  3L10 B;  5IP4 D;  1V5O A;  2HE7 A;  2Y5B B;  3N30 A;  4BBN C;  2WGS A;  3DVG Y;  2DX5 B;  2KDB A;  3QAR A;  2FID A;  4BAX A;  2G4D B;  3IFW B;  2KFJ A;  1HEZ E;  4XX5 A;  3AM9 A;  4YSY B;  3ALB A;  1KM7 A;  1J19 A;  1ACC A;  1IBX B;  3C8Y A;  4C7Z A;  1FM0 D;  1ZKH A;  1ZXH A;  4P6V F;  2V3S A;  2K25 A;  3KH0 A;  3RNB C;  2M1M A;  5FK9 C;  4RM8 A;  1XLP A;  2W54 A;  4MM3 B;  2PVO D;  3NVY A;  1FMA D;  5MPO A;  2ZVN A;  1R4N B;  3TUO A;  4LCD E;  3MTN B;  5GXG B;  2WXO A;  3U8Z A;  4L23 A;  5AZF A;  4KDL B;  3LB8 C;  2KYW A;  2LJ5 A;  3DVN U;  2D3C A;  4A90 A;  2M56 B;  1V9J A;  2CHX A;  1ZOY B;  2PE6 B;  3DVN V;  1YD8 U;  3QQ8 B;  4AP4 C;  3NHE B;  2N9L A;  1V97 A;  2WDR B;  1QIL A;  2BKR B;  2EMS A;  3DCG A;  2MBQ A;  2CU1 A;  2MW5 A;  3W2D A;  2KDE B;  4WQM A;  3KUZ A;  3ZYY X;  4EZK A;  4W9I A;  3EA6 A;  3ECI A;  1PGB A;  1WE7 A;  3SD5 A;  1N5W A;  1WJU A;  2GBN A;  1C4A A;  1A70 A;  3VUY A;  1YJI A;  3T3N A;  4I6L B;  2UYZ B;  1PDX A;  4JIO U;  1WF9 A;  1V8C A;  3N1Y C;  4HLE A;  4KDI C;  1E8Z A;  3GP7 A;  2WHI A;  2O6V D;  1V86 A;  2K8B A;  1TGZ B;  2CHW A;  2OED A;  2KDM A;  1NI3 A;  4XGA B;  3PS6 A;  3A4R A;  3P4Q B;  3R8B A;  2TSS A;  2EKE C;  3Q8F A;  3AE8 B;  4MEL A;  1V81 A;  3C0R B;  2KJH B;  3RFZ B;  2KO3 A;  1F52 A;  3URY A;  3IVF A;  3A33 B;  4HDO A;  2KTF A;  3PZ7 A;  2KQ7 A;  1V1O A;  1K50 A;  4ICV A;  1WSP A;  3QCA A;  4A3P A;  3P1M A;  2Z0D B;  2JPH A;  4NAM A;  1LFD A;  1WXA A;  4KGT A;  2B76 B;  1Q0W B;  1YQ4 B;  2LGX A;  4DXG A;  3Q3O C;  2DEN B;  3KYD D;  2BT6 A;  2D2Q A;  2ZJD A;  1TS4 A;  1JWM D;  1QZE A;  4DXF A;  3ML9 A;  1BXT A;  1HXY D;  1PQS A;  4US9 A;  2MX2 A;  2LGY A;  3NVV A;  2J53 A;  1SJH D;  2M0X A;  2ZVO A;  3ZNI D;  1D5Z C;  1C1Y B;  4WJO A;  4FJV B;  2KTR B;  4NJC A;  2OJR A;  1IBX A;  3VXW A;  2JQR B;  4BOZ B;  3Q8A A;  4GMV A;  4AWJ A;  2CR5 A;  4MGZ E;  4ZYN A;  2BGF A;  3MJW A;  1TS3 A;  4LDT D;  3UQA A;  2GMI C;  1SF0 A;  4AS1 A;  3TIX A;  1T0S C;  2L83 A;  2REX A;  3SDL C;  1VDV A;  1T0Q C;  1D6E C;  2WWZ A;  4W9D A;  3AE4 B;  2QMT A;  1IPG A;  1P98 A;  2K1F A;  5BYQ A;  2KFK A;  3NZU A;  1T0R C;  2SEB D;  4BKT A;  3RNA C;  1WXM A;  2AL3 A;  3C19 A;  1C77 A;  1TY0 A;  3B08 A;  2MBO A;  1TBE A;  4XWT A;  4DQO C;  3VVW B;  3TL5 A;  2Z59 B;  1I4H A;  1ISN A;  1TKG A;  2NBU A;  5J18 A;  1GUA B;  1EF5 A;  4N6E B;  1QF6 A;  5C1Z A;  3NS1 A;  3HRD D;  4G0N B;  1TKE A;  2IPK D;  3P4R B;  2N7J A;  4FHK A;  3ZTC A;  2J0M A;  5G5H A;  1HQR D;  4C80 A;  3A9K B;  1UGJ A;  5TSS A;  3D32 A;  4KKI A;  1WIA A;  3H7P A;  1EU4 A;  2B3A A;  2PW9 A;  1XO3 A;  3A9J A;  2ZCB A;  2FUH B;  4K7W A;  3Q3M C;  4WWM A;  1WX8 A;  3OJ4 B;  3VTU A;  3AE3 B;  2KJ6 A;  4KV2 A;  4KIK A;  2JWZ A;  4BKS D;  3PHX B;  5LLI A;  5DPR A;  4HPP A;  1NI2 A;  2PKO A;  3RZW C;  4HWI B;  5JZE B;  4RGN A;  2PLP A;  3WIM A;  1EWY C;  5IN7 A;  2JSV X;  3MHZ A;  3NZ3 A;  2DAJ A;  4P7I A;  4YSZ B;  3TBL D;  2YEP B;  2ZW1 A;  5J2R A;  3FAH A;  3HIZ A;  3LJ3 A;  1MHX A;  1WGR A;  2JRI B;  4ARI A;  3V6E B;  1RFA A;  1R4M I;  3KVF B;  2LHE A;  2E6X A;  5D3I B;  5AZH A;  4L2Y A;  4OZA A;  1TS5 A;  2WNM A;  2AX5 A;  3R3M A;  4M01 A;  2K8H A;  3PTF C;  3KUD B;  1KOT A;  1I4Q A;  3ONS A;  3U2S C;  4ASW C;  5IOI A;  4YT0 B;  5CX3 A;  2LVQ A;  1WYG A;  4OHJ A;  3DHI C;  1YJ1 A;  1VLB A;  3N9Y C;  1WWT A;  1L7Y A;  3RNG C;  2MBE A;  2J42 A;  3NG0 A;  3P63 A;  3TCA A;  3X0W A;  4EKU A;  3APF A;  1WM2 A;  2D07 B;  3HVZ A;  1P7F A;  2LGS A;  2K0P A;  2CHZ A;  3B2F A;  4EOY A;  4RMA A;  3ZQ4 A;  2KZR A;  2KNB A;  2KVZ A;  3A1Q B;  1UBQ A;  1GNU A;  3WAL A;  5FKA C;  2JF5 A;  1D5M C;  1NYQ A;  1UUP A;  1AAR A;  4M8N A;  2MSE D;  4C00 A;  1FXA A;  2JX5 A;  1K53 A;  1GB1 A;  4PYU A;  1Q5W B;  4RFB A;  2IO0 B;  2FCS A;  1P7E A;  3W5U B;  4NNJ B;  4E3C A;  2RD0 A;  2PE9 A;  1S3S G;  1JWS D;  1WGY A;  3SFE B;  5BYS A;  3R7R A;  3R66 C;  1GPX A;  2JVC A;  3VAW A;  2XN9 C;  2L00 B;  4TUU A;  2C9W B;  1G6J A;  3ZW3 A;  4HKQ A;  1KLG D;  1TJE A;  2MH7 A;  1QLB B;  2KK8 A;  2N7E A;  3TEX A;  3FIL A;  2JZZ A;  1HA5 A;  1LXD A;  1V80 A;  4ICU A;  4M8M A;  3VHT C;  3V05 A;  2YVC A;  1ZXI A;  4AUQ C;  2J7Q B;  2PIA A;  2OOB B;  2Z0E B;  4FBJ B;  2EMT A;  1E8W A;  4JWU C;  3V3X A;  4OZB A;  3U30 A;  3N1Z C;  2KC1 A;  4GU2 A;  2ACZ B;  3CMM B;  2PPH A;  2HTM E;  4NY0 A;  2Y5P A;  3PHW B;  4AOF A;  1C9F A;  1CZP A;  4IWO A;  1WXS A;  1YX5 B;  2EEL A;  4YTP B;  3EUB 2;  4RH6 A;  3UIN B;  4WH4 A;  2HJ8 A;  5JH5 C;  1TZO A;  1YQB A;  2QEJ C;  2KJR A;  3TEW A;  3EC8 A;  2BPS A;  3DBH I;  1YN5 A;  5EE9 A;  2O2V A;  4HXD A;  2K8C A;  1QOA A;  2LVP A;  1XCQ L;  2LHD A;  4YXD B;  1FNW A;  3K9P B;  3W1Y A;  3L16 A;  2BS3 B;  2KQS A;  4MSM B;  1I35 A;  4RGO S;  2WDV B;  2WXM A;  5IKC M;  2RPQ A;  1I4G A;  3L0W B;  3GE3 C;  4YWG G;  3ZDT A;  2GBJ A;  4ZHP A;  5KHQ A;  4BKG A;  3KLS X;  1PUT A;  3BZD B;  4DHJ B;  2KMA A;  1XLQ A;  4I6N B;  4S17 A;  2JYE A;  2QCZ A;  4KIK B;  3Q3F A;  3UIP B;  3AEF B;  4W9C A;  1WZ3 A;  2LEK A;  1N63 A;  1KH0 A;  3FKY A;  5HFY A;  2INN E;  2V3N A;  1ROE A;  3PZD A;  2ZCC A;  2JXX A;  4LDT B;  4PS3 A;  2IO1 B;  4JL9 A;  1ZW7 A;  1WM3 A;  2BKF A;  3RMK C;  1MVK A;  2AL6 A;  4A8X C;  1TTN A;  2WDQ B;  3WAM A;  2BQQ A;  5T8I A;  4AQ7 A;  2IO3 B;  4WJN A;  3VUX A;  2L1A A;  3UI3 A;  4LTU A;  3W1S A;  1C76 A;  2KAN A;  2IO2 B;  2CJO A;  2BBC A;  1WX9 A;  1SXT A;  4IG7 B;  1L5P A;  1WYW B;  2C7N B;  3Q3N C;  2KVR A;  1FRR A;  1UBI A;  3A9K A;  4PYZ A;  4HPL B;  3APD A;  1NEK B;  2AEH A;  4KZ0 A;  2G45 B;  1DOX A;  3DDC B;  4LNO A;  2O2V B;  4URK A;  2BB5 A;  1VZ7 A;  1I4X A;  1FNU A;  3AEG B;  4HRO A;  2CKH B;  3R7Q A;  2C60 A;  4ANU A;  4WQO B;  3V61 A;  3ZNZ B;  1MG4 A;  4II2 B;  3NOB A;  1SE9 A;  1V1P A;  2D3B A;  2XNA C;  4C7Y A;  3I57 A;  3M3J A;  4FUL A;  1QKZ A;  3KQ4 A;  3AEE B;  2GB1 A;  1YOV B;  4WIP A;  2JRH A;  4REZ A;  2I38 A;  5CHV C;  3ZRF A;  1ET9 A;  3E56 A;  4GXB A;  1SIF A;  2DYM A;  2LFI A;  3I63 C;  2INP E;  2L52 A;  1WJ6 A;  2FUG 1;  1OFF A;  2LWP A;  1RLF A;  4OVV A;  1ZE3 D;  1B1Z A;  2KWV B;  2WQY B;  4WJQ A;  2K6D B;  2MA9 B;  4HKZ E;  1T0Y A;  2JWU A;  4DXA B;  3X23 A;  1WH3 A;  3WAO A;  1UH6 A;  3DBR B;  3MFG A;  2ASQ A;  1HTO A;  2ZNV C;  4BFR A;  1JRP A;  4M0W B;  4WWP A;  4PT5 A;  2W3S A;  3OAW A;  2CU3 A;  4GGQ A;  3ZJU A;  4DHZ E;  2WXI A;  3BK2 A;  4W9L A;  2D10 A;  2BS2 B;  4MDK E;  4DHJ D;  3AE1 B;  3MHS D;  2M4N A;  1C3T A;  4I6P A;  3DBH B;  3LDZ E;  1WMH A;  4FXC A;  3DQV A;  1Q1O A;  2WX1 A;  1BML C;  1SSN A;  1BT0 A;  2MBB B;  2WXN A;  3Q3J A;  4HVB A;  2C7M B;  2RDB C;  5DPT A;  2DBY A;  1C4P A;  1V2Y A;  2D11 A;  3DWM A;  4G3X B;  2MJD A;  4NPN A;  3SU8 X;  3I3T B;  1FPY A;  5E6O A;  1QQR A;  2KLG A;  3HHM A;  2QSD A;  3VRA B;  1YN3 A;  1IUE A;  2WXR A;  1UWX A;  4NZL B;  2OHF A;  1JRO A;  3JW0 X;  2RR9 A;  2NBW B;  4LNF A;  2WX0 A;  4USA A;  1FFV A;  5E6N A;  4XYC A;  1XQQ A;  3VRB B;  3VDZ A;  4C4V A;  1SJE D;  3UIO B;  1NDD A;  3OLM D;  1YN4 A;  2WU5 B;  2LZ6 A;  3ZIM A;  3VQI A;  2KWD A;  1SGH A;  5D7G A;  3T9L A;  2PEA A;  3VFK A;  1YNT E;  1F0Z A;  4M0W A;  1ZDV A;  5IAA C;  4TQ1 A;  1L0X B;  5AUI A;  3IT6 B;  4B9K A;  2L32 A;  2LRU A;  2LUM A;  3QWZ B;  3FC4 A;  2CS4 A;  1Y56 A;  3MC8 A;  2VH1 A;  4LJO B;  2BYV E;  3R2T A;  2WXG A;  1IP9 A;  3QIJ A;  3H9D A;  2XEW A;  4GDL A;  3NRZ A;  5D3D A;  2QJL A;  1IYF A;  1NBF C;  2N9E B;  2WXQ A;  4A20 A;  1V5T A;  2J0J A;  2LMC A;  3EFU A;  4KSK C;  1E8Y A;  1FXI A;  2D5G A;  2PJH A;  3VUW A;  2DZM A;  2ICI A;  3PZ8 A;  3DBL B;  1GC7 A;  3ABV B;  2KDF B;  5L95 C;  3L13 A;  3KW5 B;  4FHJ A;  4FAD A;  4EZJ A;  5TR5 A;  1C4C A;  3ETR A;  2IGD A;  1UEL A;  4MEM A;  4F1S A;  4WWO A;  1MHH E;  3MC9 A;  3PRZ A;  4K81 A;  4ANW A;  4B0M A;  3AEB B;  2M0A A;  1PFD A;  4JE3 B;  2E3T A;  1Z5S B;  2ZEQ A;  1FRD A;  4GOC A;  2VZK B;  3PO0 A;  4HPM B;  4QAY A;  4BOS C;  5LXH A;  1WZ0 A;  4M02 A;  1E8X A;  1F77 A;  3BVG A;  2NTS A;  4NQK E;  4XZ4 A;  5LNK 1;  2J52 A;  2WXH A;  4AJW A;  2RPV A;  1L2N A;  2Y3A A;  4ZRJ A;  1L0Y B;  5BMH A;  3H6N A;  4LLG M;  4TKN A;  5DPS A;  3Q6B A;  4W9H A;  2NTT A;  1FIQ A;  1S1Q B;  3VR8 B;  1CQV A;  4DWF A;  4FA6 A;  1WMH B;  2QHO A;  1R7S A;  2N9X A;  4XDD A;  1EF1 A;  5IA7 A;  2JU6 X;  1M94 A;  5AUK A;  5HG2 A;  1WRI A;  2KTR A;  2K22 A;  4FLH A;  1IGD A;  3AMZ A;  3W9C B;  3T8M A;  4NAW A;  2JZP A;  2J4X A;  3GE8 C;  4AJY B;  1MJD A;  3W1S C;  2SAK A;  3DOW A;  1SIJ A;  1RWS A;  2FBW B;  4O1N A;  3BWU D;  5IO9 A;  1FCL A;  5KHO A;  4B6W A;  2LGD A;  1XLN A;  4P16 A;  4ZHO A;  5CHF A;  2KFK B;  3DHG C;  3I5J C;  5EE0 A;  1OQR A;  5I4D A;  4A9A A;  1T3Q A;  4HEA 1;  3L4P A;  1Z2M A;  2PMV A;  3FIL B;  3CST A;  3CWI A;  3PV1 A;  1VCB A;  3B1L X;  3V60 A;  4LNI A;  3K9O B;  3SR6 A;  2IND C;  3MP9 A;  2RDG A;  4H2A A;  4W9G A;  1TY2 A;  4JLC A;  3TSS A;  4HRS A;  3TEY A;  4GDK B;  3QHT A;  3HUI A;  2BWF A;  4WAF A;  2AQ1 B;  1WRD B;  2HJ1 A;  3WCQ A;  3OWE B;  3QC8 B;  4GB9 A;  1JML A;  3A4S C;  2G3Q B;  3AUL A;  1DYQ A;  2XK5 A;  2BW2 A;  4KZC A;  3ZJV A;  2L3Z A;  1MI0 A;  4IUM B;  1WY8 A;  3HM6 X;  3UQB A;  2H89 B;  1I7H A;  2V4L A;  4DK5 A;  4G50 A;  1RAX A;  4EEW A;  2C7H A;  2M8S A;  2NBV B;  3AI5 A;  1PGX A;  2R2O A;  4MH8 A;  4GIV A;  4MJS B;  2ZW0 A;  1P1A A;  3U7Z A;  2LD9 A;  1J7B A;  2DLB A;  2WP9 B;  1WFY A;  3H1U A;  3O65 B;  1L6V A;  2QIL A;  4ACF A;  2WLB A;  2MQJ A;  2MP2 B;  3EFC A;  4F8C B;  4S0R A;  4GDL B;  4GLS C;  2JXT A;  2WXP A;  1JQ4 A;  2LVO A;  2LRW A;  2LUE A;  1E10 A;  1KTK A;  2K3U A;  4A3O A;  4B95 A;  2WXJ A;  3RUI B;  3ZXV A;  3AN1 A;  1L6U A;  1LQB A;  3IBE A;  1XT9 B;  4P1B C;  4BVU C;  1U4A A;  1GG3 A;  3KWL A;  4HJK A;  4ZRQ A;  5BMG A;  3APC A;  4CYE A;  3R2I A;  1XF5 L;  4CHK A;  1TS2 A;  2GBK A;  2KHW B;  2O6V A;  2UU7 A;  3B2G A;  3CIR B;  4EFO A;  3GB1 A;  3NVW A;  1L4D B;  3PRP B;  2N1W A;  3AB5 A;  1TIF A;  2DAF A;  2ZZP B;  1SEB D;  2NS5 A;  2IY0 B;  3Q2A C;  3NUH B;  1DOI A;  2Q5W D;  2N0S B;  4OVU A;  4M00 A;  1KLV A;  4NJ7 A;  2K6Q A;  2LXC A;  5BYR A;  1QT9 A;  2C5L C;  2OJW A;  1K51 A;  1OGW A;  1WXV A;  2HD5 B;  3VH4 B;  2JYT A;  2H88 B;  2KWU B;  4K1R B;  4R3D A;  4ARC A;  5DPW A;  1WJN A;  4PS8 A;  2Y5C A;  3BK1 A;  1L0V B;  2VZK D;  4Q2J A;  3P2B A;  4RNA A;  1GJZ A;  1X1M A;  1KFY B;  4DDG D;  4ZRK A;  3ZLZ A;  3V6C B;  4XDC A;  3TMP B;  4W9F A;  2DZI A;  2KD0 A;  4II3 B;  1EUV B;  5E6P A;  1NEN B;  3ZRC A;  1SE2 A;  4ZRP A;  2XK5 B;  4KSL C;  3H7S A;  1NVI D;  2W9N A;  3AH7 A;  4LNK A;  4PS7 A;  3ZXR A;  4WJP A;  1STE A;  1XCT L;  4DBG A;  1R4N I;  2IZV B;  4MGK E;  3ZTD A;  1GOZ A;  4HK2 A;  3T3O A;  4KX6 B;  1TZ1 A;  4F7Z A;  4ANX A;  2N9P C;  2N1V A;  3JSV B;  4KGS A;  1UF0 A;  4A6Q A;  5EDS A;  2DZJ A;  3MC0 B;  1VZ6 A;  4N9F 4;  2N7D A;  2X8X X;  1QOG A;  2IGH A;  1RRB A;  1AN8 A;  1E7P B;  2WXL A;  3J9C A;  4N59 A;  5HI1 A;  4HCP B;  2KLC A;  3SHQ A;  4WUR A;  2I1K A;  2BS4 B;  2ZPY A;  2DYB A;  2N4F A;  4K3C A;  1YX6 B;  2QDF A;  1FFU A;  1GAQ B;  4IM3 A;  1MPE A;  3IAM 1;  3DHH C;  2KOX A;  3I9V 1;  1N62 A;  1E90 A;  2L0T A;  3JYU A;  1JRU A;  1XEE A;  4IM0 A;  4TV3 A;  1RM6 C;  4EZL A;  4IW0 A;  1JW9 D;  3KYC D;  1CJE A;  2LXA A;  2GBM A;  1FNV A;  2A4Z A; 
#chains in the Genus database with same CATH homology
 3R2T A;  2BB6 A;  2WXG A;  3AED B;  2QIE B;  2AX5 A;  1VR9 A;  1JAL A;  1I4Q A;  1M4V A;  3SEB A;  3U2S C;  3NRZ A;  5D3D A;  2QJL A;  2WXK A;  4YT0 B;  2V3P A;  2WXQ A;  1WYG A;  4OHJ A;  4IKG A;  4JPS A;  4MT5 A;  2LMC A;  1VLB A;  3N9Y C;  1BUI C;  1WWT A;  2J42 A;  1YJJ A;  1FXI A;  2D5G A;  3P63 A;  1WGK A;  1RYJ A;  2ICI A;  2NMQ A;  3PZ8 A;  3HVZ A;  1P7F A;  2K0P A;  2YEP F;  1E9M A;  3ABV B;  3B2F A;  4OZC A;  3ZQ4 A;  1C78 A;  2M19 A;  4B0E A;  1JWB D;  2K9X A;  1AYF A;  1D5X C;  1C4C A;  1EM7 A;  1KRH A;  5FKA C;  2IJ0 A;  2W82 A;  3ETR A;  2IGD A;  3P42 A;  3RPF C;  1D5M C;  1MHH E;  1NYQ A;  1UUP A;  4OW0 A;  1VJK A;  4B0M A;  3AEB B;  1AWD A;  2M0A A;  3EGR A;  1ET6 A;  1Q10 A;  2KN4 A;  4KKJ A;  1FXA A;  1PFD A;  1K53 A;  2JX5 A;  3AE7 B;  5H92 C;  2GI9 A;  1GB1 A;  4JE3 B;  3BII D;  2MEK A;  2E3T A;  4RFB A;  1FRD A;  2VZK B;  3PO0 A;  1P7E A;  3W5U B;  5FR3 A;  1UWM A;  1JWS D;  1LO5 D;  2BTE A;  1YQ3 B;  3SFE B;  5BYS A;  5JXV A;  1F77 A;  1GPX A;  5C2T B;  1SBB B;  3Q8B A;  3BVG A;  4RF1 A;  4N58 A;  2NTS A;  2Z8L A;  3TEZ A;  1UNS A;  2XN9 C;  5LNK 1;  4ITK A;  2J52 A;  3U4E G;  4C56 C;  2WXH A;  5E6J A;  4HKQ A;  1KLG D;  2RPV A;  1D4B A;  1TJE A;  2MH7 A;  1QLB B;  3TEX A;  1JCK B;  2Y3A A;  2HDE A;  4JX1 C;  1L0Y B;  3FIL A;  5BMH A;  3E9S A;  1HA5 A;  1DGJ A;  1E0Z A;  1ZPS A;  4LLG M;  1KF6 B;  3P4P B;  1B9R A;  2LJI A;  3V05 A;  1FD6 A;  4J3O D;  2NTT A;  1FIQ A;  2RMM A;  1XXG A;  2V0G A;  4MAC A;  2CJN A;  1J7A A;  1ZXI A;  2PTL A;  1ZDX A;  1CQV A;  3VR8 B;  2PIA A;  3BVZ A;  1R7S A;  3Q69 A;  4XDD A;  3SFD B;  2JU6 X;  4JWU C;  4KGR A;  3V3X A;  4OZB A;  5AUK A;  5HG2 A;  1WRI A;  4YTN B;  1FNV A;  2K22 A;  1IGD A;  3AMZ A;  3W9C B;  2ACZ B;  2JZP A;  1PYW D;  2J4X A;  3DWG C;  2HTM E;  1EU3 A;  4RGT A;  1N61 A;  1HEZ E;  2Y5P A;  5EE3 A;  4IDI A;  1CK1 A;  1CZP A;  2SAK A;  3AM9 A;  4JWS C;  4XWW A;  1C9F A;  1SIJ A;  4YSY B;  1RWS A;  2FBW B;  4O1N A;  1ACC A;  1IBX B;  3BWU D;  3C8Y A;  4C7Z A;  2EEL A;  1FCL A;  1FM0 D;  4YTP B;  2AQ3 B;  3EUB 2;  4RH6 A;  1ZXH A;  2AQ2 B;  3Q8E A;  4P6V F;  1XLN A;  4P16 A;  4ZHO A;  5FK9 C;  4WH4 A;  1XLP A;  2W54 A;  5EE0 A;  4MM3 B;  1OQR A;  5I4D A;  2PVO D;  3NVY A;  4A9A A;  1FMA D;  1T3Q A;  1ESF A;  4HEA 1;  5MPO A;  1TZO A;  3L4P A;  5HHD G;  2QEJ C;  3TUO A;  3TEW A;  5GXG B;  4D2K A;  2PMV A;  3FIL B;  2WXO A;  1YN5 A;  3CWI A;  5EE9 A;  1F2R C;  4ZYS A;  1QOA A;  1XCQ L;  4L23 A;  2LHD A;  4YXD B;  1YMH E;  1TYG B;  3LB8 C;  1FNW A;  2BYT A;  3SR6 A;  2BS3 B;  3MP9 A;  4A90 A;  2M56 B;  2RDG A;  4H2A A;  1ZOY B;  1FEH A;  4RGO S;  1VZ8 A;  2WDV B;  2WXM A;  2N9L A;  3O13 A;  1V97 A;  1TY2 A;  2WDR B;  1EWC A;  1QIL A;  3TSS A;  2W3R A;  1I4G A;  4YWG G;  4HRS A;  3TEY A;  4ZHP A;  4GDK B;  2ON8 A;  3HUI A;  3KLS X;  4WQM A;  4WAF A;  3W2D A;  2AQ1 B;  2K5P A;  1PUT A;  3ZYY X;  3BYY B;  1NYR A;  3BZD B;  3WCQ A;  3EA6 A;  1WXQ A;  3OWE B;  1PGB A;  1N5W A;  1XLQ A;  2MJE A;  1PGA A;  1JML A;  1C4A A;  1A70 A;  3BVM A;  2JYE A;  5G5G A;  1YJI A;  1SB3 C;  3T3N A;  3AE6 B;  1AW7 A;  1DYQ A;  2BW2 A;  3ZJV A;  2I2Y A;  3AEF B;  1PDX A;  2LEK A;  1N63 A;  1KH0 A;  1V8C A;  5HFY A;  2INN E;  2V3N A;  1ROE A;  1MI0 A;  2V4I B;  3GP7 A;  2H89 B;  1I7H A;  3ZJT A;  1FCC C;  2KDM A;  2OED A;  1NI3 A;  2WS3 B;  3B9J A;  1MVK A;  3P4S B;  4A8X C;  3P4Q B;  3R8B A;  2TSS A;  2WDQ B;  1PGX A;  3AV8 A;  4MH8 A;  3Q8F A;  3AE8 B;  3KWV A;  5T8I A;  4CQN A;  2ZW0 A;  4AQ7 A;  3U7Z A;  1J7B A;  2DLB A;  2WP9 B;  3RFZ B;  3URY A;  2L1A A;  3UI3 A;  4LTU A;  3W1S A;  1C76 A;  1L6V A;  2CJO A;  2QIL A;  3PZ7 A;  2BBC A;  1SXT A;  1ZUD 2;  1V1O A;  1K50 A;  2WLB A;  1WSP A;  2PVG C;  1L5P A;  3IT4 B;  3P1M A;  1FRR A;  4GDL B;  4GLS C;  1QOF A;  2JXT A;  2EKI A;  3AEC B;  4ZOH C;  4A55 A;  2WXP A;  1NEK B;  3GS2 A;  4OVZ A;  4NAM A;  1JQ4 A;  4KGT A;  1DOX A;  2B76 B;  1YQ4 B;  2BB5 A;  1VZ7 A;  4DXG A;  1I4X A;  1E10 A;  1FNU A;  3AEG B;  4HRO A;  3ZGZ A;  1KTK A;  2BT6 A;  2K3U A;  4HJG E;  4US8 A;  1T5X D;  2WXJ A;  1OQQ A;  3AN1 A;  1TS4 A;  1JWM D;  3AE9 B;  1L6U A;  1XLO A;  1RFK A;  4DXF A;  1HZ6 A;  1BXT A;  2X38 A;  1HXY D;  1V1P A;  3LYY A;  1F2R I;  3KWL A;  4US9 A;  2XNA C;  4C7Y A;  3I57 A;  4ZRQ A;  5BMG A;  5H8Y E;  4TQ0 A;  1QKZ A;  3KQ4 A;  3AEE B;  2GB1 A;  4WIP A;  3R2I A;  1XF5 L;  2J53 A;  2G9H D;  1TS2 A;  3NVV A;  2I38 A;  4REZ A;  5BMI A;  1SJH D;  1D5Z C;  1ET9 A;  3E56 A;  3B2G A;  2DYM A;  1TKY A;  3CIR B;  2DYO A;  4NJC A;  2LFI A;  2WXF A;  2INP E;  1IBX A;  2L52 A;  3GB1 A;  3NVW A;  4RCO A;  2FUG 1;  1OFF A;  2JQR B;  1L4D B;  1I4R A;  3Q8A A;  2KMM A;  3NVZ A;  3AB5 A;  1ZE3 D;  1B1Z A;  4RF0 A;  3LXF A;  1SEB D;  2WQY B;  3NUH B;  4HKZ E;  1DOI A;  2JWU A;  2Q5W D;  2N0S B;  4UDU C;  1QOB A;  1TS3 A;  1I4P A;  3MFG A;  5BYR A;  3AE2 B;  1QT9 A;  3IAS 1;  1SF0 A;  4AS1 A;  1E6E B;  1JRP A;  2L83 A;  4PT5 A;  4TMA B;  1VRA B;  2W3S A;  2CU3 A;  2W55 A;  4IOI E;  1K51 A;  3ZJU A;  1VDV A;  2WXI A;  2G1E A;  2JYT A;  3AE5 B;  2H88 B;  3AEA B;  3BK2 A;  1D6E C;  4R3D A;  4ARC A;  3Q8C A;  3W5V B;  3MJ5 A;  2Y5C A;  3BK1 A;  4NAW B;  1N60 A;  1L0V B;  2VZK D;  4Q2J A;  4YTM B;  1DOY A;  4RNA A;  3AE4 B;  2QMT A;  2BS2 B;  3AE1 B;  1KFY B;  5BYQ A;  3U52 E;  4XDC A;  2SEB D;  2KQ4 X;  4XE0 A;  1GB4 A;  4FXC A;  1HZ5 A;  1C77 A;  1BML C;  1SSN A;  1TY0 A;  1NEN B;  2KAC A;  3H8H A;  2WXN A;  1SE2 A;  1ENF A;  4ZRP A;  4XWT A;  2WU2 B;  4EE2 A;  4DQO C;  1NVI D;  1SE4 A;  3AH7 A;  1I4H A;  2DBY A;  4YSX B;  1TKG A;  1C4P A;  1FO4 A;  1STE A;  3BYT B;  1XCT L;  2N9K A;  2R61 A;  3DWM A;  3HVD A;  2MJD A;  5EE1 A;  4N6E B;  1QF6 A;  1GOZ A;  3T3O A;  1K52 A;  4KX6 B;  4RGM A;  1JWA D;  1QQR A;  3HRD D;  3NS1 A;  4LK0 M;  1KLU D;  1TKE A;  1JWU D;  2IPK D;  3P4R B;  2N7J A;  2QSD A;  3VRA B;  1YN3 A;  1IUE A;  2WXR A;  1HQR D;  1UWX A;  5G5H A;  2ONQ A;  4C80 A;  1UGJ A;  4NZL B;  2OHF A;  1JRO A;  5TSS A;  4KKI A;  1EU4 A;  4KGS A;  1J7C A;  2PW9 A;  1XO3 A;  2KAJ A;  4A6Q A;  4USA A;  1C79 A;  1FFV A;  3MC0 B;  1T6B X;  1VZ6 A;  4WWM A;  3VRB B;  3AE3 B;  1SE3 A;  1QOG A;  1IGC A;  2IGH A;  1SJE D;  4TSS A;  1AN8 A;  1E7P B;  2GRI A;  1YN4 A;  4L1B A;  2WXL A;  3J9C A;  4N59 A;  3VR9 B;  2RDH A;  5HI1 A;  2WU5 B;  4WUR A;  2PKO A;  3VQI A;  2KWD A;  1V1P B;  2BS4 B;  5D7G A;  3IXS A;  4RGN A;  2PLP A;  1EWY C;  1YNT E;  2JSV X;  1F0Z A;  3MHZ A;  2DWQ A;  3NZ3 A;  4M0W A;  1FFU A;  1GAQ B;  1ZDV A;  2LGI A;  5C3J B;  1MPE A;  3IAM 1;  4YSZ B;  2YEP B;  2ZW1 A;  1N5X A;  3FAH A;  4TQ1 A;  1L0X B;  3I9V 1;  1MHX A;  5AUI A;  1N62 A;  4ARI A;  3IT6 B;  2L32 A;  2LUM A;  1XEE A;  3FC4 A;  2LHE A;  2E6X A;  5D3I B;  1ZP0 B;  2FE8 A;  1RM6 C;  4L2Y A;  1JW9 D;  1Y56 A;  1CJE A;  4OZA A;  2IDY A;  2MJ3 A;  1TS5 A;  2IGG A;  2WNM A;  1L4Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...