2LJIA

Structure of a protein from haloferax volcanii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
b'MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title Structure of a protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 5
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ljiA00
2LJIA 2L32A
chains in the Genus database with same CATH superfamily
3ETRA 4M8NA 4E3CA 4A55A 4S17A 3AU4A 1T0YA 1L4ZB 2LZ6A 3CIRB 5LNK1 3IAM1 4LCDE 2LI5A 3ZRFA 1F9JA 1ZXIA 1N6ZA 2G1EA 1NI3A 2IZVB 4TMAB 3V62A 3TEWA 1HTQA 4GIVA 2BGFA 1E7PB 3NS8A 1P0RA 4ZRJA 1EO6A 4QAYA 4HLEA 2KFKA 2QCZA 3QQ8B 4GOCA 1TS5A 5EE0A 3DVNV 3HM6X 1UD7A 1E5WA 2IJ0A 3DWGC 3H7SA 1UF0A 3ZXRA 3CSTA 2KXJA 3L17A 1R4MB 3NVYA 1WI0A 2KFKB 5G55A 3D32A 2KJ6A 2PKOA 2JRHA 1V5TA 3RZWC 4IWPA 2N4FA 1WXQA 3T8MA 1N63A 3DBRB 1ZUD2 2JWUA 3ZDMC 1EUVB 4BAXA 2PVOD 4W9IA 2FAZA 2CS4A 4GDKB 3VUXA 3P4QB 5KHQA 1QT9A 2NBVB 1E10A 1C76A 2R61A 1SXTA 5LXIB 1N61A 2LGXA 3HM3A 4YSXB 3RMKC 5BMHA 2QEJC 1JQ4A 1CK1A 3NHEB 4C4VB 4ARIA 2R2OA 4KX6B 2QMTA 1SE2A 4Q2JA 3PREA 1ZPSA 3UINB 4AQ7A 1PUTA 3QJZA 4REZA 3LDZE 2ZNVB 1C4PA 2WP9B 5HG2A 1IP9A 3N1ZC 5CHVC 3ZKJC 1VZ8A 5L83A 2BYVE 3K9PB 5BYRA 3A4SC 2RGFA 2RDBC 1UGMA 1ZE3D 4K3BA 1P3QU 3GE8C 3QIJA 5H92C 4B95A 1GJZA 3QX1A 1WX9A 3NUHB 3WANA 3AECB 2ZNVC 4C7YA 1DYQA 1M94A 3AE7B 1RYJA 1TKYA 1R4NI 3AE3B 3A9KA 2E3TA 1KLUD 4B9KA 3Q8AA 3JW0X 4II2B 2WXPA 2PTLA 1GUAB 2LGDA 4X57B 4H2AA 1I7HA 2LGSA 2LXCA 5L95C 3WCQA 4A9AA 4YXDB 3Q14C 3A9KB 2O2VA 3B1LX 4EKUA 3TEXA 3TCAA 1K53A 2ZW1A 4MDKE 3VUYA 4NJ6A 2PVGC 1LM8B 1ROEA 2MLBA 4DHJD 4LLGM 2PE6B 4MSMB 2Z0DB 3J9CA 5DPSA 3ZNID 4KGTA 2IY0B 2O2VB 5IA7A 3RT3B 2MCNB 5DCNA 5G2NA 2LVQA 4ANWA 3AE4B 4OVVA 3A4RA 4W9JA 3ZRCA 1WJ4A 3Q3OC 3SR6A 2FIDA 2WXRA 2CJOA 2MBQA 2ONQA 3A9JB 4EUTA 2SEBD 2JWZA 3H9DA 4WURA 2WXFA 1WWTA 4ZRKA 4A20A 1FFUA 4MEMA 2G45B 1WRDB 2KX3A 5IKCM 2KC1A 2D10A 2UU7A 1IYFA 4PYUA 1FEHA 3PTFC 2JXTA 3VDZA 4AP4C 3RNGC 3BZDB 3BK1A 4K7UA 4MGKE 1CJEA 4WWPA 3ML8A 2G4DB 1XLOA 2LMCA 4AJYB 4FHJA 2WU2B 2L0TA 1FXIA 3Q3FA 4JGHB 1WX7A 3KYDD 1XCQL 2E6XA 1KJTA 4G0NB 2C7MB 1SJED 4XGAB 3DQVA 4YL8A 4ACFA 5IP4D 1YQ3B 1CZPA 4NQKE 1D4BA 1E9MA 3AE2B 3KYCD 2LJ5A 3X0WA 1ESFA 2Q5WD 2REXA 1YX5B 3V6EB 4DHZE 2NVUI 3AB5A 5AZFA 4WJNA 2AEHA 2BT6A 4M02A 1XQQA 1IUEA 4ICUA 2JT4B 3ZIMA 3ALBA 1I4GA 4KKJA 1GG3A 1STEA 5E6PA 3AE1B 1ZDXA 2HDEA 1ET6A 1OQQA 2FCNA 3ZVVA 4N58A 2IDYA 2D3CA 4RCOA 1F0ZA 5MPOA 1WJ6A 2ZJDA 1WXVA 3AN1A 4W9LA 3IAS1 2HE7A 4HXDA 1B1ZA 2ZPYA 4C56C 3PVLA 3H7PA 1CMXB 3DVGY 1TY0A 1NVID 5FKAC 1FFVA 2N1WA 4NY0A 5FR3A 1PGBA 2WS3B 2AQ1B 2R2QA 2WGSA 3AM9A 5HKHA 3B2FA 1NBFC 2K3UA 4OZAA 3L08A 3HVZA 3RPFC 1SJHD 2K5PA 4ZRPA 2KDEB 1L0YB 4KSLC 5D94A 3R66C 1L7YA 1OEYA 2A5UA 1C3TA 2W82A 4IKGA 4A6QA 3TBLD 1E8YA 2INDC 2LXAA 3KUDB 1UH6A 3VR8B 3ZYYX 2B3AA 1FNWA 4PS7A 2YEPF 2LVOA 1MHXA 1FRRA 3AEDB 1FMAD 1J7CA 2KX0A 4WJQA 1SB3C 3NY5A 1JRUA 2INNE 1L2NA 2L7RA 2K8HA 4I6LB 1YIWA 2AL6A 2C5LC 2YEPB 1WGHA 3QAQA 3KWVA 2AX5A 2KTRB 4TQ1A 3ZNHB 4GXBA 4DDID 2N7JA 3PV1A 4IWQA 2W9NA 2ICIA 4ZYNA 2KDFB 3VRBB 2LUMA 2OJRA 4YWGG 1N5WA 1TGZB 2KQSA 3LB8C 3E9SA 2JSVX 2NPTA 1P7EA 4NJ7A 1CQVA 3ZNZB 4WAFA 1GC6A 2HJ1A 1V80A 4CHKA 2BS2B 2Y5BB 3N9YC 2Y3AA 4JWUC 1TS2A 3IXSA 3ZTCA 4A3OA 1JWBD 2ON8A 5C2TB 2D07B 1D3ZA 4L23A 2KWDA 3AXCA 1VDVA 4ZRIA 1M4VA 4EFOA 1YN3A 4NQLB 4LNIA 2UYZB 2FNJB 2G9HD 3CF6E 3ZW3A 2O6VD 5D6JB 3LYYA 4UDUC 3N30A 3ZO5B 2HD5B 5CHWA 4XYCA 5JHBA 3MHSD 1J8CA 3UGBB 1KM7A 2ZCBA 4ANUA 4A3PA 1OQRA 2BQQA 4JIOU 2WU5B 5CHFA 3NS1A 1XO3A 2N9PC 4KIKA 2J0JA 1Q5WB 1E7UA 2D3GA 4DQOC 5E6NA 2MWSB 4GMVA 1K8RB 1KF6B 1GB4A 3U8ZA 2JXXA 4LNNA 2CU1A 4G3XB 4BKSD 2N1VA 4KIKB 1KOTA 4FJYA 2MX2A 2KNBA 5AUIA 3VXWA 2KN5A 1T3QA 2MQJA 1AARA 1E7VA 3W5UB 2W3RA 4RMAA 4M00A 2PIAA 3CWIA 2DNFA 2WWZA 2KACA 1WR6E 3MC8A 4W9HA 2L32A 5BMIA 2BB6A 3Q8EA 1V86A 1DOIA 2BPSA 1H8CA 4GDLB 3P4RB 2I1KA 2IO2B 2OHFA 2AQ2B 3H8HA 3HRDD 4YT0B 1NEKB 4BBNC 2DBYA 1LQBA 5HI1A 4BFRA 4K7WA 2LJIA 4K81A 2GBJA 3PRPB 4K3CA 4RNAA 4ZDVA 1NENB 5D7GA 3V61A 1GAQB 2FCQA 4XWWA 3EGRA 3W9CB 2D3BA 3AE8B 4RGNA 5JXVA 3S2AA 2FUG1 2RDGA 2L00B 1YQ4B 3P1MA 2JZZA 2WXOA 3ZXVA 3VH3B 4KKIA 1SE9A 5DPRA 1E8XA 2KK8A 4NNJB 2D2QA 4FA6A 5IOIA 2KJHB 1KTKA 2IGHA 2V9HA 4DWFA 1TIFA 3AE6B 1ZXHA 1YX6B 3AV8A 5FK9C 3ABVB 2V3PA 3Q69A 3KH0A 1KLVA 1YMHE 3U52E 2ZW0A 3DWMA 4GDKA 3URYA 2BBCA 3IG3A 1YN5A 2JYEA 1XF5L 2L83A 2IGGA 3TIXA 2MRPA 1VZ6A 3EUB2 4CYEA 3VH4B 4MGIE 1E8ZA 1FNUA 3GP7A 3MHZA 1E6EB 2DX5B 3Q8BA 4YTNB 4C4VA 4A8XC 3HIZA 4HJKA 3W2DA 2FUHB 1VRAB 2WXHA 4RFBA 1PFDA 1K52A 3W1YA 5BYQA 1U4AA 1TY2A 2WXGA 2BYTA 3I9V1 2KAJA 4GGQA 3PSEB 3UIPB 1LFDA 5C3JB 2ZPNA 4ZHOA 4G11A 1QOAA 1EF1A 3IT6B 1FCCC 2DLBA 1TYGB 3ONSA 3I63C 3RN9C 1TKEA 3DBSA 2A4ZA 4LNKA 1Y8RC 1P1AA 2V3SA 4L1BA 1B9RA 1LO5D 1Q1OA 2J52A 3CMMB 1UBQA 1XCTL 3SFEB 4MGZE 3EC8A 2ZVOA 4N6EB 2EMSA 1LXDA 1Q0WB 2N0SB 1AWDA 5FR6A 1EM7A 1PQSA 3DHGC 3PRZA 2EELA 3VUWA 2CHWA 2MEKA 3PZ8A 1TT5B 2DYMA 4HK2A 2IBIB 1SGHA 5HFYA 1ACCA 2PW9A 3NVVA 4JWSC 2MBOA 4KVGB 1PDXA 3Q3JA 1JWSD 1HXYD 1N62A 1J7BA 1J0GA 3JSVA 1UUPA 4J3OD 3B9JA 4DHZB 2KVZA 2HTHA 2XN9C 4P16A 3TUOA 1T0SC 3AI5A 1RLFA 2K39A 2QIEB 3A9JA 2C7NB 4E71A 4PS8A 2WXIA 5AUKA 3JSVB 3AEAB 1MHHE 4JLCA 1UWMA 3RNEC 2GBRA 2X38A 1PGXA 3A1QB 2M4NA 2J42A 3RNFC 2KO3A 2W54A 3RNCC 5IO9A 3RI7C 2VH1A 2VZKB 2IO0B 2UWQA 1V49A 1ZOYB 3BWUD 2N7EA 3L13A 1AYFA 4GN1A 4WQMA 1A70A 3IFWB 4I6NB 1YJ1A 2OOBB 2PMVA 2RMMA 1OTRB 1E90A 2WXLA 2KQ4X 4WIPA 4ANXA 2JPHA 1QLBB 4YTMB 4MACA 4GU2A 5G5HA 2QILA 2H89B 1WXSA 3AEBB 1WFYA 2WDVB 3ECIA 2EMTA 3T3NA 1KH0A 3WAOA 2NCNA 2QDFA 2C9WB 2NBWB 4LJPB 2KN4A 5I4DA 2W55A 1HZ5A 1HEZE 1P98A 4PYZA 5J17A 2BB5A 4DHJB 1WSPA 1QILA 3NRZA 3HK0A 4OW0A 4KGSA 2LHEA 4AUQC 2NS5A 3DCGA 3PO0A 1ZW7A 2DWQA 2LASA 2KJRA 1JWUD 1X1MA 2AQ3B 2MJ3A 4XWTA 1Z5SB 4WWMA 3WAPA 1Q10A 4FHKA 4XDDA 1UNSA 1WYGA 3Q6BA 1JWAD 2WQYB 2H88B 1YQBA 4E74A 3TMPB 2WDRB 4W9FA 2WLBA 1HQRD 3KW5B 1BUIC 2N9EB 3QC8B 1SBBB 4OZCA 2VRRB 3RNAC 1ZKHA 2RPVA 3PGEA 5E6JA 3EHVA 2RR9A 2X8XX 4KZCA 1V8CA 4RF1A 1WZ0A 2FCSA 3MC9A 5T8IA 4OHJA 1WE6A 4FXCA 1I4HA 2N7DA 3ZLZA 1C78A 4JX1C 3DHIC 1FPYA 1C4CA 1EWCA 2MBBB 3L0WB 2CHXA 2JY6A 2MJDA 3V05A 3O65B 3PZDA 4TSSA 2RDHA 1FO4A 1JMLA 2KQ7A 2OEDA 4IC7B 1JROA 1FIQA 5CTRC 1WH3A 2BF8B 2WXKA 3FAHA 3T9LA 3MP9A 4ZYSA 3KWLA 3UI3A 1L6UA 2BWES 3ZJTA 3ENEA 2IYDB 2W3SA 2LHDA 2GLSA 4W9EA 2TSSA 3TJPA 1FD6A 2NR2A 1XLPA 1V2YA 2FBWB 2IPKD 4PT5A 4HRSA 1D5MC 2ASQA 1NYQA 1WGRA 2LVPA 4P1BC 1C1YB 1F52A 1WXAA 1IGDA 2KDMA 3GS2A 3R3MA 2V1YA 3SU8X 4S0RA 1GOZA 3C8YA 2KTRA 3VHTC 2BVCA 1ENFA 4MGYE 4MM3A 4NJCA 3GOEA 4LDTB 3IVFA 4EZKA 1L5PA 2GBMA 2JVCA 1YN4A 2DYOA 4HPPA 1TS4A 3PHWB 4NAMA 3M95A 2MP2A 3RUIB 3SD5A 1BT0A 3Q3MC 4HROA 5AZHA 3BINA 4MM3B 2KOXA 4ICVA 4NAWA 1VD2A 4HKZE 3P63A 2EKIA 4KDLB 4RGTA 4HVBA 1JRPA 2KMMA 2MP2B 4W9GA 2BTEA 2BW2A 2L3ZA 1JWMD 3NOBA 3AU5A 3R7QA 3KUCB 4NAWB 2CR5A 2LD9A 3DHHC 4JQWC 1MG8A 2G3QB 1SE3A 1OEYJ 4GB9A 3QA8A 1KLGD 1TJEA 3GE3C 5J18A 2JU6X 4US9A 1VLBA 3RZFA 2HTME 2WX1A 5DPTA 2WXNA 3PPAA 3U30A 3OJ3A 1Z2MA 5TR5A 3PS6A 3FILB 3NZ3A 2AYOB 1GPXA 2RD0A 5AEKB 3MJ5A 4IG7B 1MG4A 2BKRB 4FJZA 4EOYA 3B0AA 1SE4A 2LGIA 3Q8FA 3U2SC 2CHZA 4KDIC 2JRIB 3U7ZA 4OVUA 3C19A 2GRIA 4R3DA 3QARA 1FNVA 2ZCCA 2Y5PA 3NJTA 3P4SB 3VTUA 4PS3A 3QHTA 1ISNA 2CKHB 4P1CC 1RM6C 2D3AA 2JQRB 3EECA 3WALA 2WHIA 4XZ4A 4P6VF 2Z8LA 3DPDA 2K1FA 2K0PA 4N9F4 4GDLA 3AEGB 3VAWA 3TEZA 4URKA 4ITKA 3RULA 1FXTB 1HE8A 1I4RA 5JHAA 1OQYA 4BKTA 3VVWB 2N9LA 2FE8A 2MHJA 4KZ0A 5JZEB 3L54A 4IM0A 3U4EG 2BS3B 1SIFA 3BVGA 4WQOB 1WE7A 2DAJA 1F2RI 3B2GA 1FCLA 1R7SA 2KDIA 2V3NA 2GBNA 2ACZB 4HPLB 2GMIC 2K8BA 2INPE 4DK5A 2KMAA 4G50A 3L16A 3BVMA 3H1UA 2WYQA 3TEYA 2J0KA 4EZLA 3TSSA 4HCNB 2C60A 4XC2A 1V97A 3TL5A 1T0RC 1I4PA 3I3TB 3VTWA 3SFDB 3UQBA 1WIAA 4CO7A 2KZRA 1WGDA 1EU4A 3P42A 5EE1A 2CU3A 3WA0A 2M17A 2ZVNA 1C77A 2M1MA 4II3B 4DXAB 1EU3A 3ZJVA 1EF5A 2DZIA 1MFWA 3AH7A 1ZP0B 4ANVA 1N60A 4HKQA 1J19A 1AW7A 1PYWD 2I38A 3U7DA 2WDTB 3OAWA 4JL9A 3GB1A 4IOIE 4FADA 1WJUA 3ZTDA 1E8WA 2D5GA 2DHZA 3W1SA 2NTSA 1SSNA 2N9XA 2PJHA 1RAXA 4W9KA 4DXFA 1UGJA 3P4PB 2GBKA 1TTNA 2LGYA 2WXQA 2DZJA 2YVCA 2AWTA 1P7FA 1UELA 3N1XC 3M62B 4HPMB 2C7HA 3OWEB 3L4PA 4USAA 3MFGA 3GZNI 4IM2A 2MW5A 3UIOB 1J7AA 3DBLB 5AZGA 1XT9B 1HA5A 2J0MA 1XD3B 3FC4A 3WIMA 4DBGA 4C80A 1WMHA 3V60A 3NZSA 4KV2A 4GSWA 2Z59B 1GNUA 1VR9A 2DAFA 1YD8U 3W1SC 4M0WA 2CJNA 4TQ0A 4MELA 2G4SA 1T6BX 2V4IB 4KSKC 3ZDTA 4I6PA 1WMHB 3R8BA 4EE2A 1YJIA 2XBBC 2BYFA 2V4LA 5D3IB 2KYWA 4M0WB 4O1NA 3X23A 1NYRA 4RF0A 1L0VB 2BYEA 4XX5A 1JALA 1LGRA 4IM3A 3EFCA 1SEBD 4WAAA 4P7IA 1WGKA 1DOXA 4B0EA 3ZQ4A 2GB1A 3VR9B 2MBEA 4IWOA 1SIJA 2K25A 4LJOB 1MI0A 4HCPB 2VZKD 3NZUA 3PT2B 4US8A 1YNTE 2L76A 4D2KA 1TKGA 1K50A 3ZGZA 1A5RA 3PLUA 4GLSC 3EFUA 3A1QA 4FULA 3W5VB 2M19A 1RFAA 3UF8A 1ZGUB 3AULA 3M63B 4DDGD 4XE0A 3VQIA 3SEBA 4ZRQA 2MA9B 4B0MA 2LUEA 5D2MB 3IHPC 4RGMA 1E0ZA 4LTUA 3A33B 1C79A 5EE3A 2MBHA 4RM9A 3OJ4B 3N32A 5BYSA 2L52A 1IGCA 3APDA 2K6DB 1V5OA 2K8CA 4XDCA 4YSYB 5IAAC 1D6EC 2IY1B 3EA6A 5H8YE 4IW0A 1IBXA 4IUMB 4AWJA 4K1RB 2I2YA 1TS3A 3DVGX 1K51A 2KVRA 4TKNA 4M01A 4WWOA 3KLSX 4BZAA 2K9XA 2LRWA 1WJNA 1Y56A 2GI9A 3N20C 2L0FA 1IBXB 1MVKA 1WYWB 3R2IA 3IT4B 3Q3NC 3KVFB 3PZ7A 1WRIA 1I42A 4TUUA 3DBHB 1WGGA 4ZHPA 4YSZB 2KT7A 4W9DA 4BOZB 2KWCA 4BKGA 3LJ3A 2DZMA 2QHOA 1WXMA 1D5ZC 2JX5A 4HJGE 3P2BA 3B08A 4B6WA 5DPWA 2J7QB 5GXGB 1KRHA 2VH2A 1KFYB 3RCZA 3H6NA 3HHMA 1MJDA 1DOYA 2JF5A 1UZXB 1JW9D 2ZEQA 5IN7A 3QWZB 3BIID 3HUIA 1DGJA 2BS4B 1YOVB 3ZJUA 1WY8A 3SDLC 1RFKA 2MH7A 3JVZX 3T3OA 4M8MA 2L05A 4AJWA 3BY4B 5E6OA 1QF6A 4NPNA 2Y5CA 2XEWA 2FCMA 3AEEB 1I4QA 2IGDA 1F2RC 1JCKB 4MSQB 3RYTA 2QJLA 2LRUA 1RWSA 2KLGA 1T5XD 1S3SG 1BMLC 2BWFA 4C00A 2MSED 3AE5B 4C7ZA 1WX8A 4L2YA 3VFKA 1IPGA 3V6CB 3KUZA 3WAMA 5D3DA 1UWXA 1XLQA 3CSFA 2LEKA 2KANA 3V3XA 2WNMA 4HEA1 3ML9A 4LNFA 1V1OA 2L8JA 1TBEA 2JZ3B 1NDDA 2IO3B 5G5GA 3RNBC 1ZDVA 3KQ4A 5J2RA 3NVZA 1VCBA 3BYTB 1XLNA 2QSDA 3DDCB 4DXGA 4J6IA 2FIFA 3N3KB 4MH0E 5GMVA 1QOFA 1WGYA 4HWIB 4MH8A 2RPQA 4LDTD 3H7PB 1R4MI 4F8CB 3OG5A 5BMGA 5CX3A 4JPSA 2Z0EB 2WDQB 3I57A 3VTVA 1NI2A 3APCA 1SF0A 3JYUA 4IDIA 2V0GA 3DBRI 2KWVB 3NG0A 2RSUA 4YTPB 2WXJA 2I1JA 2M0XA 4FN2A 1WR1A 3GZNB 2PLPA 2HJ8A 4WWNA 2DZKA 3DBLI 2AL3A 2NTTA 1V81A 2N9KA 2KMCA 1S1QB 3MTNB 3RD2A 3ZUNA 2KD0A 1TZOA 4MJSA 4NZLB 3OLMD 1L6VA 1L4DB 4OZBA 2DYBA 5LLIA 5EDSA 4FLHA 3DVNU 1QKZA 4CQNA 3LXFA 1YJJA 4ASWC 1F1HA 2NBUA 1V1PA 1MPEA 4MJSB 2WX0A 2KTFA 4HDQA 1QZEA 3K9OB 1I4XA 2GOWA 4WJOA 2BKFA 2YLMA 1V6EA 1OFFA 2WXMA 1P9DU 4EEWA 3O13A 1G6JA 2LWPA 3C0RB 1TZ1A 3NVWA 1HTOA 1V1PB 3N1YC 2J53A 2XK5A 3Q2AC 2JZPA 2OJWA 1F77A 1BXTA 2K6QA 3I5JC 2EKEC 2M8SA 1PGAA 1AN8A 4ZOHC 3APFA 4K7SA 4LNOA 2XK5B 4F1SA 1D5XC 3L10B 3R2TA 1OGWA 3UQAA 5HHDG 1R4NB 4FBJB 3MC0B 3BK2A 3AEFB 3QCAA 3FILA 3AMZA 2PE9A 1HZ6A 4ARCA 2B76B 1GB1A 2M56B 2INCC 1EWYC 2L1AA 2PPHA 5LXHA 2XNAC 3Q8CA 2KKCA 2NPTB 2MJEA 1VZ7A 2DENB 2K22A 2NMQA 5TSSA 3M3JA 1WZ3A 2JUOA 2KDBA 3VRAB 2JYTA 2KLCA 5C23A 4HDOA 3E56A 5BO4B 4BBNF 4WH4A 2PEAA 4LK0M 3ZNGC 3PHXB 3QK0A 3FKYA 2KC2A 1UBIA 3BYYB 2O6VA 4RH6A 2KWUB 1T0QC 2QC8A 4MT5A 4KGRA 1RRBA 3BVZA 1WM2A 1I35A 1H4RA 1VJKA 3MJWA 1FXAA 2SAKA 1C9FA 4FJVB 4N59A 4WJPA 1QOBA 3PLVA 2IO1B 4W9CA 1QQRA 2O6VB 2KFJA 5C1ZA 3DBHI 3PRMB 2J4XA 3R7RA 1WF9A 1L0XB 2KHWB 3DOWA 2M0AA 4TV3A 1XXGA 4OVZA 3SHQA 2D11A 3AE9B 4JE3B 3IBEA 4BKSA 4A90A 1FRDA 1ET9A 1V9JA 5EE9A 2ZZPB 5JH5C 3HVDA 1QOGA 4RGOS 1GC7A 4RM8A 4BOSC 4BVUC 1N5XA 3RFZB 1FM0D 5KHOA 4PK1A 4AS1A 4EZJA 1WM3A 4AOFA 1C4AA 1XEEA 2LFIA 4F7ZA
chains in the Genus database with same CATH topology
3ETRA 4RF0A 1L0VB 4A55A 1JWAD 1JALA 3VRBB 1SEBD 2WQYB 2H88B 2LUMA 1WGKA 1DOXA 4B0EA 1L4ZB 4YWGG 3ZQ4A 1N5WA 2GB1A 3CIRB 2WDRB 3LB8C 3VR9B 5LNK1 3E9SA 3IAM1 1SIJA 2JSVX 1HQRD 1MI0A 2WLBA 1P7EA 1CQVA 4WAFA 2VZKD 1BUIC 2BS2B 1SBBB 4US8A 4OZCA 1YNTE 3N9YC 4D2KA 1ZXIA 2RPVA 2Y3AA 1TKGA 4JWUC 1K50A 1TS2A 5E6JA 3ZGZA 3IXSA 4YTMB 1V8CA 4RF1A 4GLSC 2G1EA 1JWBD 1NI3A 2ON8A 4TMAB 5C2TB 3TEWA 4L23A 2KWDA 3W5VB 1VDVA 1E7PB 1M4VA 5T8IA 1YN3A 4OHJA 4FXCA 2M19A 1I4HA 2G9HD 1C78A 4JX1C 1C4CA 4XE0A 1TS5A 1EWCA 3SEBA 3VQIA 5EE0A 4ZRQA 2MJDA 4B0MA 3LYYA 4RGMA 3V05A 4UDUC 1E0ZA 4LTUA 2IJ0A 3DWGC 4TSSA 2RDHA 1C79A 5EE3A 1FO4A 1JMLA 2OEDA 3NVYA 1JROA 5BYSA 2L52A 1IGCA 1FIQA 2PKOA 1OQRA 2WU5B 2WXKA 3NS1A 1XO3A 4XDCA 3FAHA 3MP9A 4YSYB 4ZYSA 3KWLA 1WXQA 1N63A 3UI3A 1L6UA 1D6EC 4DQOC 1ZUD2 3ZJTA 2JWUA 3EA6A 5H8YE 2W3SA 1IBXA 2LHDA 1KF6B 2TSSA 2PVOD 1GB4A 4GDKB 1FD6A 1XLPA 2FBWB 2IPKD 2I2YA 4PT5A 1TS3A 4HRSA 1D5MC 3P4QB 1K51A 1NYQA 3KLSX 1QT9A 1E10A 2K9XA 1C76A 2R61A 1SXTA 5AUIA 1Y56A 1N61A 2GI9A 1IGDA 4YSXB 2KDMA 1T3QA 3GS2A 1IBXB 1MVKA 5BMHA 3W5UB 2QEJC 2W3RA 3R2IA 1JQ4A 3IT4B 1GOZA 1CK1A 3C8YA 4ARIA 2PIAA 3CWIA 3PZ7A 1WRIA 2QMTA 4KX6B 1SE2A 4Q2JA 4ZHPA 1ZPSA 2KACA 4YSZB 1ENFA 4NJCA 4AQ7A 1PUTA 2L32A 4REZA 2BB6A 1L5PA 3Q8EA 5BMIA 1DOIA 1D5ZC 1C4PA 2JX5A 1YN4A 2DYOA 4GDLB 2WP9B 3P4RB 4HJGE 1TS4A 5HG2A 2OHFA 2AQ2B 4NAMA 3H8HA 5GXGB 1KRHA 1VZ8A 3HRDD 4YT0B 1NEKB 1KFYB 2DBYA 4HROA 5HI1A 1DOYA 4MM3B 1JW9D 5BYRA 2LJIA 3BIID 3HUIA 1ZE3D 4HKZE 1DGJA 3P63A 2BS4B 2EKIA 4RGTA 1JRPA 5H92C 3ZJUA 4RNAA 1RFKA 2MH7A 2KMMA 3T3OA 1NENB 5D7GA 1GAQB 1QF6A 4XWWA 3EGRA 3W9CB 2BTEA 2BW2A 2Y5CA 1JWMD 3NUHB 3AE8B 3AEEB 1I4QA 2IGDA 1F2RC 1JCKB 4RGNA 5JXVA 2FUG1 3AECB 4NAWB 4C7YA 1DYQA 2QJLA 2RDGA 1RWSA 1T5XD 1BMLC 1RYJA 1TKYA 1YQ4B 3AE7B 3AE3B 3AE5B 3P1MA 2WXOA 1SE3A 2E3TA 4C7ZA 1KLUD 4L2YA 1KLGD 3Q8AA 4KKIA 1TJEA 2JU6X 4US9A 5D3DA 1UWXA 1VLBA 1XLQA 2WXPA 2LEKA 2PTLA 1KTKA 2HTME 3V3XA 4H2AA 1I7HA 2WNMA 4HEA1 2IGHA 2WXNA 1V1OA 3WCQA 4A9AA 4YXDB 5G5GA 1ZDVA 3KQ4A 3TEXA 3NVZA 3BYTB 1K53A 1XLNA 2ZW1A 3AE6B 2QSDA 1ZXHA 4DXGA 3AV8A 5FK9C 3ABVB 3FILB 2V3PA 3Q69A 2PVGC 3NZ3A 1ROEA 4LLGM 1GPXA 1QOFA 1YMHE 3J9CA 3U52E 3MJ5A 4KGTA 2ZW0A 3DWMA 3URYA 2BBCA 4MH8A 3AE4B 1YN5A 2JYEA 1SE4A 5BMGA 2LGIA 3Q8FA 4JPSA 3U2SC 1XF5L 2L83A 2IGGA 2WDQB 1VZ6A 3EUB2 3I57A 3U7ZA 3SR6A 1FNUA 1SF0A 2GRIA 1FNVA 4IDIA 4R3DA 2WXRA 2CJOA 2Y5PA 3P4SB 3GP7A 2ONQA 3MHZA 1E6EB 2V0GA 2SEBD 3Q8BA 4YTNB 4A8XC 1RM6C 2JQRB 4WURA 2WXFA 3W2DA 4YTPB 2WXJA 1WWTA 1VRAB 2WXHA 4RFBA 1FFUA 1PFDA 4P6VF 2Z8LA 2PLPA 1K52A 2K0PA 5BYQA 1TY2A 2WXGA 2BYTA 2NTTA 3I9V1 2KAJA 2N9KA 3AEGB 1FEHA 3TEZA 2JXTA 1TZOA 4ITKA 5C3JB 3BZDB 4NZLB 3BK1A 1L6VA 4ZHOA 1QOAA 1CJEA 1L4DB 4OZBA 1I4RA 1XLOA 3IT6B 2LMCA 1FCCC 2DLBA 1TYGB 2N9LA 2FE8A 2WU2B 1QKZA 3U4EG 3LXFA 4CQNA 1FXIA 1YJJA 1TKEA 2BS3B 3BVGA 1V1PA 1MPEA 1XCQL 1F2RI 2E6XA 1SJED 3B2GA 1FCLA 1R7SA 1I4XA 2V3NA 4L1BA 1B9RA 2ACZB 1YQ3B 1OFFA 2WXMA 2INPE 1LO5D 3O13A 1CZPA 2J52A 1D4BA 1E9MA 3AE2B 3NVWA 1ESFA 1XCTL 2Q5WD 3SFEB 1V1PB 3AB5A 3BVMA 2J53A 2JZPA 1F77A 4N6EB 3TEYA 1BXTA 2BT6A 2N0SB 1IUEA 1AWDA 3TSSA 1EM7A 1PGAA 1V97A 1AN8A 1I4GA 4KKJA 1I4PA 1STEA 4ZOHC 2EELA 3SFDB 2MEKA 3AE1B 3PZ8A 1ZDXA 2HDEA 2DYMA 1ET6A 1EU4A 1OQQA 1D5XC 3P42A 4N58A 2IDYA 3R2TA 4RCOA 5HHDG 5EE1A 5HFYA 2CU3A 1ACCA 1F0ZA 5MPOA 3MC0B 3BK2A 3AEFB 3AN1A 3FILA 2PW9A 3AMZA 3IAS1 1C77A 1HZ6A 3NVVA 2B76B 4JWSC 4ARCA 1GB1A 2M56B 1EWYC 1PDXA 1JWSD 1HXYD 2L1AA 1B1ZA 1N62A 1EU3A 4C56C 1J7BA 3ZJVA 1UUPA 4J3OD 3B9JA 2XNAC 3AH7A 1ZP0B 1TY0A 1N60A 3Q8CA 4HKQA 1NVID 2MJEA 1VZ7A 2XN9C 4P16A 5FKAC 1FFVA 3TUOA 1AW7A 1PYWD 2I38A 5FR3A 1PGBA 2WS3B 3GB1A 4IOIE 2QIEB 2AQ1B 2K22A 2NMQA 5TSSA 2WXIA 3AM9A 5AUKA 3AEAB 3B2FA 2D5GA 1MHHE 3VRAB 3W1SA 2K3UA 4OZAA 1UWMA 2JYTA 2NTSA 2X38A 3HVZA 1SSNA 1PGXA 2J42A 3RPFC 1SJHD 2K5PA 2W54A 4ZRPA 3E56A 1L0YB 4DXFA 1UGJA 2VZKB 4WH4A 3P4PB 4LK0M 1ZOYB 3BWUD 2WXQA 1AYFA 4WQMA 1A70A 2W82A 1P7FA 2PMVA 4IKGA 2RMMA 3BYYB 4RH6A 3OWEB 2WXLA 3L4PA 4A6QA 2KQ4X 4WIPA 1QLBB 4USAA 4MT5A 3MFGA 4KGRA 3VR8B 4MACA 3BVZA 5G5HA 2QILA 3ZYYX 2H89B 1VJKA 3AEBB 1FNWA 2WDVB 1J7AA 1FXAA 2SAKA 1C9FA 3T3NA 1KH0A 4N59A 1QOBA 2YEPF 1HA5A 1QQRA 1MHXA 1FRRA 3AEDB 2KN4A 3FC4A 5I4DA 2W55A 4C80A 1FMAD 1J7CA 1HZ5A 2J4XA 1HEZE 1L0XB 1SB3C 2BB5A 1WSPA 2M0AA 1XXGA 1QILA 1VR9A 4OVZA 2INNE 3NRZA 3AE9B 4M0WA 2CJNA 4OW0A 4TQ0A 4JE3B 4KGSA 2LHEA 3PO0A 4A90A 1FRDA 1T6BX 2DWQA 2V4IB 1ET9A 5EE9A 3HVDA 1QOGA 1JWUD 4RGOS 2YEPB 2AQ3B 3R8BA 2MJ3A 3KWVA 1YJIA 4EE2A 2AX5A 4TQ1A 4XWTA 1N5XA 3RFZB 1FM0D 4WWMA 2N7JA 5D3IB 4AS1A 1Q10A 4XDDA 4O1NA 1C4AA 1XEEA 2LFIA 1NYRA 1UNSA 1WYGA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJI A;  2L32 A; 
#chains in the Genus database with same CATH topology
 3ETR A;  4M8N A;  4E3C A;  4A55 A;  4S17 A;  3AU4 A;  1T0Y A;  1L4Z B;  2LZ6 A;  3CIR B;  5LNK 1;  3IAM 1;  4LCD E;  2LI5 A;  3ZRF A;  1F9J A;  1ZXI A;  1N6Z A;  2G1E A;  1NI3 A;  2IZV B;  4TMA B;  3V62 A;  3TEW A;  1HTQ A;  4GIV A;  2BGF A;  1E7P B;  3NS8 A;  1P0R A;  4ZRJ A;  1EO6 A;  4QAY A;  4HLE A;  2KFK A;  2QCZ A;  3QQ8 B;  4GOC A;  1TS5 A;  5EE0 A;  3DVN V;  3HM6 X;  1UD7 A;  1E5W A;  2IJ0 A;  3DWG C;  3H7S A;  1UF0 A;  3ZXR A;  3CST A;  2KXJ A;  3L17 A;  1R4M B;  3NVY A;  1WI0 A;  2KFK B;  5G55 A;  3D32 A;  2KJ6 A;  2PKO A;  2JRH A;  1V5T A;  3RZW C;  4IWP A;  2N4F A;  1WXQ A;  3T8M A;  1N63 A;  3DBR B;  1ZUD 2;  2JWU A;  3ZDM C;  1EUV B;  4BAX A;  2PVO D;  4W9I A;  2FAZ A;  2CS4 A;  4GDK B;  3VUX A;  3P4Q B;  5KHQ A;  1QT9 A;  2NBV B;  1E10 A;  1C76 A;  2R61 A;  1SXT A;  5LXI B;  1N61 A;  2LGX A;  3HM3 A;  4YSX B;  3RMK C;  5BMH A;  2QEJ C;  1JQ4 A;  1CK1 A;  3NHE B;  4C4V B;  4ARI A;  2R2O A;  4KX6 B;  2QMT A;  1SE2 A;  4Q2J A;  3PRE A;  1ZPS A;  3UIN B;  4AQ7 A;  1PUT A;  3QJZ A;  4REZ A;  3LDZ E;  2ZNV B;  1C4P A;  2WP9 B;  5HG2 A;  1IP9 A;  3N1Z C;  5CHV C;  3ZKJ C;  1VZ8 A;  5L83 A;  2BYV E;  3K9P B;  5BYR A;  3A4S C;  2RGF A;  2RDB C;  1UGM A;  1ZE3 D;  4K3B A;  1P3Q U;  3GE8 C;  3QIJ A;  5H92 C;  4B95 A;  1GJZ A;  3QX1 A;  1WX9 A;  3NUH B;  3WAN A;  3AEC B;  2ZNV C;  4C7Y A;  1DYQ A;  1M94 A;  3AE7 B;  1RYJ A;  1TKY A;  1R4N I;  3AE3 B;  3A9K A;  2E3T A;  1KLU D;  4B9K A;  3Q8A A;  3JW0 X;  4II2 B;  2WXP A;  2PTL A;  1GUA B;  2LGD A;  4X57 B;  4H2A A;  1I7H A;  2LGS A;  2LXC A;  5L95 C;  3WCQ A;  4A9A A;  4YXD B;  3Q14 C;  3A9K B;  2O2V A;  3B1L X;  4EKU A;  3TEX A;  3TCA A;  1K53 A;  2ZW1 A;  4MDK E;  3VUY A;  4NJ6 A;  2PVG C;  1LM8 B;  1ROE A;  2MLB A;  4DHJ D;  4LLG M;  2PE6 B;  4MSM B;  2Z0D B;  3J9C A;  5DPS A;  3ZNI D;  4KGT A;  2IY0 B;  2O2V B;  5IA7 A;  3RT3 B;  2MCN B;  5DCN A;  5G2N A;  2LVQ A;  4ANW A;  3AE4 B;  4OVV A;  3A4R A;  4W9J A;  3ZRC A;  1WJ4 A;  3Q3O C;  3SR6 A;  2FID A;  2WXR A;  2CJO A;  2MBQ A;  2ONQ A;  3A9J B;  4EUT A;  2SEB D;  2JWZ A;  3H9D A;  4WUR A;  2WXF A;  1WWT A;  4ZRK A;  4A20 A;  1FFU A;  4MEM A;  2G45 B;  1WRD B;  2KX3 A;  5IKC M;  2KC1 A;  2D10 A;  2UU7 A;  1IYF A;  4PYU A;  1FEH A;  3PTF C;  2JXT A;  3VDZ A;  4AP4 C;  3RNG C;  3BZD B;  3BK1 A;  4K7U A;  4MGK E;  1CJE A;  4WWP A;  3ML8 A;  2G4D B;  1XLO A;  2LMC A;  4AJY B;  4FHJ A;  2WU2 B;  2L0T A;  1FXI A;  3Q3F A;  4JGH B;  1WX7 A;  3KYD D;  1XCQ L;  2E6X A;  1KJT A;  4G0N B;  2C7M B;  1SJE D;  4XGA B;  3DQV A;  4YL8 A;  4ACF A;  5IP4 D;  1YQ3 B;  1CZP A;  4NQK E;  1D4B A;  1E9M A;  3AE2 B;  3KYC D;  2LJ5 A;  3X0W A;  1ESF A;  2Q5W D;  2REX A;  1YX5 B;  3V6E B;  4DHZ E;  2NVU I;  3AB5 A;  5AZF A;  4WJN A;  2AEH A;  2BT6 A;  4M02 A;  1XQQ A;  1IUE A;  4ICU A;  2JT4 B;  3ZIM A;  3ALB A;  1I4G A;  4KKJ A;  1GG3 A;  1STE A;  5E6P A;  3AE1 B;  1ZDX A;  2HDE A;  1ET6 A;  1OQQ A;  2FCN A;  3ZVV A;  4N58 A;  2IDY A;  2D3C A;  4RCO A;  1F0Z A;  5MPO A;  1WJ6 A;  2ZJD A;  1WXV A;  3AN1 A;  4W9L A;  3IAS 1;  2HE7 A;  4HXD A;  1B1Z A;  2ZPY A;  4C56 C;  3PVL A;  3H7P A;  1CMX B;  3DVG Y;  1TY0 A;  1NVI D;  5FKA C;  1FFV A;  2N1W A;  4NY0 A;  5FR3 A;  1PGB A;  2WS3 B;  2AQ1 B;  2R2Q A;  2WGS A;  3AM9 A;  5HKH A;  3B2F A;  1NBF C;  2K3U A;  4OZA A;  3L08 A;  3HVZ A;  3RPF C;  1SJH D;  2K5P A;  4ZRP A;  2KDE B;  1L0Y B;  4KSL C;  5D94 A;  3R66 C;  1L7Y A;  1OEY A;  2A5U A;  1C3T A;  2W82 A;  4IKG A;  4A6Q A;  3TBL D;  1E8Y A;  2IND C;  2LXA A;  3KUD B;  1UH6 A;  3VR8 B;  3ZYY X;  2B3A A;  1FNW A;  4PS7 A;  2YEP F;  2LVO A;  1MHX A;  1FRR A;  3AED B;  1FMA D;  1J7C A;  2KX0 A;  4WJQ A;  1SB3 C;  3NY5 A;  1JRU A;  2INN E;  1L2N A;  2L7R A;  2K8H A;  4I6L B;  1YIW A;  2AL6 A;  2C5L C;  2YEP B;  1WGH A;  3QAQ A;  3KWV A;  2AX5 A;  2KTR B;  4TQ1 A;  3ZNH B;  4GXB A;  4DDI D;  2N7J A;  3PV1 A;  4IWQ A;  2W9N A;  2ICI A;  4ZYN A;  2KDF B;  3VRB B;  2LUM A;  2OJR A;  4YWG G;  1N5W A;  1TGZ B;  2KQS A;  3LB8 C;  3E9S A;  2JSV X;  2NPT A;  1P7E A;  4NJ7 A;  1CQV A;  3ZNZ B;  4WAF A;  1GC6 A;  2HJ1 A;  1V80 A;  4CHK A;  2BS2 B;  2Y5B B;  3N9Y C;  2Y3A A;  4JWU C;  1TS2 A;  3IXS A;  3ZTC A;  4A3O A;  1JWB D;  2ON8 A;  5C2T B;  2D07 B;  1D3Z A;  4L23 A;  2KWD A;  3AXC A;  1VDV A;  4ZRI A;  1M4V A;  4EFO A;  1YN3 A;  4NQL B;  4LNI A;  2UYZ B;  2FNJ B;  2G9H D;  3CF6 E;  3ZW3 A;  2O6V D;  5D6J B;  3LYY A;  4UDU C;  3N30 A;  3ZO5 B;  2HD5 B;  5CHW A;  4XYC A;  5JHB A;  3MHS D;  1J8C A;  3UGB B;  1KM7 A;  2ZCB A;  4ANU A;  4A3P A;  1OQR A;  2BQQ A;  4JIO U;  2WU5 B;  5CHF A;  3NS1 A;  1XO3 A;  2N9P C;  4KIK A;  2J0J A;  1Q5W B;  1E7U A;  2D3G A;  4DQO C;  5E6N A;  2MWS B;  4GMV A;  1K8R B;  1KF6 B;  1GB4 A;  3U8Z A;  2JXX A;  4LNN A;  2CU1 A;  4G3X B;  4BKS D;  2N1V A;  4KIK B;  1KOT A;  4FJY A;  2MX2 A;  2KNB A;  5AUI A;  3VXW A;  2KN5 A;  1T3Q A;  2MQJ A;  1AAR A;  1E7V A;  3W5U B;  2W3R A;  4RMA A;  4M00 A;  2PIA A;  3CWI A;  2DNF A;  2WWZ A;  2KAC A;  1WR6 E;  3MC8 A;  4W9H A;  2L32 A;  5BMI A;  2BB6 A;  3Q8E A;  1V86 A;  1DOI A;  2BPS A;  1H8C A;  4GDL B;  3P4R B;  2I1K A;  2IO2 B;  2OHF A;  2AQ2 B;  3H8H A;  3HRD D;  4YT0 B;  1NEK B;  4BBN C;  2DBY A;  1LQB A;  5HI1 A;  4BFR A;  4K7W A;  2LJI A;  4K81 A;  2GBJ A;  3PRP B;  4K3C A;  4RNA A;  4ZDV A;  1NEN B;  5D7G A;  3V61 A;  1GAQ B;  2FCQ A;  4XWW A;  3EGR A;  3W9C B;  2D3B A;  3AE8 B;  4RGN A;  5JXV A;  3S2A A;  2FUG 1;  2RDG A;  2L00 B;  1YQ4 B;  3P1M A;  2JZZ A;  2WXO A;  3ZXV A;  3VH3 B;  4KKI A;  1SE9 A;  5DPR A;  1E8X A;  2KK8 A;  4NNJ B;  2D2Q A;  4FA6 A;  5IOI A;  2KJH B;  1KTK A;  2IGH A;  2V9H A;  4DWF A;  1TIF A;  3AE6 B;  1ZXH A;  1YX6 B;  3AV8 A;  5FK9 C;  3ABV B;  2V3P A;  3Q69 A;  3KH0 A;  1KLV A;  1YMH E;  3U52 E;  2ZW0 A;  3DWM A;  4GDK A;  3URY A;  2BBC A;  3IG3 A;  1YN5 A;  2JYE A;  1XF5 L;  2L83 A;  2IGG A;  3TIX A;  2MRP A;  1VZ6 A;  3EUB 2;  4CYE A;  3VH4 B;  4MGI E;  1E8Z A;  1FNU A;  3GP7 A;  3MHZ A;  1E6E B;  2DX5 B;  3Q8B A;  4YTN B;  4C4V A;  4A8X C;  3HIZ A;  4HJK A;  3W2D A;  2FUH B;  1VRA B;  2WXH A;  4RFB A;  1PFD A;  1K52 A;  3W1Y A;  5BYQ A;  1U4A A;  1TY2 A;  2WXG A;  2BYT A;  3I9V 1;  2KAJ A;  4GGQ A;  3PSE B;  3UIP B;  1LFD A;  5C3J B;  2ZPN A;  4ZHO A;  4G11 A;  1QOA A;  1EF1 A;  3IT6 B;  1FCC C;  2DLB A;  1TYG B;  3ONS A;  3I63 C;  3RN9 C;  1TKE A;  3DBS A;  2A4Z A;  4LNK A;  1Y8R C;  1P1A A;  2V3S A;  4L1B A;  1B9R A;  1LO5 D;  1Q1O A;  2J52 A;  3CMM B;  1UBQ A;  1XCT L;  3SFE B;  4MGZ E;  3EC8 A;  2ZVO A;  4N6E B;  2EMS A;  1LXD A;  1Q0W B;  2N0S B;  1AWD A;  5FR6 A;  1EM7 A;  1PQS A;  3DHG C;  3PRZ A;  2EEL A;  3VUW A;  2CHW A;  2MEK A;  3PZ8 A;  1TT5 B;  2DYM A;  4HK2 A;  2IBI B;  1SGH A;  5HFY A;  1ACC A;  2PW9 A;  3NVV A;  4JWS C;  2MBO A;  4KVG B;  1PDX A;  3Q3J A;  1JWS D;  1HXY D;  1N62 A;  1J7B A;  1J0G A;  3JSV A;  1UUP A;  4J3O D;  3B9J A;  4DHZ B;  2KVZ A;  2HTH A;  2XN9 C;  4P16 A;  3TUO A;  1T0S C;  3AI5 A;  1RLF A;  2K39 A;  2QIE B;  3A9J A;  2C7N B;  4E71 A;  4PS8 A;  2WXI A;  5AUK A;  3JSV B;  3AEA B;  1MHH E;  4JLC A;  1UWM A;  3RNE C;  2GBR A;  2X38 A;  1PGX A;  3A1Q B;  2M4N A;  2J42 A;  3RNF C;  2KO3 A;  2W54 A;  3RNC C;  5IO9 A;  3RI7 C;  2VH1 A;  2VZK B;  2IO0 B;  2UWQ A;  1V49 A;  1ZOY B;  3BWU D;  2N7E A;  3L13 A;  1AYF A;  4GN1 A;  4WQM A;  1A70 A;  3IFW B;  4I6N B;  1YJ1 A;  2OOB B;  2PMV A;  2RMM A;  1OTR B;  1E90 A;  2WXL A;  2KQ4 X;  4WIP A;  4ANX A;  2JPH A;  1QLB B;  4YTM B;  4MAC A;  4GU2 A;  5G5H A;  2QIL A;  2H89 B;  1WXS A;  3AEB B;  1WFY A;  2WDV B;  3ECI A;  2EMT A;  3T3N A;  1KH0 A;  3WAO A;  2NCN A;  2QDF A;  2C9W B;  2NBW B;  4LJP B;  2KN4 A;  5I4D A;  2W55 A;  1HZ5 A;  1HEZ E;  1P98 A;  4PYZ A;  5J17 A;  2BB5 A;  4DHJ B;  1WSP A;  1QIL A;  3NRZ A;  3HK0 A;  4OW0 A;  4KGS A;  2LHE A;  4AUQ C;  2NS5 A;  3DCG A;  3PO0 A;  1ZW7 A;  2DWQ A;  2LAS A;  2KJR A;  1JWU D;  1X1M A;  2AQ3 B;  2MJ3 A;  4XWT A;  1Z5S B;  4WWM A;  3WAP A;  1Q10 A;  4FHK A;  4XDD A;  1UNS A;  1WYG A;  3Q6B A;  1JWA D;  2WQY B;  2H88 B;  1YQB A;  4E74 A;  3TMP B;  2WDR B;  4W9F A;  2WLB A;  1HQR D;  3KW5 B;  1BUI C;  2N9E B;  3QC8 B;  1SBB B;  4OZC A;  2VRR B;  3RNA C;  1ZKH A;  2RPV A;  3PGE A;  5E6J A;  3EHV A;  2RR9 A;  2X8X X;  4KZC A;  1V8C A;  4RF1 A;  1WZ0 A;  2FCS A;  3MC9 A;  5T8I A;  4OHJ A;  1WE6 A;  4FXC A;  1I4H A;  2N7D A;  3ZLZ A;  1C78 A;  4JX1 C;  3DHI C;  1FPY A;  1C4C A;  1EWC A;  2MBB B;  3L0W B;  2CHX A;  2JY6 A;  2MJD A;  3V05 A;  3O65 B;  3PZD A;  4TSS A;  2RDH A;  1FO4 A;  1JML A;  2KQ7 A;  2OED A;  4IC7 B;  1JRO A;  1FIQ A;  5CTR C;  1WH3 A;  2BF8 B;  2WXK A;  3FAH A;  3T9L A;  3MP9 A;  4ZYS A;  3KWL A;  3UI3 A;  1L6U A;  2BWE S;  3ZJT A;  3ENE A;  2IYD B;  2W3S A;  2LHD A;  2GLS A;  4W9E A;  2TSS A;  3TJP A;  1FD6 A;  2NR2 A;  1XLP A;  1V2Y A;  2FBW B;  2IPK D;  4PT5 A;  4HRS A;  1D5M C;  2ASQ A;  1NYQ A;  1WGR A;  2LVP A;  4P1B C;  1C1Y B;  1F52 A;  1WXA A;  1IGD A;  2KDM A;  3GS2 A;  3R3M A;  2V1Y A;  3SU8 X;  4S0R A;  1GOZ A;  3C8Y A;  2KTR A;  3VHT C;  2BVC A;  1ENF A;  4MGY E;  4MM3 A;  4NJC A;  3GOE A;  4LDT B;  3IVF A;  4EZK A;  1L5P A;  2GBM A;  2JVC A;  1YN4 A;  2DYO A;  4HPP A;  1TS4 A;  3PHW B;  4NAM A;  3M95 A;  2MP2 A;  3RUI B;  3SD5 A;  1BT0 A;  3Q3M C;  4HRO A;  5AZH A;  3BIN A;  4MM3 B;  2KOX A;  4ICV A;  4NAW A;  1VD2 A;  4HKZ E;  3P63 A;  2EKI A;  4KDL B;  4RGT A;  4HVB A;  1JRP A;  2KMM A;  2MP2 B;  4W9G A;  2BTE A;  2BW2 A;  2L3Z A;  1JWM D;  3NOB A;  3AU5 A;  3R7Q A;  3KUC B;  4NAW B;  2CR5 A;  2LD9 A;  3DHH C;  4JQW C;  1MG8 A;  2G3Q B;  1SE3 A;  1OEY J;  4GB9 A;  3QA8 A;  1KLG D;  1TJE A;  3GE3 C;  5J18 A;  2JU6 X;  4US9 A;  1VLB A;  3RZF A;  2HTM E;  2WX1 A;  5DPT A;  2WXN A;  3PPA A;  3U30 A;  3OJ3 A;  1Z2M A;  5TR5 A;  3PS6 A;  3FIL B;  3NZ3 A;  2AYO B;  1GPX A;  2RD0 A;  5AEK B;  3MJ5 A;  4IG7 B;  1MG4 A;  2BKR B;  4FJZ A;  4EOY A;  3B0A A;  1SE4 A;  2LGI A;  3Q8F A;  3U2S C;  2CHZ A;  4KDI C;  2JRI B;  3U7Z A;  4OVU A;  3C19 A;  2GRI A;  4R3D A;  3QAR A;  1FNV A;  2ZCC A;  2Y5P A;  3NJT A;  3P4S B;  3VTU A;  4PS3 A;  3QHT A;  1ISN A;  2CKH B;  4P1C C;  1RM6 C;  2D3A A;  2JQR B;  3EEC A;  3WAL A;  2WHI A;  4XZ4 A;  4P6V F;  2Z8L A;  3DPD A;  2K1F A;  2K0P A;  4N9F 4;  4GDL A;  3AEG B;  3VAW A;  3TEZ A;  4URK A;  4ITK A;  3RUL A;  1FXT B;  1HE8 A;  1I4R A;  5JHA A;  1OQY A;  4BKT A;  3VVW B;  2N9L A;  2FE8 A;  2MHJ A;  4KZ0 A;  5JZE B;  3L54 A;  4IM0 A;  3U4E G;  2BS3 B;  1SIF A;  3BVG A;  4WQO B;  1WE7 A;  2DAJ A;  1F2R I;  3B2G A;  1FCL A;  1R7S A;  2KDI A;  2V3N A;  2GBN A;  2ACZ B;  4HPL B;  2GMI C;  2K8B A;  2INP E;  4DK5 A;  2KMA A;  4G50 A;  3L16 A;  3BVM A;  3H1U A;  2WYQ A;  3TEY A;  2J0K A;  4EZL A;  3TSS A;  4HCN B;  2C60 A;  4XC2 A;  1V97 A;  3TL5 A;  1T0R C;  1I4P A;  3I3T B;  3VTW A;  3SFD B;  3UQB A;  1WIA A;  4CO7 A;  2KZR A;  1WGD A;  1EU4 A;  3P42 A;  5EE1 A;  2CU3 A;  3WA0 A;  2M17 A;  2ZVN A;  1C77 A;  2M1M A;  4II3 B;  4DXA B;  1EU3 A;  3ZJV A;  1EF5 A;  2DZI A;  1MFW A;  3AH7 A;  1ZP0 B;  4ANV A;  1N60 A;  4HKQ A;  1J19 A;  1AW7 A;  1PYW D;  2I38 A;  3U7D A;  2WDT B;  3OAW A;  4JL9 A;  3GB1 A;  4IOI E;  4FAD A;  1WJU A;  3ZTD A;  1E8W A;  2D5G A;  2DHZ A;  3W1S A;  2NTS A;  1SSN A;  2N9X A;  2PJH A;  1RAX A;  4W9K A;  4DXF A;  1UGJ A;  3P4P B;  2GBK A;  1TTN A;  2LGY A;  2WXQ A;  2DZJ A;  2YVC A;  2AWT A;  1P7F A;  1UEL A;  3N1X C;  3M62 B;  4HPM B;  2C7H A;  3OWE B;  3L4P A;  4USA A;  3MFG A;  3GZN I;  4IM2 A;  2MW5 A;  3UIO B;  1J7A A;  3DBL B;  5AZG A;  1XT9 B;  1HA5 A;  2J0M A;  1XD3 B;  3FC4 A;  3WIM A;  4DBG A;  4C80 A;  1WMH A;  3V60 A;  3NZS A;  4KV2 A;  4GSW A;  2Z59 B;  1GNU A;  1VR9 A;  2DAF A;  1YD8 U;  3W1S C;  4M0W A;  2CJN A;  4TQ0 A;  4MEL A;  2G4S A;  1T6B X;  2V4I B;  4KSK C;  3ZDT A;  4I6P A;  1WMH B;  3R8B A;  4EE2 A;  1YJI A;  2XBB C;  2BYF A;  2V4L A;  5D3I B;  2KYW A;  4M0W B;  4O1N A;  3X23 A;  1NYR A;  4RF0 A;  1L0V B;  2BYE A;  4XX5 A;  1JAL A;  1LGR A;  4IM3 A;  3EFC A;  1SEB D;  4WAA A;  4P7I A;  1WGK A;  1DOX A;  4B0E A;  3ZQ4 A;  2GB1 A;  3VR9 B;  2MBE A;  4IWO A;  1SIJ A;  2K25 A;  4LJO B;  1MI0 A;  4HCP B;  2VZK D;  3NZU A;  3PT2 B;  4US8 A;  1YNT E;  2L76 A;  4D2K A;  1TKG A;  1K50 A;  3ZGZ A;  1A5R A;  3PLU A;  4GLS C;  3EFU A;  3A1Q A;  4FUL A;  3W5V B;  2M19 A;  1RFA A;  3UF8 A;  1ZGU B;  3AUL A;  3M63 B;  4DDG D;  4XE0 A;  3VQI A;  3SEB A;  4ZRQ A;  2MA9 B;  4B0M A;  2LUE A;  5D2M B;  3IHP C;  4RGM A;  1E0Z A;  4LTU A;  3A33 B;  1C79 A;  5EE3 A;  2MBH A;  4RM9 A;  3OJ4 B;  3N32 A;  5BYS A;  2L52 A;  1IGC A;  3APD A;  2K6D B;  1V5O A;  2K8C A;  4XDC A;  4YSY B;  5IAA C;  1D6E C;  2IY1 B;  3EA6 A;  5H8Y E;  4IW0 A;  1IBX A;  4IUM B;  4AWJ A;  4K1R B;  2I2Y A;  1TS3 A;  3DVG X;  1K51 A;  2KVR A;  4TKN A;  4M01 A;  4WWO A;  3KLS X;  4BZA A;  2K9X A;  2LRW A;  1WJN A;  1Y56 A;  2GI9 A;  3N20 C;  2L0F A;  1IBX B;  1MVK A;  1WYW B;  3R2I A;  3IT4 B;  3Q3N C;  3KVF B;  3PZ7 A;  1WRI A;  1I42 A;  4TUU A;  3DBH B;  1WGG A;  4ZHP A;  4YSZ B;  2KT7 A;  4W9D A;  4BOZ B;  2KWC A;  4BKG A;  3LJ3 A;  2DZM A;  2QHO A;  1WXM A;  1D5Z C;  2JX5 A;  4HJG E;  3P2B A;  3B08 A;  4B6W A;  5DPW A;  2J7Q B;  5GXG B;  1KRH A;  2VH2 A;  1KFY B;  3RCZ A;  3H6N A;  3HHM A;  1MJD A;  1DOY A;  2JF5 A;  1UZX B;  1JW9 D;  2ZEQ A;  5IN7 A;  3QWZ B;  3BII D;  3HUI A;  1DGJ A;  2BS4 B;  1YOV B;  3ZJU A;  1WY8 A;  3SDL C;  1RFK A;  2MH7 A;  3JVZ X;  3T3O A;  4M8M A;  2L05 A;  4AJW A;  3BY4 B;  5E6O A;  1QF6 A;  4NPN A;  2Y5C A;  2XEW A;  2FCM A;  3AEE B;  1I4Q A;  2IGD A;  1F2R C;  1JCK B;  4MSQ B;  3RYT A;  2QJL A;  2LRU A;  1RWS A;  2KLG A;  1T5X D;  1S3S G;  1BML C;  2BWF A;  4C00 A;  2MSE D;  3AE5 B;  4C7Z A;  1WX8 A;  4L2Y A;  3VFK A;  1IPG A;  3V6C B;  3KUZ A;  3WAM A;  5D3D A;  1UWX A;  1XLQ A;  3CSF A;  2LEK A;  2KAN A;  3V3X A;  2WNM A;  4HEA 1;  3ML9 A;  4LNF A;  1V1O A;  2L8J A;  1TBE A;  2JZ3 B;  1NDD A;  2IO3 B;  5G5G A;  3RNB C;  1ZDV A;  3KQ4 A;  5J2R A;  3NVZ A;  1VCB A;  3BYT B;  1XLN A;  2QSD A;  3DDC B;  4DXG A;  4J6I A;  2FIF A;  3N3K B;  4MH0 E;  5GMV A;  1QOF A;  1WGY A;  4HWI B;  4MH8 A;  2RPQ A;  4LDT D;  3H7P B;  1R4M I;  4F8C B;  3OG5 A;  5BMG A;  5CX3 A;  4JPS A;  2Z0E B;  2WDQ B;  3I57 A;  3VTV A;  1NI2 A;  3APC A;  1SF0 A;  3JYU A;  4IDI A;  2V0G A;  3DBR I;  2KWV B;  3NG0 A;  2RSU A;  4YTP B;  2WXJ A;  2I1J A;  2M0X A;  4FN2 A;  1WR1 A;  3GZN B;  2PLP A;  2HJ8 A;  4WWN A;  2DZK A;  3DBL I;  2AL3 A;  2NTT A;  1V81 A;  2N9K A;  2KMC A;  1S1Q B;  3MTN B;  3RD2 A;  3ZUN A;  2KD0 A;  1TZO A;  4MJS A;  4NZL B;  3OLM D;  1L6V A;  1L4D B;  4OZB A;  2DYB A;  5LLI A;  5EDS A;  4FLH A;  3DVN U;  1QKZ A;  4CQN A;  3LXF A;  1YJJ A;  4ASW C;  1F1H A;  2NBU A;  1V1P A;  1MPE A;  4MJS B;  2WX0 A;  2KTF A;  4HDQ A;  1QZE A;  3K9O B;  1I4X A;  2GOW A;  4WJO A;  2BKF A;  2YLM A;  1V6E A;  1OFF A;  2WXM A;  1P9D U;  4EEW A;  3O13 A;  1G6J A;  2LWP A;  3C0R B;  1TZ1 A;  3NVW A;  1HTO A;  1V1P B;  3N1Y C;  2J53 A;  2XK5 A;  3Q2A C;  2JZP A;  2OJW A;  1F77 A;  1BXT A;  2K6Q A;  3I5J C;  2EKE C;  2M8S A;  1PGA A;  1AN8 A;  4ZOH C;  3APF A;  4K7S A;  4LNO A;  2XK5 B;  4F1S A;  1D5X C;  3L10 B;  3R2T A;  1OGW A;  3UQA A;  5HHD G;  1R4N B;  4FBJ B;  3MC0 B;  3BK2 A;  3AEF B;  3QCA A;  3FIL A;  3AMZ A;  2PE9 A;  1HZ6 A;  4ARC A;  2B76 B;  1GB1 A;  2M56 B;  2INC C;  1EWY C;  2L1A A;  2PPH A;  5LXH A;  2XNA C;  3Q8C A;  2KKC A;  2NPT B;  2MJE A;  1VZ7 A;  2DEN B;  2K22 A;  2NMQ A;  5TSS A;  3M3J A;  1WZ3 A;  2JUO A;  2KDB A;  3VRA B;  2JYT A;  2KLC A;  5C23 A;  4HDO A;  3E56 A;  5BO4 B;  4BBN F;  4WH4 A;  2PEA A;  4LK0 M;  3ZNG C;  3PHX B;  3QK0 A;  3FKY A;  2KC2 A;  1UBI A;  3BYY B;  2O6V A;  4RH6 A;  2KWU B;  1T0Q C;  2QC8 A;  4MT5 A;  4KGR A;  1RRB A;  3BVZ A;  1WM2 A;  1I35 A;  1H4R A;  1VJK A;  3MJW A;  1FXA A;  2SAK A;  1C9F A;  4FJV B;  4N59 A;  4WJP A;  1QOB A;  3PLV A;  2IO1 B;  4W9C A;  1QQR A;  2O6V B;  2KFJ A;  5C1Z A;  3DBH I;  3PRM B;  2J4X A;  3R7R A;  1WF9 A;  1L0X B;  2KHW B;  3DOW A;  2M0A A;  4TV3 A;  1XXG A;  4OVZ A;  3SHQ A;  2D11 A;  3AE9 B;  4JE3 B;  3IBE A;  4BKS A;  4A90 A;  1FRD A;  1ET9 A;  1V9J A;  5EE9 A;  2ZZP B;  5JH5 C;  3HVD A;  1QOG A;  4RGO S;  1GC7 A;  4RM8 A;  4BOS C;  4BVU C;  1N5X A;  3RFZ B;  1FM0 D;  5KHO A;  4PK1 A;  4AS1 A;  4EZJ A;  1WM3 A;  4AOF A;  1C4A A;  1XEE A;  2LFI A;  4F7Z A; 
#chains in the Genus database with same CATH homology
 3ETR A;  4RF0 A;  1L0V B;  4A55 A;  1JWA D;  1JAL A;  3VRB B;  1SEB D;  2WQY B;  2H88 B;  2LUM A;  1WGK A;  1DOX A;  4B0E A;  1L4Z B;  4YWG G;  3ZQ4 A;  1N5W A;  2GB1 A;  3CIR B;  2WDR B;  3LB8 C;  3VR9 B;  5LNK 1;  3E9S A;  3IAM 1;  1SIJ A;  2JSV X;  1HQR D;  1MI0 A;  2WLB A;  1P7E A;  1CQV A;  4WAF A;  2VZK D;  1BUI C;  2BS2 B;  1SBB B;  4US8 A;  4OZC A;  1YNT E;  3N9Y C;  4D2K A;  1ZXI A;  2RPV A;  2Y3A A;  1TKG A;  4JWU C;  1K50 A;  1TS2 A;  5E6J A;  3ZGZ A;  3IXS A;  4YTM B;  1V8C A;  4RF1 A;  4GLS C;  2G1E A;  1JWB D;  1NI3 A;  2ON8 A;  4TMA B;  5C2T B;  3TEW A;  4L23 A;  2KWD A;  3W5V B;  1VDV A;  1E7P B;  1M4V A;  5T8I A;  1YN3 A;  4OHJ A;  4FXC A;  2M19 A;  1I4H A;  2G9H D;  1C78 A;  4JX1 C;  1C4C A;  4XE0 A;  1TS5 A;  1EWC A;  3SEB A;  3VQI A;  5EE0 A;  4ZRQ A;  2MJD A;  4B0M A;  3LYY A;  4RGM A;  3V05 A;  4UDU C;  1E0Z A;  4LTU A;  2IJ0 A;  3DWG C;  4TSS A;  2RDH A;  1C79 A;  5EE3 A;  1FO4 A;  1JML A;  2OED A;  3NVY A;  1JRO A;  5BYS A;  2L52 A;  1IGC A;  1FIQ A;  2PKO A;  1OQR A;  2WU5 B;  2WXK A;  3NS1 A;  1XO3 A;  4XDC A;  3FAH A;  3MP9 A;  4YSY B;  4ZYS A;  3KWL A;  1WXQ A;  1N63 A;  3UI3 A;  1L6U A;  1D6E C;  4DQO C;  1ZUD 2;  3ZJT A;  2JWU A;  3EA6 A;  5H8Y E;  2W3S A;  1IBX A;  2LHD A;  1KF6 B;  2TSS A;  2PVO D;  1GB4 A;  4GDK B;  1FD6 A;  1XLP A;  2FBW B;  2IPK D;  2I2Y A;  4PT5 A;  1TS3 A;  4HRS A;  1D5M C;  3P4Q B;  1K51 A;  1NYQ A;  3KLS X;  1QT9 A;  1E10 A;  2K9X A;  1C76 A;  2R61 A;  1SXT A;  5AUI A;  1Y56 A;  1N61 A;  2GI9 A;  1IGD A;  4YSX B;  2KDM A;  1T3Q A;  3GS2 A;  1IBX B;  1MVK A;  5BMH A;  3W5U B;  2QEJ C;  2W3R A;  3R2I A;  1JQ4 A;  3IT4 B;  1GOZ A;  1CK1 A;  3C8Y A;  4ARI A;  2PIA A;  3CWI A;  3PZ7 A;  1WRI A;  2QMT A;  4KX6 B;  1SE2 A;  4Q2J A;  4ZHP A;  1ZPS A;  2KAC A;  4YSZ B;  1ENF A;  4NJC A;  4AQ7 A;  1PUT A;  2L32 A;  4REZ A;  2BB6 A;  1L5P A;  3Q8E A;  5BMI A;  1DOI A;  1D5Z C;  1C4P A;  2JX5 A;  1YN4 A;  2DYO A;  4GDL B;  2WP9 B;  3P4R B;  4HJG E;  1TS4 A;  5HG2 A;  2OHF A;  2AQ2 B;  4NAM A;  3H8H A;  5GXG B;  1KRH A;  1VZ8 A;  3HRD D;  4YT0 B;  1NEK B;  1KFY B;  2DBY A;  4HRO A;  5HI1 A;  1DOY A;  4MM3 B;  1JW9 D;  5BYR A;  2LJI A;  3BII D;  3HUI A;  1ZE3 D;  4HKZ E;  1DGJ A;  3P63 A;  2BS4 B;  2EKI A;  4RGT A;  1JRP A;  5H92 C;  3ZJU A;  4RNA A;  1RFK A;  2MH7 A;  2KMM A;  3T3O A;  1NEN B;  5D7G A;  1GAQ B;  1QF6 A;  4XWW A;  3EGR A;  3W9C B;  2BTE A;  2BW2 A;  2Y5C A;  1JWM D;  3NUH B;  3AE8 B;  3AEE B;  1I4Q A;  2IGD A;  1F2R C;  1JCK B;  4RGN A;  5JXV A;  2FUG 1;  3AEC B;  4NAW B;  4C7Y A;  1DYQ A;  2QJL A;  2RDG A;  1RWS A;  1T5X D;  1BML C;  1RYJ A;  1TKY A;  1YQ4 B;  3AE7 B;  3AE3 B;  3AE5 B;  3P1M A;  2WXO A;  1SE3 A;  2E3T A;  4C7Z A;  1KLU D;  4L2Y A;  1KLG D;  3Q8A A;  4KKI A;  1TJE A;  2JU6 X;  4US9 A;  5D3D A;  1UWX A;  1VLB A;  1XLQ A;  2WXP A;  2LEK A;  2PTL A;  1KTK A;  2HTM E;  3V3X A;  4H2A A;  1I7H A;  2WNM A;  4HEA 1;  2IGH A;  2WXN A;  1V1O A;  3WCQ A;  4A9A A;  4YXD B;  5G5G A;  1ZDV A;  3KQ4 A;  3TEX A;  3NVZ A;  3BYT B;  1K53 A;  1XLN A;  2ZW1 A;  3AE6 B;  2QSD A;  1ZXH A;  4DXG A;  3AV8 A;  5FK9 C;  3ABV B;  3FIL B;  2V3P A;  3Q69 A;  2PVG C;  3NZ3 A;  1ROE A;  4LLG M;  1GPX A;  1QOF A;  1YMH E;  3J9C A;  3U52 E;  3MJ5 A;  4KGT A;  2ZW0 A;  3DWM A;  3URY A;  2BBC A;  4MH8 A;  3AE4 B;  1YN5 A;  2JYE A;  1SE4 A;  5BMG A;  2LGI A;  3Q8F A;  4JPS A;  3U2S C;  1XF5 L;  2L83 A;  2IGG A;  2WDQ B;  1VZ6 A;  3EUB 2;  3I57 A;  3U7Z A;  3SR6 A;  1FNU A;  1SF0 A;  2GRI A;  1FNV A;  4IDI A;  4R3D A;  2WXR A;  2CJO A;  2Y5P A;  3P4S B;  3GP7 A;  2ONQ A;  3MHZ A;  1E6E B;  2V0G A;  2SEB D;  3Q8B A;  4YTN B;  4A8X C;  1RM6 C;  2JQR B;  4WUR A;  2WXF A;  3W2D A;  4YTP B;  2WXJ A;  1WWT A;  1VRA B;  2WXH A;  4RFB A;  1FFU A;  1PFD A;  4P6V F;  2Z8L A;  2PLP A;  1K52 A;  2K0P A;  5BYQ A;  1TY2 A;  2WXG A;  2BYT A;  2NTT A;  3I9V 1;  2KAJ A;  2N9K A;  3AEG B;  1FEH A;  3TEZ A;  2JXT A;  1TZO A;  4ITK A;  5C3J B;  3BZD B;  4NZL B;  3BK1 A;  1L6V A;  4ZHO A;  1QOA A;  1CJE A;  1L4D B;  4OZB A;  1I4R A;  1XLO A;  3IT6 B;  2LMC A;  1FCC C;  2DLB A;  1TYG B;  2N9L A;  2FE8 A;  2WU2 B;  1QKZ A;  3U4E G;  3LXF A;  4CQN A;  1FXI A;  1YJJ A;  1TKE A;  2BS3 B;  3BVG A;  1V1P A;  1MPE A;  1XCQ L;  1F2R I;  2E6X A;  1SJE D;  3B2G A;  1FCL A;  1R7S A;  1I4X A;  2V3N A;  4L1B A;  1B9R A;  2ACZ B;  1YQ3 B;  1OFF A;  2WXM A;  2INP E;  1LO5 D;  3O13 A;  1CZP A;  2J52 A;  1D4B A;  1E9M A;  3AE2 B;  3NVW A;  1ESF A;  1XCT L;  2Q5W D;  3SFE B;  1V1P B;  3AB5 A;  3BVM A;  2J53 A;  2JZP A;  1F77 A;  4N6E B;  3TEY A;  1BXT A;  2BT6 A;  2N0S B;  1IUE A;  1AWD A;  3TSS A;  1EM7 A;  1PGA A;  1V97 A;  1AN8 A;  1I4G A;  4KKJ A;  1I4P A;  1STE A;  4ZOH C;  2EEL A;  3SFD B;  2MEK A;  3AE1 B;  3PZ8 A;  1ZDX A;  2HDE A;  2DYM A;  1ET6 A;  1EU4 A;  1OQQ A;  1D5X C;  3P42 A;  4N58 A;  2IDY A;  3R2T A;  4RCO A;  5HHD G;  5EE1 A;  5HFY A;  2CU3 A;  1ACC A;  1F0Z A;  5MPO A;  3MC0 B;  3BK2 A;  3AEF B;  3AN1 A;  3FIL A;  2PW9 A;  3AMZ A;  3IAS 1;  1C77 A;  1HZ6 A;  3NVV A;  2B76 B;  4JWS C;  4ARC A;  1GB1 A;  2M56 B;  1EWY C;  1PDX A;  1JWS D;  1HXY D;  2L1A A;  1B1Z A;  1N62 A;  1EU3 A;  4C56 C;  1J7B A;  3ZJV A;  1UUP A;  4J3O D;  3B9J A;  2XNA C;  3AH7 A;  1ZP0 B;  1TY0 A;  1N60 A;  3Q8C A;  4HKQ A;  1NVI D;  2MJE A;  1VZ7 A;  2XN9 C;  4P16 A;  5FKA C;  1FFV A;  3TUO A;  1AW7 A;  1PYW D;  2I38 A;  5FR3 A;  1PGB A;  2WS3 B;  3GB1 A;  4IOI E;  2QIE B;  2AQ1 B;  2K22 A;  2NMQ A;  5TSS A;  2WXI A;  3AM9 A;  5AUK A;  3AEA B;  3B2F A;  2D5G A;  1MHH E;  3VRA B;  3W1S A;  2K3U A;  4OZA A;  1UWM A;  2JYT A;  2NTS A;  2X38 A;  3HVZ A;  1SSN A;  1PGX A;  2J42 A;  3RPF C;  1SJH D;  2K5P A;  2W54 A;  4ZRP A;  3E56 A;  1L0Y B;  4DXF A;  1UGJ A;  2VZK B;  4WH4 A;  3P4P B;  4LK0 M;  1ZOY B;  3BWU D;  2WXQ A;  1AYF A;  4WQM A;  1A70 A;  2W82 A;  1P7F A;  2PMV A;  4IKG A;  2RMM A;  3BYY B;  4RH6 A;  3OWE B;  2WXL A;  3L4P A;  4A6Q A;  2KQ4 X;  4WIP A;  1QLB B;  4USA A;  4MT5 A;  3MFG A;  4KGR A;  3VR8 B;  4MAC A;  3BVZ A;  5G5H A;  2QIL A;  3ZYY X;  2H89 B;  1VJK A;  3AEB B;  1FNW A;  2WDV B;  1J7A A;  1FXA A;  2SAK A;  1C9F A;  3T3N A;  1KH0 A;  4N59 A;  1QOB A;  2YEP F;  1HA5 A;  1QQR A;  1MHX A;  1FRR A;  3AED B;  2KN4 A;  3FC4 A;  5I4D A;  2W55 A;  4C80 A;  1FMA D;  1J7C A;  1HZ5 A;  2J4X A;  1HEZ E;  1L0X B;  1SB3 C;  2BB5 A;  1WSP A;  2M0A A;  1XXG A;  1QIL A;  1VR9 A;  4OVZ A;  2INN E;  3NRZ A;  3AE9 B;  4M0W A;  2CJN A;  4OW0 A;  4TQ0 A;  4JE3 B;  4KGS A;  2LHE A;  3PO0 A;  4A90 A;  1FRD A;  1T6B X;  2DWQ A;  2V4I B;  1ET9 A;  5EE9 A;  3HVD A;  1QOG A;  1JWU D;  4RGO S;  2YEP B;  2AQ3 B;  3R8B A;  2MJ3 A;  3KWV A;  1YJI A;  4EE2 A;  2AX5 A;  4TQ1 A;  4XWT A;  1N5X A;  3RFZ B;  1FM0 D;  4WWM A;  2N7J A;  5D3I B;  4AS1 A;  1Q10 A;  4XDD A;  4O1N A;  1C4A A;  1XEE A;  2LFI A;  1NYR A;  1UNS A;  1WYG A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...