2LJIA

Structure of a protein from haloferax volcanii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title Structure of a protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 5
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ljiA00
2LJIA 2L32A
chains in the Genus database with same CATH superfamily
1PQSA 1WXQA 4YXDB 1WXAA 4FADA 3W5UB 2W3SA 4ANWA 3QX1A 1L6UA 4WAFA 3KYDD 4CYEA 2CHZA 2V3SA 4EZJA 2QJLA 1E7UA 1JRUA 2MQJA 2QC8A 1XEEA 3VHTC 3AEDB 2INDC 1E8WA 2MA9B 2NTSA 2UU7A 3O13A 4EFOA 3BINA 1ZXIA 1WZ0A 1G6JA 3KH0A 2LD9A 3H1UA 4MELA 1B9RA 3AECB 4AUQC 3Q8EA 3NOBA 2INPE 2ZZPB 2LEKA 1QILA 4HRSA 2BKFA 3PT2B 1XLNA 4YTNB 1N62A 3NZUA 2IJ0A 4JQWC 3RNBC 1E7VA 3AE7B 3DCGA 5JXVA 3KUDB 1T5XD 2MW5A 1N60A 2FBWB 4F7ZA 1YOVB 3H7SA 1ACCA 2ON8A 1LO5D 1WM3A 3ZNHB 2V3NA 3Q3FA 1P7FA 4ZYNA 2IPKD 2K5PA 4OVVA 3BK2A 1Z5SB 2KN4A 4ZHOA 3ML8A 4GDKA 4REZA 3VAWA 3AH7A 1C77A 4I6LB 1P98A 1I35A 2ONQA 1QZEA 1JRPA 2KFKA 4MSQB 2E6XA 2HE7A 4DXAB 1SGHA 5L83A 3PRPB 1TGZB 2KO3A 2ZEQA 3DWGC 2A4ZA 3IFWB 4N9F4 4WJOA 5EDSA 2ZVNA 3BVGA 2VH2A 3QA8A 1D5ZC 4OVUA 2UYZB 2LI5A 3Q8CA 1PGAA 1XXGA 3IT6B 4IKGA 3IBEA 4L23A 2K3UA 5D3DA 1ZXHA 4JWSC 3MC0B 2EKIA 2J52A 2M56B 3WAMA 3N9YC 4MH8A 3SU8X 4N59A 4J6IA 1TYGB 3DBHB 3SFDB 3U2SC 1P1AA 1KJTA 4QAYA 1Q5WB 1UGJA 4BKGA 2QSDA 3A33B 3MJWA 1WX8A 1VZ6A 5CHVC 1OQYA 1TZ1A 4ZHPA 4EUTA 2TSSA 2KOXA 1XF5L 3AE3B 3IHPC 5C2TB 4TQ1A 2RMMA 4M02A 4TV3A 4XYCA 2L32A 4HDOA 4HPPA 4G11A 4HPLB 5IAAC 4UDUC 1MI0A 4LLGM 4CO7A 3APFA 4IOIE 4KV2A 4HCPB 4BKSD 1AWDA 1YN4A 4W9FA 1WE6A 3R66C 2D3BA 2MSED 3CIRB 2PJHA 4XZ4A 1SE3A 2JRHA 4MSMB 2KWUB 3EFCA 1FO4A 3FAHA 2WXQA 5TR5A 1ZE3D 5IP4D 1Q0WB 1IGCA 4YTMB 1N61A 4C4VA 1ZKHA 2D07B 5KHOA 3QIJA 3N32A 2C7MB 2EMSA 2LGDA 1WMHA 3P4SB 2BYVE 4YSXB 1SJHD 2ZVOA 2KWCA 3Q3MC 1YN3A 1UBQA 2DYMA 3ZYYX 2LUMA 3PZDA 1XLOA 3V60A 2KK8A 3N1ZC 2BGFA 4RMAA 4M01A 2K6QA 4IUMB 2OHFA 3KWVA 1R4MB 1I4QA 4TSSA 1V1OA 1BXTA 1JWMD 1SIJA 4YL8A 2KJ6A 3MP9A 1GG3A 1TKEA 2KWDA 4ARCA 2NMQA 5BO4B 1MVKA 4B95A 3IAM1 3P63A 2BTEA 2DENB 1K8RB 2R61A 3WCQA 3K9OB 4B6WA 3BVZA 1QKZA 1E7PB 2BPSA 3DPDA 3PSEB 2PKOA 1TY2A 3TEYA 2L05A 3NRZA 1WJUA 1XCQL 3GZNB 2O2VB 3QARA 2KKCA 5CTRC 2MP2A 2DLBA 3T9LA 4HJGE 1YX5B 3WALA 4KDLB 3CMMB 2PVGC 1C4PA 3ALBA 2Q5WD 1XT9B 1NYQA 1GUAB 3ZIMA 1U4AA 4MACA 3M63B 3DWMA 2KANA 3VUYA 2MJEA 4ZRKA 3HRDD 3V62A 4B9KA 1KFYB 3AE8B 1VJKA 2NBWB 3AEGB 1VCBA 2CR5A 2FIDA 5AZFA 4M0WA 2BWES 2JZZA 3A4SC 1X1MA 3ZO5B 1L0XB 1T0YA 5DPSA 1VR9A 2X8XX 3MC8A 5AEKB 5KHQA 2JZ3B 4WWMA 1XO3A 2PPHA 2JSVX 3OAWA 2K8HA 3C8YA 4JLCA 4KKJA 5BMHA 2HTHA 4RCOA 5HI1A 3TEZA 5DPRA 1QOAA 5TSSA 1SXTA 2CKHB 3RFZB 1Z2MA 2IO1B 2Z59B 2LVOA 1XCTL 4FJYA 3URYA 1WJ6A 2B3AA 5D94A 1DGJA 5G2NA 1UELA 3EA6A 1WSPA 5IA7A 2RD0A 1PUTA 2RDBC 1C79A 4ANVA 3UQAA 2C7HA 2DZKA 1TS2A 3Q14C 4RF1A 4AP4C 2KTRB 1D3ZA 2O6VD 2QDFA 1OQQA 2WXKA 2M8SA 4PS8A 1WH3A 3PS6A 1P7EA 5I4DA 3CSTA 4NJ6A 1ROEA 3PHXB 2KN5A 5FK9C 2OOBB 1T6BX 3MJ5A 2DYBA 3LB8C 3L08A 4LJPB 2OJWA 4RM9A 2KMCA 4DXFA 4WWPA 2KACA 4S0RA 2WXRA 5D2MB 5G55A 3V3XA 5HG2A 1FNUA 2K8BA 4HEA1 1JWSD 3DBLB 2NBUA 3VR8B 3IT4B 1R4NB 1FNVA 2AX5A 5E6OA 2PIAA 1TS3A 3IXSA 3RPFC 4R3DA 3O65B 4DHJB 4KZ0A 5H92C 1EO6A 3BZDB 4P1BC 4FULA 1E9MA 4BBNF 2L8JA 5IKCM 1WFYA 1SEBD 2WXMA 1F1HA 4II3B 4GIVA 3H7PB 3OG5A 4KGTA 2LASA 4K7UA 3ML9A 1TKYA 3ZDMC 2PLPA 2INNE 1GPXA 3R8BA 4GSWA 5AZGA 4IM3A 3VH3B 3I5JC 3HM6X 2WLBA 1TBEA 1MG4A 4RH6A 2MCNB 3U8ZA 3TBLD 2JXXA 2MJ3A 3AEEB 4JE3B 2KHWB 3UQBA 1V1PB 1EU3A 3QWZB 4HWIB 5MPOA 3WAOA 3AM9A 3HVZA 1FMAD 3DBRI 1NDDA 3DOWA 2MRPA 4A90A 2KDFB 3A9JB 4W9DA 3ZDTA 5HFYA 4WWOA 5FKAC 5AUKA 3DVNU 2XBBC 3E56A 4IDIA 2MLBA 1YJIA 2UWQA 4CQNA 1IUEA 1F77A 2FUG1 3ZQ4A 1JMLA 1FIQA 2GLSA 2DNFA 3EFUA 2C9WB 4W9IA 2YLMA 1FFUA 2VZKD 3AE4B 2WXOA 4S17A 2WXIA 1F52A 4TMAB 3PPAA 4H2AA 1WYGA 2LGXA 5LNK1 4RGOS 1I42A 2J0JA 4MGIE 1SJED 3PRZA 1WGRA 3PZ8A 3R7QA 3Q3JA 4C80A 4N6EB 1WF9A 3RNFC 4M8MA 3AI5A 3AE1B 1FD6A 1T0RC 2JUOA 5AZHA 1WGKA 2JYTA 1IBXA 4IM2A 2D5GA 4J3OD 2AYOB 2L1AA 4I6PA 2ZNVC 3PVLA 2M1MA 2PE6B 4L2YA 4DQOC 5IO9A 1AW7A 4A20A 2N9KA 3BK1A 1RYJA 3DVGX 1S1QB 4LCDE 1QF6A 4BAXA 4JPSA 1V9JA 1YQBA 2I2YA 4HCNB 4IWOA 1NYRA 3ONSA 2J0KA 1AN8A 1V2YA 2L3ZA 4FBJB 1HTOA 2B76B 4MEMA 1WE7A 1WR1A 2IY1B 3ZTDA 4K81A 4HVBA 2WXPA 2PMVA 2LZ6A 5GMVA 1UUPA 1YN5A 4KIKB 4P16A 2ZW0A 2LVQA 3V6CB 1IYFA 2N7EA 2WDTB 2PE9A 1YQ4B 4DDID 3TMPB 4K7WA 3QCAA 3ZLZA 2Y5BB 4GXBA 2C7NB 2V9HA 3PLVA 2JZPA 2JT4B 2W9NA 2M19A 4MM3A 3ZJUA 1GAQB 3AE6B 1N5XA 2ZJDA 3PGEA 4DDGD 1L2NA 2CHWA 4HKQA 3BYTB 2RDHA 3B0AA 2XK5B 2SEBD 2Y3AA 3VFKA 1FNWA 4KKIA 1NEKB 3VTVA 4B0MA 1XD3B 2M0XA 3EECA 4LDTD 4L1BA 2WXNA 4K3CA 4GDKB 5BYSA 4WIPA 4TUUA 3RNEC 4B0EA 2ZNVB 2ACZB 3Q8BA 3SD5A 1UWXA 2C5LC 4MJSA 1PGXA 3IAS1 3S2AA 3NJTA 3GE3C 4EKUA 2M0AA 4US9A 1WM2A 3Q3NC 2DAJA 3P4RB 1ZPSA 4AJWA 4BVUC 1E8YA 3NVYA 4DHZE 1K50A 1WGYA 3OWEB 3GB1A 5DPTA 2K25A 3LDZE 1VZ7A 4ZRQA 3ZNID 1DOXA 4ZRJA 5JHAA 3APCA 5DCNA 2BS4B 4URKA 2K39A 2J53A 2K0PA 3RN9C 5J18A 5L95C 2K1FA 1WIAA 2WDRB 2KVRA 2WP9B 3MHSD 4M8NA 4ICVA 4IC7B 4FN2A 2AEHA 4USAA 3RZWC 1WI0A 1GOZA 3SDLC 3HM3A 2N7JA 5D7GA 2YEPF 1D5XC 2XN9C 3M62B 3ZW3A 4XWWA 2WXGA 3BY4B 4F1SA 1JCKB 1XLQA 4K3BA 1T0SC 1RWSA 3QJZA 4YTPB 2WDQB 1J7AA 3RNAC 5D6JB 4BBNC 2XEWA 1YX6B 1FM0D 5CX3A 2L83A 2WX0A 2HJ1A 5E6JA 2G1EA 3RNCC 4NAWA 1TIFA 4P6VF 1CMXB 2FE8A 2KD0A 5HKHA 4ICUA 2DHZA 2FNJB 1EUVB 2M4NA 3VUXA 4WJPA 4ZDVA 4BKSA 3WIMA 1NENB 3KW5B 4FA6A 1TKGA 1V5TA 4RGTA 4C4VB 2JVCA 2MJDA 1QOBA 4OZCA 2RSUA 4PS7A 4DHZB 1V80A 1ET6A 2DZIA 2LXCA 1EF5A 1YJ1A 2L0TA 1TY0A 4TQ0A 2IO3B 4G3XB 3KQ4A 2LGSA 1PYWD 2V0GA 3PO0A 1OEYA 3U52E 3K9PB 2H88B 3NVVA 4OHJA 2IGHA 1EWYC 1GC6A 2ZCBA 2WS3B 4NQKE 4BKTA 2Y5PA 4C00A 1YD8U 2RDGA 2FCSA 3ZUNA 2KDIA 2RPVA 3UF8A 2R2OA 3Q8FA 1JWBD 1E5WA 1C9FA 1HXYD 5CHWA 1L0VB 4RFBA 4EZLA 1SE4A 4NJCA 1WZ3A 3JSVA 2KMAA 1GB1A 1I4HA 4W9HA 2N1VA 1V97A 2N0SB 1UH6A 3ZNGC 1E8XA 2L0FA 4KVGB 4KGSA 1V49A 3I3TB 1JALA 1TTNA 2O2VA 1F9JA 1VRAB 1JW9D 2QCZA 2MP2B 3MFGA 1WR6E 2BWFA 1YNTE 3I63C 3VDZA 1SSNA 2NS5A 2FCNA 3UIOB 1FCLA 4AOFA 1BMLC 3EHVA 2EMTA 3HVDA 4HXDA 4RGMA 3NVZA 3ZVVA 4KSKC 2IZVB 4AWJA 1C78A 4K1RB 1GJZA 1J0GA 2D2QA 4I6NB 1VDVA 1NVID 4ZRPA 2MX2A 2JWUA 4MT5A 1I4RA 2K9XA 4JGHB 3P4QB 3LYYA 3U7ZA 1WYWB 3LJ3A 1ISNA 3Q8AA 1QLBB 4Q2JA 4LNIA 2JY6A 4D2KA 4LNKA 1HEZE 1ESFA 3NHEB 2NR2A 2EKEC 1UNSA 3JVZX 2JWZA 2Z0EB 3W5VB 4JL9A 1RRBA 3R7RA 3AE5B 5LXIB 1SIFA 1NI3A 3A9KA 1D6EC 1MPEA 2L7RA 1JROA 2LGYA 3AEBB 4JIOU 3FILA 1WRDB 3VR9B 1L0YB 2WHIA 2G4DB 1E0ZA 1C4CA 2KTRA 2BF8B 2L00B 3TIXA 2E3TA 3OLMD 2QILA 1MG8A 1WGGA 3ZXRA 4W9EA 3PV1A 4NPNA 3T3OA 1FRDA 2LJ5A 1V8CA 1QQRA 4LK0M 3PHWB 4CHKA 1YMHE 2JQRB 2O6VA 1YQ3B 3RZFA 1ZDXA 2M17A 1A5RA 1QT9A 3H8HA 3P1MA 1K51A 3BVMA 4DHJD 1LFDA 1HA5A 1Y8RC 2LHDA 4IWQA 2MBEA 3PRMB 4PYZA 1DOYA 1ET9A 2LWPA 1N5WA 3QK0A 1NBFC 3L0WB 4AQ7A 4DWFA 4BZAA 5CHFA 3AEAB 3LXFA 2KTFA 3HUIA 2KC2A 3NZSA 2IGDA 4NQLB 4WH4A 3VH4B 3NG0A 4FHJA 4BOSC 1KOTA 1L4ZB 2BT6A 1M94A 3AEFB 2WU2B 3DVGY 4US8A 5DPWA 2W82A 1RM6C 4F8CB 1I4XA 1UD7A 2JF5A 4E71A 3DHIC 4A9AA 3KUCB 4FJZA 3CWIA 4EOYA 2J42A 4WAAA 1CZPA 1FRRA 3J9CA 3P42A 4XWTA 1OEYJ 3DDCB 4OVZA 5JH5C 3GS2A 1AARA 3DHHC 3RI7C 3UIPB 2JPHA 1MFWA 5AUIA 1L4DB 2QHOA 3V05A 4RM8A 1E8ZA 3PREA 5GXGB 5C1ZA 1WGDA 4PT5A 4XDCA 2YVCA 3ENEA 4P1CC 2Z0DB 4GDLB 2X38A 4XE0A 3ZGZA 2CU1A 3QAQA 2GBNA 2KWVB 4NY0A 1WXSA 1JQ4A 2N9EB 3I9V1 2KNBA 1A70A 1XQQA 1F0ZA 3Q6BA 3M3JA 2KQ4X 4W9LA 4GMVA 2AQ3B 2RR9A 2LHEA 2GOWA 3RT3B 1EU4A 4A55A 2NPTB 4RGNA 1KF6B 2L76A 2MH7A 1I4PA 4ASWC 1V5OA 2VZKB 4FJVB 5LXHA 2GBRA 3A1QA 3BYYB 1QOFA 3PZ7A 1IBXB 5EE1A 3W1SC 2DAFA 3KWLA 4KZCA 1WGHA 3QQ8B 2MHJA 3B9JA 1IGDA 2N4FA 3MC9A 5EE9A 3D32A 3B1LX 2PEAA 4ARIA 4WJQA 5FR3A 3DQVA 3DBRB 1I7HA 2LVPA 5IOIA 2LGIA 5FR6A 3I57A 4OZBA 3RUIB 2V4IB 4G0NB 3TUOA 3AE9B 2JX5A 1H4RA 4HK2A 4KDIC 1BT0A 1EWCA 1S3SG 4FHKA 2WGSA 4E3CA 3NUHB 4GOCA 3RCZA 4KIKA 3X23A 1AYFA 2K22A 2ZPNA 2BYEA 2NTTA 2W55A 2FIFA 4G50A 4WQMA 1E90A 2GB1A 3W2DA 1DOIA 2ZW1A 4NZLB 3EUB2 1KLGD 1P0RA 2KVZA 4BOZB 1Q10A 3UI3A 2GMIC 2QMTA 2KDBA 2BYFA 2QEJC 5EE0A 2G9HD 2WXJA 4GB9A 3P2BA 2IDYA 2BBCA 2J7QB 1LXDA 3N3KB 1N6ZA 3RMKC 3VQIA 3DBHI 5JHBA 3KYCD 4M00A 2BS3B 4MM3B 4C7ZA 1KM7A 3L54A 2IY0B 3JYUA 3JW0X 2DZJA 1WY8A 1ZW7A 3OJ4B 2XK5A 2K6DB 2NBVB 1VZ8A 3AU4A 3RYTA 4N58A 4NNJB 3W1SA 1ZDVA 3BIID 1I4GA 4JWUC 1D4BA 2GBKA 2LJIA 1OGWA 1ZOYB 2IGGA 3TL5A 2CS4A 4IM0A 2N9XA 2KFKB 5G5HA 2W3RA 3Q69A 4MJSB 1P3QU 2MBOA 1P9DU 3ZRFA 4LDTB 2BB6A 4HKZE 3KVFB 3SFEB 4A8XC 2WYQA 3ZJVA 1IP9A 3L17A 3L13A 4LNOA 2GBMA 3X0WA 3HIZA 2GRIA 3KUZA 3OJ3A 4ITKA 4ZRIA 2N9LA 1LGRA 4ACFA 4X57B 1JWUD 1HE8A 1V81A 3ABVB 1RFAA 2N9PC 3ZTCA 2NVUI 1UF0A 1FXTB 1L6VA 1H8CA 3U7DA 3AULA 4W9CA 2BKRB 2G45B 1R4MI 3AMZA 3N30A 1GB4A 2SAKA 1C3TA 5BMIA 1TS4A 4OW0A 3C0RB 3ZJTA 4YWGG 3N20C 3E9SA 4XX5A 3Q2AC 4DXGA 2D11A 1UBIA 2VH1A 2XNAC 1LQBA 1WXVA 1FXAA 2WWZA 1FCCC 3NY5A 2A5UA 2WXLA 1WJNA 3AU5A 3V6EB 2KFJA 4O1NA 2LMCA 1Q1OA 2LXAA 4K7SA 2LUEA 3SHQA 5BYQA 1MHXA 3AE2B 2PTLA 3WA0A 2WNMA 5H8YE 3SR6A 2D3AA 3GZNI 4NAWB 2HDEA 4LNFA 3TSSA 3TEXA 2D10A 2V1YA 4MGKE 3L4PA 4C7YA 1WJ4A 1ZP0B 4MGYE 4HLEA 1LM8B 2DBYA 2H89B 3AV8A 1WMHB 3M95A 1V6EA 2EELA 1XLPA 4GN1A 1WRIA 3A4RA 2QIEB 1KH0A 2KZRA 2BQQA 4PK1A 2AWTA 1D5MC 1EF1A 3NZ3A 1CK1A 2HD5B 1WXMA 2RPQA 3VVWB 2VRRB 3NS1A 5BYRA 4PYUA 2AL6A 1KLUD 3VTWA 3MTNB 1VLBA 2HTME 3PTFC 4WQOB 3DVNV 1WWTA 4NJ7A 4DBGA 4EZKA 4XGAB 1E10A 1M4VA 2CJNA 5C23A 4IWPA 1BUIC 2I1KA 3TCAA 3N1XC 1WX7A 2I1JA 2KMMA 2ZCCA 1TZOA 1PDXA 3WANA 2N7DA 4MGZE 2KT7A 3JSVB 4A6QA 3AN1A 2K8CA 4FXCA 1IPGA 2AQ2B 4ZOHC 2WX1A 3U30A 2ICIA 2DYOA 2KDEB 1TJEA 1STEA 2CHXA 1GNUA 4GLSC 1UGMA 3TEWA 3GOEA 2WQYB 2V3PA 2IO0B 2JYEA 3QHTA 2KQ7A 2BYTA 2D3CA 5LLIA 1RFKA 1KRHA 2CJOA 2D3GA 3PLUA 3W9CB 3UINB 1T3QA 1J7CA 3ZNZB 2KJHB 1SE2A 2GI9A 1KLVA 2LRWA 2NCNA 1MHHE 1C1YB 1WX9A 2OJRA 4M0WB 3GE8C 3FC4A 4A3PA 3B2GA 4P7IA 3HHMA 1HTQA 1PFDA 3R2IA 2G4SA 2GBJA 2BB5A 3DBLI 3DBSA 3HK0A 3L16A 1R4NI 3KLSX 2ZPYA 3VRBB 3B2FA 4GU2A 1HQRD 3RD2A 4FLHA 5T8IA 2WXFA 2BS2B 4PS3A 5E6NA 3H6NA 2DZMA 2KC1A 2JU6X 4MH0E 5C3JB 5BMGA 1CJEA 2KQSA 2IYDB 1EM7A 2J4XA 1UZXB 1R7SA 4KX6B 2WDVB 1FPYA 4JX1C 2J0MA 2MBQA 3VUWA 5J2RA 3A9KB 3N1YC 3CF6E 2KX0A 4NAMA 3B08A 3CSFA 4WJNA 2JRIB 3ZXVA 1RLFA 4IG7B 4OZAA 3FILB 1FEHA 3NS8A 3WAPA 1YIWA 2I38A 5G5GA 4AJYB 4II2B 1J19A 1YJJA 1HZ6A 4YT0B 2REXA 1SE9A 2AQ1B 4GGQA 2PW9A 1Y56A 1SBBB 2FCMA 1CQVA 3QC8B 2LRUA 4EEWA 2O6VB 2AL3A 1KTKA 1HZ5A 3UGBB 1OFFA 4KSLC 4TKNA 3L10B 3NVWA 4HROA 3U4EG 2R2QA 1ENFA 2Y5CA 1QOGA 4DK5A 3VXWA 3GP7A 1SB3C 1OQRA 4RF0A 3RNGC 5JZEB 1UWMA 1NI2A 3SEBA 3VTUA 4HPMB 4A3OA 3H7PA 3ECIA 1ZGUB 2L52A 2HJ8A 4W9GA 3BWUD 2KYWA 3DHGC 2MWSB 3ETRA 4W9JA 1FFVA 1C4AA 2KLGA 4LTUA 5HHDG 1TT5B 1L5PA 1FXIA 4W9KA 2DX5B 4LJOB 2LFIA 5EE3A 4LNNA 3V61A 2IO2B 1J8CA 1TS5A 1OTRB 1T0QC 3P4PB 1V1PA 3EC8A 4C56C 2OEDA 1E6EB 4WWNA 2G3QB 3C19A 3MHZA 2C60A 3ZKJC 2KX3A 3R3MA 3A9JA 2Z8LA 2MBBB 2FCQA 1L7YA 3Q3OC 4XDDA 1J7BA 3T8MA 4ANXA 3R2TA 1B1ZA 2JXTA 3AB5A 5D3IB 1JWAD 1K53A 3ZRCA 4YSZB 1VD2A 2FUHB 2KXJA 1N63A 4WURA 1C76A 1DYQA 4GDLA 3T3NA 2KDMA 2ASQA 4YSYB 4AS1A 2PVOD 2V4LA 3H9DA 4EE2A 1PGBA 2KLCA 2DWQA 4ZYSA 1GC7A 3FKYA 2N1WA 1K52A 1F2RC 4HDQA 3IG3A 2RGFA 1RAXA 2W54A 4RNAA 5E6PA 3EGRA 1V86A 2KAJA 2NPTA 1F2RI 2WU5B 4MDKE 3VRAB 3APDA 2IBIB 1MJDA 4IW0A 5J17A 3IVFA 4XC2A 4ANUA 3TJPA 2KJRA 1SF0A 2BVCA 2WXHA 2MEKA 5IN7A 4KGRA 3A1QB 2BW2A 2CU3A 2YEPB 1ZUD2 4HJKA 3W1YA 4E74A 3AXCA 2INCC 2MBHA 2FAZA 4BFRA 3RULA
chains in the Genus database with same CATH topology
1TS3A 1WXQA 1JALA 3IXSA 3RPFC 4YXDB 3W5UB 2W3SA 1VRAB 4R3DA 1JW9D 1L6UA 4WAFA 1L6VA 5H92C 2QJLA 3MFGA 3BZDB 1E9MA 1XEEA 1YNTE 3AEDB 3O13A 2NTSA 3AMZA 1SEBD 2WXMA 1SSNA 1ZXIA 1GB4A 2SAKA 5BMIA 1TS4A 4OW0A 3ZJTA 4YWGG 1B9RA 3E9SA 1FCLA 3AECB 4KGTA 3Q8EA 1BMLC 4DXGA 2INPE 2XNAC 2LEKA 3HVDA 1TKYA 4RGMA 2PLPA 1FXAA 3NVZA 2INNE 1GPXA 1QILA 3R8BA 1FCCC 4HRSA 2WXLA 4RH6A 1XLNA 2WLBA 4YTNB 4O1NA 2LMCA 1N62A 2IJ0A 2MJ3A 1C78A 5BYQA 3AEEB 3AE7B 4JE3B 1MHXA 5JXVA 3AE2B 2PTLA 1V1PB 1EU3A 1T5XD 5MPOA 1VDVA 1NVID 2WNMA 1N60A 2FBWB 3AM9A 3HVZA 4ZRPA 5H8YE 2JWUA 3SR6A 1FMAD 4MT5A 1I4RA 4NAWB 2K9XA 2HDEA 3P4QB 3LYYA 3TSSA 3U7ZA 3TEXA 4A90A 3Q8AA 3L4PA 4C7YA 1ACCA 2ON8A 1ZP0B 5HFYA 1QLBB 4Q2JA 1LO5D 2DBYA 2H89B 2V3NA 5FKAC 4D2KA 1HEZE 1ESFA 5AUKA 1P7FA 3AV8A 3E56A 2IPKD 4IDIA 1UNSA 1YJIA 2K5PA 2EELA 2KN4A 3BK2A 4ZHOA 3W5VB 1XLPA 4REZA 1WRIA 2QIEB 4CQNA 1KH0A 1IUEA 3AE5B 1NI3A 1F77A 3AH7A 1C77A 1D6EC 1MPEA 2FUG1 3ZQ4A 1JMLA 1FIQA 1D5MC 1JROA 3AEBB 3NZ3A 2ONQA 1CK1A 3FILA 1FFUA 2VZKD 3AE4B 3VR9B 1L0YB 1JRPA 2WXOA 3NS1A 2E6XA 5BYRA 2WXIA 1KLUD 4TMAB 1E0ZA 1VLBA 1C4CA 2HTME 4H2AA 1WYGA 2E3TA 3DWGC 5LNK1 4RGOS 2QILA 1SJED 3BVGA 1WWTA 3T3OA 3PZ8A 1D5ZC 1FRDA 1E10A 1M4VA 1V8CA 2CJNA 4C80A 1QQRA 4N6EB 4LK0M 3Q8CA 1BUIC 1YMHE 1PGAA 1XXGA 2JQRB 3AE1B 1YQ3B 1FD6A 3IT6B 4IKGA 1WGKA 2JYTA 1ZDXA 1IBXA 2KMMA 2D5GA 2K3UA 4L23A 1TZOA 5D3DA 4J3OD 1ZXHA 1PDXA 1QT9A 4JWSC 3H8HA 3P1MA 1K51A 2L1AA 3MC0B 3BVMA 2EKIA 1HA5A 2J52A 2M56B 4L2YA 4A6QA 4DQOC 2LHDA 3AN1A 3N9YC 4MH8A 4FXCA 1AW7A 4N59A 2AQ2B 4ZOHC 2N9KA 3BK1A 1RYJA 1TYGB 1DOYA 1ET9A 2ICIA 2DYOA 1QF6A 1N5WA 4JPSA 3SFDB 1TJEA 3U2SC 1STEA 4GLSC 3TEWA 2I2YA 1UGJA 2WQYB 4AQ7A 2V3PA 1NYRA 2QSDA 1AN8A 2JYEA 3AEAB 3LXFA 1VZ6A 3HUIA 2IGDA 2BYTA 2B76B 4WH4A 4ZHPA 1RFKA 2WXPA 1KRHA 2TSSA 2PMVA 1XF5L 2CJOA 3AE3B 5C2TB 1UUPA 3W9CB 4TQ1A 1T3QA 1YN5A 1J7CA 2RMMA 4P16A 1L4ZB 2BT6A 3AEFB 2WU2B 2ZW0A 1SE2A 4US8A 2GI9A 2W82A 1RM6C 2L32A 1YQ4B 1MHHE 1I4XA 4UDUC 1MI0A 4A9AA 3CWIA 4LLGM 3FC4A 2J42A 1CZPA 1FRRA 3B2GA 3J9CA 3P42A 4IOIE 1PFDA 2JZPA 4XWTA 3R2IA 2BB5A 4OVZA 1AWDA 1YN4A 2M19A 3GS2A 3KLSX 3VRBB 3B2FA 3ZJUA 1GAQB 3CIRB 3AE6B 1N5XA 1SE3A 1HQRD 4HKQA 1FO4A 5AUIA 3BYTB 5T8IA 1L4DB 2WXFA 2BS2B 3FAHA 2WXQA 3V05A 2RDHA 1ZE3D 1IGCA 4YTMB 1N61A 2SEBD 2Y3AA 1FNWA 2JU6X 5C3JB 4KKIA 1CJEA 5GXGB 5BMGA 1NEKB 3P4SB 1EM7A 4PT5A 4XDCA 4B0MA 4YSXB 4L1BA 1SJHD 2J4XA 4GDLB 2X38A 2WXNA 4XE0A 1R7SA 3ZGZA 4GDKB 5BYSA 1YN3A 4KX6B 2WDVB 2DYMA 4JX1C 4WIPA 3ZYYX 1JQ4A 2LUMA 3I9V1 4B0EA 1XLOA 2ACZB 3Q8BA 4NAMA 1UWXA 1A70A 1PGXA 3IAS1 1F0ZA 4OZAA 3FILB 2M0AA 2OHFA 3KWVA 2KQ4X 4US9A 1FEHA 1I4QA 4TSSA 1V1OA 3P4RB 1BXTA 1ZPSA 2I38A 1JWMD 5G5GA 2AQ3B 1YJJA 1HZ6A 2LHEA 3NVYA 1K50A 1EU4A 1SIJA 4YT0B 4A55A 2AQ1B 4RGNA 3OWEB 3GB1A 3MP9A 1KF6B 1TKEA 2PW9A 1Y56A 1VZ7A 2KWDA 4ARCA 1SBBB 2NMQA 4ZRQA 2MH7A 1CQVA 1I4PA 1DOXA 1MVKA 2VZKB 3IAM1 3P63A 3BYYB 2BTEA 1KTKA 1HZ5A 1QOFA 1OFFA 3PZ7A 2BS4B 2R61A 3WCQA 1IBXB 3BVZA 5EE1A 1QKZA 1E7PB 3KWLA 2J53A 2K0PA 3NVWA 4HROA 3B9JA 2PKOA 2WDRB 3U4EG 1IGDA 1TY2A 3TEYA 1ENFA 5EE9A 2WP9B 4ARIA 5FR3A 3NRZA 2Y5CA 1QOGA 1XCQL 1I7HA 3GP7A 1SB3C 1OQRA 2DLBA 2LGIA 4RF0A 4USAA 4HJGE 1UWMA 3SEBA 3I57A 1GOZA 2N7JA 4OZBA 5D7GA 2YEPF 1D5XC 2PVGC 2V4IB 1C4PA 2XN9C 3TUOA 2Q5WD 3AE9B 2JX5A 4XWWA 2L52A 1NYQA 2WXGA 3BWUD 1EWCA 3ETRA 4MACA 1FFVA 1C4AA 1JCKB 1XLQA 4LTUA 3NUHB 3DWMA 5HHDG 1RWSA 1AYFA 2K22A 2MJEA 1L5PA 3HRDD 1FXIA 2NTTA 1KFYB 2W55A 2WDQB 4WQMA 1J7AA 4YTPB 2GB1A 3AE8B 2LFIA 3W2DA 1DOIA 1VJKA 2ZW1A 5EE3A 4NZLB 3EUB2 3AEGB 1KLGD 1Q10A 1FM0D 4M0WA 1TS5A 1V1PA 2L83A 3P4PB 3UI3A 2QMTA 4C56C 2QEJC 1L0XB 2OEDA 1E6EB 5EE0A 2G9HD 2WXJA 2G1EA 5E6JA 1VR9A 3MHZA 2IDYA 2BBCA 4P6VF 2FE8A 4WWMA 1XO3A 3C8YA 2JSVX 4KKJA 5BMHA 3VQIA 2Z8LA 4RCOA 5HI1A 3TEZA 1QOAA 5TSSA 1SXTA 2BS3B 4MM3B 4XDDA 3RFZB 4C7ZA 1J7BA 3R2TA 1B1ZA 2JXTA 3AB5A 5D3IB 1JWAD 1NENB 1XCTL 1K53A 3URYA 4YSZB 1TKGA 1N63A 4WURA 4RGTA 1DGJA 1VZ8A 3EA6A 4N58A 1WSPA 2MJDA 3W1SA 1QOBA 1ZDVA 3BIID 1I4GA 4JWUC 4OZCA 1D4BA 1PUTA 1C76A 1DYQA 3T3NA 2LJIA 1ET6A 2KDMA 1ZOYB 1TY0A 1C79A 4AS1A 4YSYB 4TQ0A 2PVOD 2IGGA 3KQ4A 4EE2A 1PGBA 1PYWD 5G5HA 2V0GA 3PO0A 2W3RA 3U52E 2DWQA 3Q69A 1TS2A 4ZYSA 2H88B 3NVVA 4OHJA 2IGHA 4RF1A 1EWYC 2WS3B 1K52A 1F2RC 1OQQA 2WXKA 2BB6A 2W54A 4RNAA 2Y5PA 4HKZE 1P7EA 5I4DA 3EGRA 3SFEB 4A8XC 2KAJA 2RDGA 3ZJVA 1F2RI 2WU5B 2RPVA 3Q8FA 1ROEA 3VRAB 5FK9C 1JWBD 1C9FA 1HXYD 1T6BX 1L0VB 3MJ5A 3LB8C 4RFBA 1SF0A 1SE4A 4NJCA 2WXHA 1GB1A 1I4HA 4DXFA 2GRIA 2MEKA 4KGRA 1V97A 2KACA 4ITKA 2BW2A 2CU3A 2N0SB 2WXRA 2YEPB 1ZUD2 3V3XA 5HG2A 1FNUA 4HEA1 2N9LA 1JWSD 1JWUD 4KGSA 3VR8B 3IT4B 3ABVB 1FNVA 2AX5A 2PIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJI A;  2L32 A; 
#chains in the Genus database with same CATH topology
 1PQS A;  1WXQ A;  4YXD B;  1WXA A;  4FAD A;  3W5U B;  2W3S A;  4ANW A;  3QX1 A;  1L6U A;  4WAF A;  3KYD D;  4CYE A;  2CHZ A;  2V3S A;  4EZJ A;  2QJL A;  1E7U A;  1JRU A;  2MQJ A;  2QC8 A;  1XEE A;  3VHT C;  3AED B;  2IND C;  1E8W A;  2MA9 B;  2NTS A;  2UU7 A;  3O13 A;  4EFO A;  3BIN A;  1ZXI A;  1WZ0 A;  1G6J A;  3KH0 A;  2LD9 A;  3H1U A;  4MEL A;  1B9R A;  3AEC B;  4AUQ C;  3Q8E A;  3NOB A;  2INP E;  2ZZP B;  2LEK A;  1QIL A;  4HRS A;  2BKF A;  3PT2 B;  1XLN A;  4YTN B;  1N62 A;  3NZU A;  2IJ0 A;  4JQW C;  3RNB C;  1E7V A;  3AE7 B;  3DCG A;  5JXV A;  3KUD B;  1T5X D;  2MW5 A;  1N60 A;  2FBW B;  4F7Z A;  1YOV B;  3H7S A;  1ACC A;  2ON8 A;  1LO5 D;  1WM3 A;  3ZNH B;  2V3N A;  3Q3F A;  1P7F A;  4ZYN A;  2IPK D;  2K5P A;  4OVV A;  3BK2 A;  1Z5S B;  2KN4 A;  4ZHO A;  3ML8 A;  4GDK A;  4REZ A;  3VAW A;  3AH7 A;  1C77 A;  4I6L B;  1P98 A;  1I35 A;  2ONQ A;  1QZE A;  1JRP A;  2KFK A;  4MSQ B;  2E6X A;  2HE7 A;  4DXA B;  1SGH A;  5L83 A;  3PRP B;  1TGZ B;  2KO3 A;  2ZEQ A;  3DWG C;  2A4Z A;  3IFW B;  4N9F 4;  4WJO A;  5EDS A;  2ZVN A;  3BVG A;  2VH2 A;  3QA8 A;  1D5Z C;  4OVU A;  2UYZ B;  2LI5 A;  3Q8C A;  1PGA A;  1XXG A;  3IT6 B;  4IKG A;  3IBE A;  4L23 A;  2K3U A;  5D3D A;  1ZXH A;  4JWS C;  3MC0 B;  2EKI A;  2J52 A;  2M56 B;  3WAM A;  3N9Y C;  4MH8 A;  3SU8 X;  4N59 A;  4J6I A;  1TYG B;  3DBH B;  3SFD B;  3U2S C;  1P1A A;  1KJT A;  4QAY A;  1Q5W B;  1UGJ A;  4BKG A;  2QSD A;  3A33 B;  3MJW A;  1WX8 A;  1VZ6 A;  5CHV C;  1OQY A;  1TZ1 A;  4ZHP A;  4EUT A;  2TSS A;  2KOX A;  1XF5 L;  3AE3 B;  3IHP C;  5C2T B;  4TQ1 A;  2RMM A;  4M02 A;  4TV3 A;  4XYC A;  2L32 A;  4HDO A;  4HPP A;  4G11 A;  4HPL B;  5IAA C;  4UDU C;  1MI0 A;  4LLG M;  4CO7 A;  3APF A;  4IOI E;  4KV2 A;  4HCP B;  4BKS D;  1AWD A;  1YN4 A;  4W9F A;  1WE6 A;  3R66 C;  2D3B A;  2MSE D;  3CIR B;  2PJH A;  4XZ4 A;  1SE3 A;  2JRH A;  4MSM B;  2KWU B;  3EFC A;  1FO4 A;  3FAH A;  2WXQ A;  5TR5 A;  1ZE3 D;  5IP4 D;  1Q0W B;  1IGC A;  4YTM B;  1N61 A;  4C4V A;  1ZKH A;  2D07 B;  5KHO A;  3QIJ A;  3N32 A;  2C7M B;  2EMS A;  2LGD A;  1WMH A;  3P4S B;  2BYV E;  4YSX B;  1SJH D;  2ZVO A;  2KWC A;  3Q3M C;  1YN3 A;  1UBQ A;  2DYM A;  3ZYY X;  2LUM A;  3PZD A;  1XLO A;  3V60 A;  2KK8 A;  3N1Z C;  2BGF A;  4RMA A;  4M01 A;  2K6Q A;  4IUM B;  2OHF A;  3KWV A;  1R4M B;  1I4Q A;  4TSS A;  1V1O A;  1BXT A;  1JWM D;  1SIJ A;  4YL8 A;  2KJ6 A;  3MP9 A;  1GG3 A;  1TKE A;  2KWD A;  4ARC A;  2NMQ A;  5BO4 B;  1MVK A;  4B95 A;  3IAM 1;  3P63 A;  2BTE A;  2DEN B;  1K8R B;  2R61 A;  3WCQ A;  3K9O B;  4B6W A;  3BVZ A;  1QKZ A;  1E7P B;  2BPS A;  3DPD A;  3PSE B;  2PKO A;  1TY2 A;  3TEY A;  2L05 A;  3NRZ A;  1WJU A;  1XCQ L;  3GZN B;  2O2V B;  3QAR A;  2KKC A;  5CTR C;  2MP2 A;  2DLB A;  3T9L A;  4HJG E;  1YX5 B;  3WAL A;  4KDL B;  3CMM B;  2PVG C;  1C4P A;  3ALB A;  2Q5W D;  1XT9 B;  1NYQ A;  1GUA B;  3ZIM A;  1U4A A;  4MAC A;  3M63 B;  3DWM A;  2KAN A;  3VUY A;  2MJE A;  4ZRK A;  3HRD D;  3V62 A;  4B9K A;  1KFY B;  3AE8 B;  1VJK A;  2NBW B;  3AEG B;  1VCB A;  2CR5 A;  2FID A;  5AZF A;  4M0W A;  2BWE S;  2JZZ A;  3A4S C;  1X1M A;  3ZO5 B;  1L0X B;  1T0Y A;  5DPS A;  1VR9 A;  2X8X X;  3MC8 A;  5AEK B;  5KHQ A;  2JZ3 B;  4WWM A;  1XO3 A;  2PPH A;  2JSV X;  3OAW A;  2K8H A;  3C8Y A;  4JLC A;  4KKJ A;  5BMH A;  2HTH A;  4RCO A;  5HI1 A;  3TEZ A;  5DPR A;  1QOA A;  5TSS A;  1SXT A;  2CKH B;  3RFZ B;  1Z2M A;  2IO1 B;  2Z59 B;  2LVO A;  1XCT L;  4FJY A;  3URY A;  1WJ6 A;  2B3A A;  5D94 A;  1DGJ A;  5G2N A;  1UEL A;  3EA6 A;  1WSP A;  5IA7 A;  2RD0 A;  1PUT A;  2RDB C;  1C79 A;  4ANV A;  3UQA A;  2C7H A;  2DZK A;  1TS2 A;  3Q14 C;  4RF1 A;  4AP4 C;  2KTR B;  1D3Z A;  2O6V D;  2QDF A;  1OQQ A;  2WXK A;  2M8S A;  4PS8 A;  1WH3 A;  3PS6 A;  1P7E A;  5I4D A;  3CST A;  4NJ6 A;  1ROE A;  3PHX B;  2KN5 A;  5FK9 C;  2OOB B;  1T6B X;  3MJ5 A;  2DYB A;  3LB8 C;  3L08 A;  4LJP B;  2OJW A;  4RM9 A;  2KMC A;  4DXF A;  4WWP A;  2KAC A;  4S0R A;  2WXR A;  5D2M B;  5G55 A;  3V3X A;  5HG2 A;  1FNU A;  2K8B A;  4HEA 1;  1JWS D;  3DBL B;  2NBU A;  3VR8 B;  3IT4 B;  1R4N B;  1FNV A;  2AX5 A;  5E6O A;  2PIA A;  1TS3 A;  3IXS A;  3RPF C;  4R3D A;  3O65 B;  4DHJ B;  4KZ0 A;  5H92 C;  1EO6 A;  3BZD B;  4P1B C;  4FUL A;  1E9M A;  4BBN F;  2L8J A;  5IKC M;  1WFY A;  1SEB D;  2WXM A;  1F1H A;  4II3 B;  4GIV A;  3H7P B;  3OG5 A;  4KGT A;  2LAS A;  4K7U A;  3ML9 A;  1TKY A;  3ZDM C;  2PLP A;  2INN E;  1GPX A;  3R8B A;  4GSW A;  5AZG A;  4IM3 A;  3VH3 B;  3I5J C;  3HM6 X;  2WLB A;  1TBE A;  1MG4 A;  4RH6 A;  2MCN B;  3U8Z A;  3TBL D;  2JXX A;  2MJ3 A;  3AEE B;  4JE3 B;  2KHW B;  3UQB A;  1V1P B;  1EU3 A;  3QWZ B;  4HWI B;  5MPO A;  3WAO A;  3AM9 A;  3HVZ A;  1FMA D;  3DBR I;  1NDD A;  3DOW A;  2MRP A;  4A90 A;  2KDF B;  3A9J B;  4W9D A;  3ZDT A;  5HFY A;  4WWO A;  5FKA C;  5AUK A;  3DVN U;  2XBB C;  3E56 A;  4IDI A;  2MLB A;  1YJI A;  2UWQ A;  4CQN A;  1IUE A;  1F77 A;  2FUG 1;  3ZQ4 A;  1JML A;  1FIQ A;  2GLS A;  2DNF A;  3EFU A;  2C9W B;  4W9I A;  2YLM A;  1FFU A;  2VZK D;  3AE4 B;  2WXO A;  4S17 A;  2WXI A;  1F52 A;  4TMA B;  3PPA A;  4H2A A;  1WYG A;  2LGX A;  5LNK 1;  4RGO S;  1I42 A;  2J0J A;  4MGI E;  1SJE D;  3PRZ A;  1WGR A;  3PZ8 A;  3R7Q A;  3Q3J A;  4C80 A;  4N6E B;  1WF9 A;  3RNF C;  4M8M A;  3AI5 A;  3AE1 B;  1FD6 A;  1T0R C;  2JUO A;  5AZH A;  1WGK A;  2JYT A;  1IBX A;  4IM2 A;  2D5G A;  4J3O D;  2AYO B;  2L1A A;  4I6P A;  2ZNV C;  3PVL A;  2M1M A;  2PE6 B;  4L2Y A;  4DQO C;  5IO9 A;  1AW7 A;  4A20 A;  2N9K A;  3BK1 A;  1RYJ A;  3DVG X;  1S1Q B;  4LCD E;  1QF6 A;  4BAX A;  4JPS A;  1V9J A;  1YQB A;  2I2Y A;  4HCN B;  4IWO A;  1NYR A;  3ONS A;  2J0K A;  1AN8 A;  1V2Y A;  2L3Z A;  4FBJ B;  1HTO A;  2B76 B;  4MEM A;  1WE7 A;  1WR1 A;  2IY1 B;  3ZTD A;  4K81 A;  4HVB A;  2WXP A;  2PMV A;  2LZ6 A;  5GMV A;  1UUP A;  1YN5 A;  4KIK B;  4P16 A;  2ZW0 A;  2LVQ A;  3V6C B;  1IYF A;  2N7E A;  2WDT B;  2PE9 A;  1YQ4 B;  4DDI D;  3TMP B;  4K7W A;  3QCA A;  3ZLZ A;  2Y5B B;  4GXB A;  2C7N B;  2V9H A;  3PLV A;  2JZP A;  2JT4 B;  2W9N A;  2M19 A;  4MM3 A;  3ZJU A;  1GAQ B;  3AE6 B;  1N5X A;  2ZJD A;  3PGE A;  4DDG D;  1L2N A;  2CHW A;  4HKQ A;  3BYT B;  2RDH A;  3B0A A;  2XK5 B;  2SEB D;  2Y3A A;  3VFK A;  1FNW A;  4KKI A;  1NEK B;  3VTV A;  4B0M A;  1XD3 B;  2M0X A;  3EEC A;  4LDT D;  4L1B A;  2WXN A;  4K3C A;  4GDK B;  5BYS A;  4WIP A;  4TUU A;  3RNE C;  4B0E A;  2ZNV B;  2ACZ B;  3Q8B A;  3SD5 A;  1UWX A;  2C5L C;  4MJS A;  1PGX A;  3IAS 1;  3S2A A;  3NJT A;  3GE3 C;  4EKU A;  2M0A A;  4US9 A;  1WM2 A;  3Q3N C;  2DAJ A;  3P4R B;  1ZPS A;  4AJW A;  4BVU C;  1E8Y A;  3NVY A;  4DHZ E;  1K50 A;  1WGY A;  3OWE B;  3GB1 A;  5DPT A;  2K25 A;  3LDZ E;  1VZ7 A;  4ZRQ A;  3ZNI D;  1DOX A;  4ZRJ A;  5JHA A;  3APC A;  5DCN A;  2BS4 B;  4URK A;  2K39 A;  2J53 A;  2K0P A;  3RN9 C;  5J18 A;  5L95 C;  2K1F A;  1WIA A;  2WDR B;  2KVR A;  2WP9 B;  3MHS D;  4M8N A;  4ICV A;  4IC7 B;  4FN2 A;  2AEH A;  4USA A;  3RZW C;  1WI0 A;  1GOZ A;  3SDL C;  3HM3 A;  2N7J A;  5D7G A;  2YEP F;  1D5X C;  2XN9 C;  3M62 B;  3ZW3 A;  4XWW A;  2WXG A;  3BY4 B;  4F1S A;  1JCK B;  1XLQ A;  4K3B A;  1T0S C;  1RWS A;  3QJZ A;  4YTP B;  2WDQ B;  1J7A A;  3RNA C;  5D6J B;  4BBN C;  2XEW A;  1YX6 B;  1FM0 D;  5CX3 A;  2L83 A;  2WX0 A;  2HJ1 A;  5E6J A;  2G1E A;  3RNC C;  4NAW A;  1TIF A;  4P6V F;  1CMX B;  2FE8 A;  2KD0 A;  5HKH A;  4ICU A;  2DHZ A;  2FNJ B;  1EUV B;  2M4N A;  3VUX A;  4WJP A;  4ZDV A;  4BKS A;  3WIM A;  1NEN B;  3KW5 B;  4FA6 A;  1TKG A;  1V5T A;  4RGT A;  4C4V B;  2JVC A;  2MJD A;  1QOB A;  4OZC A;  2RSU A;  4PS7 A;  4DHZ B;  1V80 A;  1ET6 A;  2DZI A;  2LXC A;  1EF5 A;  1YJ1 A;  2L0T A;  1TY0 A;  4TQ0 A;  2IO3 B;  4G3X B;  3KQ4 A;  2LGS A;  1PYW D;  2V0G A;  3PO0 A;  1OEY A;  3U52 E;  3K9P B;  2H88 B;  3NVV A;  4OHJ A;  2IGH A;  1EWY C;  1GC6 A;  2ZCB A;  2WS3 B;  4NQK E;  4BKT A;  2Y5P A;  4C00 A;  1YD8 U;  2RDG A;  2FCS A;  3ZUN A;  2KDI A;  2RPV A;  3UF8 A;  2R2O A;  3Q8F A;  1JWB D;  1E5W A;  1C9F A;  1HXY D;  5CHW A;  1L0V B;  4RFB A;  4EZL A;  1SE4 A;  4NJC A;  1WZ3 A;  3JSV A;  2KMA A;  1GB1 A;  1I4H A;  4W9H A;  2N1V A;  1V97 A;  2N0S B;  1UH6 A;  3ZNG C;  1E8X A;  2L0F A;  4KVG B;  4KGS A;  1V49 A;  3I3T B;  1JAL A;  1TTN A;  2O2V A;  1F9J A;  1VRA B;  1JW9 D;  2QCZ A;  2MP2 B;  3MFG A;  1WR6 E;  2BWF A;  1YNT E;  3I63 C;  3VDZ A;  1SSN A;  2NS5 A;  2FCN A;  3UIO B;  1FCL A;  4AOF A;  1BML C;  3EHV A;  2EMT A;  3HVD A;  4HXD A;  4RGM A;  3NVZ A;  3ZVV A;  4KSK C;  2IZV B;  4AWJ A;  1C78 A;  4K1R B;  1GJZ A;  1J0G A;  2D2Q A;  4I6N B;  1VDV A;  1NVI D;  4ZRP A;  2MX2 A;  2JWU A;  4MT5 A;  1I4R A;  2K9X A;  4JGH B;  3P4Q B;  3LYY A;  3U7Z A;  1WYW B;  3LJ3 A;  1ISN A;  3Q8A A;  1QLB B;  4Q2J A;  4LNI A;  2JY6 A;  4D2K A;  4LNK A;  1HEZ E;  1ESF A;  3NHE B;  2NR2 A;  2EKE C;  1UNS A;  3JVZ X;  2JWZ A;  2Z0E B;  3W5V B;  4JL9 A;  1RRB A;  3R7R A;  3AE5 B;  5LXI B;  1SIF A;  1NI3 A;  3A9K A;  1D6E C;  1MPE A;  2L7R A;  1JRO A;  2LGY A;  3AEB B;  4JIO U;  3FIL A;  1WRD B;  3VR9 B;  1L0Y B;  2WHI A;  2G4D B;  1E0Z A;  1C4C A;  2KTR A;  2BF8 B;  2L00 B;  3TIX A;  2E3T A;  3OLM D;  2QIL A;  1MG8 A;  1WGG A;  3ZXR A;  4W9E A;  3PV1 A;  4NPN A;  3T3O A;  1FRD A;  2LJ5 A;  1V8C A;  1QQR A;  4LK0 M;  3PHW B;  4CHK A;  1YMH E;  2JQR B;  2O6V A;  1YQ3 B;  3RZF A;  1ZDX A;  2M17 A;  1A5R A;  1QT9 A;  3H8H A;  3P1M A;  1K51 A;  3BVM A;  4DHJ D;  1LFD A;  1HA5 A;  1Y8R C;  2LHD A;  4IWQ A;  2MBE A;  3PRM B;  4PYZ A;  1DOY A;  1ET9 A;  2LWP A;  1N5W A;  3QK0 A;  1NBF C;  3L0W B;  4AQ7 A;  4DWF A;  4BZA A;  5CHF A;  3AEA B;  3LXF A;  2KTF A;  3HUI A;  2KC2 A;  3NZS A;  2IGD A;  4NQL B;  4WH4 A;  3VH4 B;  3NG0 A;  4FHJ A;  4BOS C;  1KOT A;  1L4Z B;  2BT6 A;  1M94 A;  3AEF B;  2WU2 B;  3DVG Y;  4US8 A;  5DPW A;  2W82 A;  1RM6 C;  4F8C B;  1I4X A;  1UD7 A;  2JF5 A;  4E71 A;  3DHI C;  4A9A A;  3KUC B;  4FJZ A;  3CWI A;  4EOY A;  2J42 A;  4WAA A;  1CZP A;  1FRR A;  3J9C A;  3P42 A;  4XWT A;  1OEY J;  3DDC B;  4OVZ A;  5JH5 C;  3GS2 A;  1AAR A;  3DHH C;  3RI7 C;  3UIP B;  2JPH A;  1MFW A;  5AUI A;  1L4D B;  2QHO A;  3V05 A;  4RM8 A;  1E8Z A;  3PRE A;  5GXG B;  5C1Z A;  1WGD A;  4PT5 A;  4XDC A;  2YVC A;  3ENE A;  4P1C C;  2Z0D B;  4GDL B;  2X38 A;  4XE0 A;  3ZGZ A;  2CU1 A;  3QAQ A;  2GBN A;  2KWV B;  4NY0 A;  1WXS A;  1JQ4 A;  2N9E B;  3I9V 1;  2KNB A;  1A70 A;  1XQQ A;  1F0Z A;  3Q6B A;  3M3J A;  2KQ4 X;  4W9L A;  4GMV A;  2AQ3 B;  2RR9 A;  2LHE A;  2GOW A;  3RT3 B;  1EU4 A;  4A55 A;  2NPT B;  4RGN A;  1KF6 B;  2L76 A;  2MH7 A;  1I4P A;  4ASW C;  1V5O A;  2VZK B;  4FJV B;  5LXH A;  2GBR A;  3A1Q A;  3BYY B;  1QOF A;  3PZ7 A;  1IBX B;  5EE1 A;  3W1S C;  2DAF A;  3KWL A;  4KZC A;  1WGH A;  3QQ8 B;  2MHJ A;  3B9J A;  1IGD A;  2N4F A;  3MC9 A;  5EE9 A;  3D32 A;  3B1L X;  2PEA A;  4ARI A;  4WJQ A;  5FR3 A;  3DQV A;  3DBR B;  1I7H A;  2LVP A;  5IOI A;  2LGI A;  5FR6 A;  3I57 A;  4OZB A;  3RUI B;  2V4I B;  4G0N B;  3TUO A;  3AE9 B;  2JX5 A;  1H4R A;  4HK2 A;  4KDI C;  1BT0 A;  1EWC A;  1S3S G;  4FHK A;  2WGS A;  4E3C A;  3NUH B;  4GOC A;  3RCZ A;  4KIK A;  3X23 A;  1AYF A;  2K22 A;  2ZPN A;  2BYE A;  2NTT A;  2W55 A;  2FIF A;  4G50 A;  4WQM A;  1E90 A;  2GB1 A;  3W2D A;  1DOI A;  2ZW1 A;  4NZL B;  3EUB 2;  1KLG D;  1P0R A;  2KVZ A;  4BOZ B;  1Q10 A;  3UI3 A;  2GMI C;  2QMT A;  2KDB A;  2BYF A;  2QEJ C;  5EE0 A;  2G9H D;  2WXJ A;  4GB9 A;  3P2B A;  2IDY A;  2BBC A;  2J7Q B;  1LXD A;  3N3K B;  1N6Z A;  3RMK C;  3VQI A;  3DBH I;  5JHB A;  3KYC D;  4M00 A;  2BS3 B;  4MM3 B;  4C7Z A;  1KM7 A;  3L54 A;  2IY0 B;  3JYU A;  3JW0 X;  2DZJ A;  1WY8 A;  1ZW7 A;  3OJ4 B;  2XK5 A;  2K6D B;  2NBV B;  1VZ8 A;  3AU4 A;  3RYT A;  4N58 A;  4NNJ B;  3W1S A;  1ZDV A;  3BII D;  1I4G A;  4JWU C;  1D4B A;  2GBK A;  2LJI A;  1OGW A;  1ZOY B;  2IGG A;  3TL5 A;  2CS4 A;  4IM0 A;  2N9X A;  2KFK B;  5G5H A;  2W3R A;  3Q69 A;  4MJS B;  1P3Q U;  2MBO A;  1P9D U;  3ZRF A;  4LDT B;  2BB6 A;  4HKZ E;  3KVF B;  3SFE B;  4A8X C;  2WYQ A;  3ZJV A;  1IP9 A;  3L17 A;  3L13 A;  4LNO A;  2GBM A;  3X0W A;  3HIZ A;  2GRI A;  3KUZ A;  3OJ3 A;  4ITK A;  4ZRI A;  2N9L A;  1LGR A;  4ACF A;  4X57 B;  1JWU D;  1HE8 A;  1V81 A;  3ABV B;  1RFA A;  2N9P C;  3ZTC A;  2NVU I;  1UF0 A;  1FXT B;  1L6V A;  1H8C A;  3U7D A;  3AUL A;  4W9C A;  2BKR B;  2G45 B;  1R4M I;  3AMZ A;  3N30 A;  1GB4 A;  2SAK A;  1C3T A;  5BMI A;  1TS4 A;  4OW0 A;  3C0R B;  3ZJT A;  4YWG G;  3N20 C;  3E9S A;  4XX5 A;  3Q2A C;  4DXG A;  2D11 A;  1UBI A;  2VH1 A;  2XNA C;  1LQB A;  1WXV A;  1FXA A;  2WWZ A;  1FCC C;  3NY5 A;  2A5U A;  2WXL A;  1WJN A;  3AU5 A;  3V6E B;  2KFJ A;  4O1N A;  2LMC A;  1Q1O A;  2LXA A;  4K7S A;  2LUE A;  3SHQ A;  5BYQ A;  1MHX A;  3AE2 B;  2PTL A;  3WA0 A;  2WNM A;  5H8Y E;  3SR6 A;  2D3A A;  3GZN I;  4NAW B;  2HDE A;  4LNF A;  3TSS A;  3TEX A;  2D10 A;  2V1Y A;  4MGK E;  3L4P A;  4C7Y A;  1WJ4 A;  1ZP0 B;  4MGY E;  4HLE A;  1LM8 B;  2DBY A;  2H89 B;  3AV8 A;  1WMH B;  3M95 A;  1V6E A;  2EEL A;  1XLP A;  4GN1 A;  1WRI A;  3A4R A;  2QIE B;  1KH0 A;  2KZR A;  2BQQ A;  4PK1 A;  2AWT A;  1D5M C;  1EF1 A;  3NZ3 A;  1CK1 A;  2HD5 B;  1WXM A;  2RPQ A;  3VVW B;  2VRR B;  3NS1 A;  5BYR A;  4PYU A;  2AL6 A;  1KLU D;  3VTW A;  3MTN B;  1VLB A;  2HTM E;  3PTF C;  4WQO B;  3DVN V;  1WWT A;  4NJ7 A;  4DBG A;  4EZK A;  4XGA B;  1E10 A;  1M4V A;  2CJN A;  5C23 A;  4IWP A;  1BUI C;  2I1K A;  3TCA A;  3N1X C;  1WX7 A;  2I1J A;  2KMM A;  2ZCC A;  1TZO A;  1PDX A;  3WAN A;  2N7D A;  4MGZ E;  2KT7 A;  3JSV B;  4A6Q A;  3AN1 A;  2K8C A;  4FXC A;  1IPG A;  2AQ2 B;  4ZOH C;  2WX1 A;  3U30 A;  2ICI A;  2DYO A;  2KDE B;  1TJE A;  1STE A;  2CHX A;  1GNU A;  4GLS C;  1UGM A;  3TEW A;  3GOE A;  2WQY B;  2V3P A;  2IO0 B;  2JYE A;  3QHT A;  2KQ7 A;  2BYT A;  2D3C A;  5LLI A;  1RFK A;  1KRH A;  2CJO A;  2D3G A;  3PLU A;  3W9C B;  3UIN B;  1T3Q A;  1J7C A;  3ZNZ B;  2KJH B;  1SE2 A;  2GI9 A;  1KLV A;  2LRW A;  2NCN A;  1MHH E;  1C1Y B;  1WX9 A;  2OJR A;  4M0W B;  3GE8 C;  3FC4 A;  4A3P A;  3B2G A;  4P7I A;  3HHM A;  1HTQ A;  1PFD A;  3R2I A;  2G4S A;  2GBJ A;  2BB5 A;  3DBL I;  3DBS A;  3HK0 A;  3L16 A;  1R4N I;  3KLS X;  2ZPY A;  3VRB B;  3B2F A;  4GU2 A;  1HQR D;  3RD2 A;  4FLH A;  5T8I A;  2WXF A;  2BS2 B;  4PS3 A;  5E6N A;  3H6N A;  2DZM A;  2KC1 A;  2JU6 X;  4MH0 E;  5C3J B;  5BMG A;  1CJE A;  2KQS A;  2IYD B;  1EM7 A;  2J4X A;  1UZX B;  1R7S A;  4KX6 B;  2WDV B;  1FPY A;  4JX1 C;  2J0M A;  2MBQ A;  3VUW A;  5J2R A;  3A9K B;  3N1Y C;  3CF6 E;  2KX0 A;  4NAM A;  3B08 A;  3CSF A;  4WJN A;  2JRI B;  3ZXV A;  1RLF A;  4IG7 B;  4OZA A;  3FIL B;  1FEH A;  3NS8 A;  3WAP A;  1YIW A;  2I38 A;  5G5G A;  4AJY B;  4II2 B;  1J19 A;  1YJJ A;  1HZ6 A;  4YT0 B;  2REX A;  1SE9 A;  2AQ1 B;  4GGQ A;  2PW9 A;  1Y56 A;  1SBB B;  2FCM A;  1CQV A;  3QC8 B;  2LRU A;  4EEW A;  2O6V B;  2AL3 A;  1KTK A;  1HZ5 A;  3UGB B;  1OFF A;  4KSL C;  4TKN A;  3L10 B;  3NVW A;  4HRO A;  3U4E G;  2R2Q A;  1ENF A;  2Y5C A;  1QOG A;  4DK5 A;  3VXW A;  3GP7 A;  1SB3 C;  1OQR A;  4RF0 A;  3RNG C;  5JZE B;  1UWM A;  1NI2 A;  3SEB A;  3VTU A;  4HPM B;  4A3O A;  3H7P A;  3ECI A;  1ZGU B;  2L52 A;  2HJ8 A;  4W9G A;  3BWU D;  2KYW A;  3DHG C;  2MWS B;  3ETR A;  4W9J A;  1FFV A;  1C4A A;  2KLG A;  4LTU A;  5HHD G;  1TT5 B;  1L5P A;  1FXI A;  4W9K A;  2DX5 B;  4LJO B;  2LFI A;  5EE3 A;  4LNN A;  3V61 A;  2IO2 B;  1J8C A;  1TS5 A;  1OTR B;  1T0Q C;  3P4P B;  1V1P A;  3EC8 A;  4C56 C;  2OED A;  1E6E B;  4WWN A;  2G3Q B;  3C19 A;  3MHZ A;  2C60 A;  3ZKJ C;  2KX3 A;  3R3M A;  3A9J A;  2Z8L A;  2MBB B;  2FCQ A;  1L7Y A;  3Q3O C;  4XDD A;  1J7B A;  3T8M A;  4ANX A;  3R2T A;  1B1Z A;  2JXT A;  3AB5 A;  5D3I B;  1JWA D;  1K53 A;  3ZRC A;  4YSZ B;  1VD2 A;  2FUH B;  2KXJ A;  1N63 A;  4WUR A;  1C76 A;  1DYQ A;  4GDL A;  3T3N A;  2KDM A;  2ASQ A;  4YSY B;  4AS1 A;  2PVO D;  2V4L A;  3H9D A;  4EE2 A;  1PGB A;  2KLC A;  2DWQ A;  4ZYS A;  1GC7 A;  3FKY A;  2N1W A;  1K52 A;  1F2R C;  4HDQ A;  3IG3 A;  2RGF A;  1RAX A;  2W54 A;  4RNA A;  5E6P A;  3EGR A;  1V86 A;  2KAJ A;  2NPT A;  1F2R I;  2WU5 B;  4MDK E;  3VRA B;  3APD A;  2IBI B;  1MJD A;  4IW0 A;  5J17 A;  3IVF A;  4XC2 A;  4ANU A;  3TJP A;  2KJR A;  1SF0 A;  2BVC A;  2WXH A;  2MEK A;  5IN7 A;  4KGR A;  3A1Q B;  2BW2 A;  2CU3 A;  2YEP B;  1ZUD 2;  4HJK A;  3W1Y A;  4E74 A;  3AXC A;  2INC C;  2MBH A;  2FAZ A;  4BFR A;  3RUL A; 
#chains in the Genus database with same CATH homology
 1TS3 A;  1WXQ A;  1JAL A;  3IXS A;  3RPF C;  4YXD B;  3W5U B;  2W3S A;  1VRA B;  4R3D A;  1JW9 D;  1L6U A;  4WAF A;  1L6V A;  5H92 C;  2QJL A;  3MFG A;  3BZD B;  1E9M A;  1XEE A;  1YNT E;  3AED B;  3O13 A;  2NTS A;  3AMZ A;  1SEB D;  2WXM A;  1SSN A;  1ZXI A;  1GB4 A;  2SAK A;  5BMI A;  1TS4 A;  4OW0 A;  3ZJT A;  4YWG G;  1B9R A;  3E9S A;  1FCL A;  3AEC B;  4KGT A;  3Q8E A;  1BML C;  4DXG A;  2INP E;  2XNA C;  2LEK A;  3HVD A;  1TKY A;  4RGM A;  2PLP A;  1FXA A;  3NVZ A;  2INN E;  1GPX A;  1QIL A;  3R8B A;  1FCC C;  4HRS A;  2WXL A;  4RH6 A;  1XLN A;  2WLB A;  4YTN B;  4O1N A;  2LMC A;  1N62 A;  2IJ0 A;  2MJ3 A;  1C78 A;  5BYQ A;  3AEE B;  3AE7 B;  4JE3 B;  1MHX A;  5JXV A;  3AE2 B;  2PTL A;  1V1P B;  1EU3 A;  1T5X D;  5MPO A;  1VDV A;  1NVI D;  2WNM A;  1N60 A;  2FBW B;  3AM9 A;  3HVZ A;  4ZRP A;  5H8Y E;  2JWU A;  3SR6 A;  1FMA D;  4MT5 A;  1I4R A;  4NAW B;  2K9X A;  2HDE A;  3P4Q B;  3LYY A;  3TSS A;  3U7Z A;  3TEX A;  4A90 A;  3Q8A A;  3L4P A;  4C7Y A;  1ACC A;  2ON8 A;  1ZP0 B;  5HFY A;  1QLB B;  4Q2J A;  1LO5 D;  2DBY A;  2H89 B;  2V3N A;  5FKA C;  4D2K A;  1HEZ E;  1ESF A;  5AUK A;  1P7F A;  3AV8 A;  3E56 A;  2IPK D;  4IDI A;  1UNS A;  1YJI A;  2K5P A;  2EEL A;  2KN4 A;  3BK2 A;  4ZHO A;  3W5V B;  1XLP A;  4REZ A;  1WRI A;  2QIE B;  4CQN A;  1KH0 A;  1IUE A;  3AE5 B;  1NI3 A;  1F77 A;  3AH7 A;  1C77 A;  1D6E C;  1MPE A;  2FUG 1;  3ZQ4 A;  1JML A;  1FIQ A;  1D5M C;  1JRO A;  3AEB B;  3NZ3 A;  2ONQ A;  1CK1 A;  3FIL A;  1FFU A;  2VZK D;  3AE4 B;  3VR9 B;  1L0Y B;  1JRP A;  2WXO A;  3NS1 A;  2E6X A;  5BYR A;  2WXI A;  1KLU D;  4TMA B;  1E0Z A;  1VLB A;  1C4C A;  2HTM E;  4H2A A;  1WYG A;  2E3T A;  3DWG C;  5LNK 1;  4RGO S;  2QIL A;  1SJE D;  3BVG A;  1WWT A;  3T3O A;  3PZ8 A;  1D5Z C;  1FRD A;  1E10 A;  1M4V A;  1V8C A;  2CJN A;  4C80 A;  1QQR A;  4N6E B;  4LK0 M;  3Q8C A;  1BUI C;  1YMH E;  1PGA A;  1XXG A;  2JQR B;  3AE1 B;  1YQ3 B;  1FD6 A;  3IT6 B;  4IKG A;  1WGK A;  2JYT A;  1ZDX A;  1IBX A;  2KMM A;  2D5G A;  2K3U A;  4L23 A;  1TZO A;  5D3D A;  4J3O D;  1ZXH A;  1PDX A;  1QT9 A;  4JWS C;  3H8H A;  3P1M A;  1K51 A;  2L1A A;  3MC0 B;  3BVM A;  2EKI A;  1HA5 A;  2J52 A;  2M56 B;  4L2Y A;  4A6Q A;  4DQO C;  2LHD A;  3AN1 A;  3N9Y C;  4MH8 A;  4FXC A;  1AW7 A;  4N59 A;  2AQ2 B;  4ZOH C;  2N9K A;  3BK1 A;  1RYJ A;  1TYG B;  1DOY A;  1ET9 A;  2ICI A;  2DYO A;  1QF6 A;  1N5W A;  4JPS A;  3SFD B;  1TJE A;  3U2S C;  1STE A;  4GLS C;  3TEW A;  2I2Y A;  1UGJ A;  2WQY B;  4AQ7 A;  2V3P A;  1NYR A;  2QSD A;  1AN8 A;  2JYE A;  3AEA B;  3LXF A;  1VZ6 A;  3HUI A;  2IGD A;  2BYT A;  2B76 B;  4WH4 A;  4ZHP A;  1RFK A;  2WXP A;  1KRH A;  2TSS A;  2PMV A;  1XF5 L;  2CJO A;  3AE3 B;  5C2T B;  1UUP A;  3W9C B;  4TQ1 A;  1T3Q A;  1YN5 A;  1J7C A;  2RMM A;  4P16 A;  1L4Z B;  2BT6 A;  3AEF B;  2WU2 B;  2ZW0 A;  1SE2 A;  4US8 A;  2GI9 A;  2W82 A;  1RM6 C;  2L32 A;  1YQ4 B;  1MHH E;  1I4X A;  4UDU C;  1MI0 A;  4A9A A;  3CWI A;  4LLG M;  3FC4 A;  2J42 A;  1CZP A;  1FRR A;  3B2G A;  3J9C A;  3P42 A;  4IOI E;  1PFD A;  2JZP A;  4XWT A;  3R2I A;  2BB5 A;  4OVZ A;  1AWD A;  1YN4 A;  2M19 A;  3GS2 A;  3KLS X;  3VRB B;  3B2F A;  3ZJU A;  1GAQ B;  3CIR B;  3AE6 B;  1N5X A;  1SE3 A;  1HQR D;  4HKQ A;  1FO4 A;  5AUI A;  3BYT B;  5T8I A;  1L4D B;  2WXF A;  2BS2 B;  3FAH A;  2WXQ A;  3V05 A;  2RDH A;  1ZE3 D;  1IGC A;  4YTM B;  1N61 A;  2SEB D;  2Y3A A;  1FNW A;  2JU6 X;  5C3J B;  4KKI A;  1CJE A;  5GXG B;  5BMG A;  1NEK B;  3P4S B;  1EM7 A;  4PT5 A;  4XDC A;  4B0M A;  4YSX B;  4L1B A;  1SJH D;  2J4X A;  4GDL B;  2X38 A;  2WXN A;  4XE0 A;  1R7S A;  3ZGZ A;  4GDK B;  5BYS A;  1YN3 A;  4KX6 B;  2WDV B;  2DYM A;  4JX1 C;  4WIP A;  3ZYY X;  1JQ4 A;  2LUM A;  3I9V 1;  4B0E A;  1XLO A;  2ACZ B;  3Q8B A;  4NAM A;  1UWX A;  1A70 A;  1PGX A;  3IAS 1;  1F0Z A;  4OZA A;  3FIL B;  2M0A A;  2OHF A;  3KWV A;  2KQ4 X;  4US9 A;  1FEH A;  1I4Q A;  4TSS A;  1V1O A;  3P4R B;  1BXT A;  1ZPS A;  2I38 A;  1JWM D;  5G5G A;  2AQ3 B;  1YJJ A;  1HZ6 A;  2LHE A;  3NVY A;  1K50 A;  1EU4 A;  1SIJ A;  4YT0 B;  4A55 A;  2AQ1 B;  4RGN A;  3OWE B;  3GB1 A;  3MP9 A;  1KF6 B;  1TKE A;  2PW9 A;  1Y56 A;  1VZ7 A;  2KWD A;  4ARC A;  1SBB B;  2NMQ A;  4ZRQ A;  2MH7 A;  1CQV A;  1I4P A;  1DOX A;  1MVK A;  2VZK B;  3IAM 1;  3P63 A;  3BYY B;  2BTE A;  1KTK A;  1HZ5 A;  1QOF A;  1OFF A;  3PZ7 A;  2BS4 B;  2R61 A;  3WCQ A;  1IBX B;  3BVZ A;  5EE1 A;  1QKZ A;  1E7P B;  3KWL A;  2J53 A;  2K0P A;  3NVW A;  4HRO A;  3B9J A;  2PKO A;  2WDR B;  3U4E G;  1IGD A;  1TY2 A;  3TEY A;  1ENF A;  5EE9 A;  2WP9 B;  4ARI A;  5FR3 A;  3NRZ A;  2Y5C A;  1QOG A;  1XCQ L;  1I7H A;  3GP7 A;  1SB3 C;  1OQR A;  2DLB A;  2LGI A;  4RF0 A;  4USA A;  4HJG E;  1UWM A;  3SEB A;  3I57 A;  1GOZ A;  2N7J A;  4OZB A;  5D7G A;  2YEP F;  1D5X C;  2PVG C;  2V4I B;  1C4P A;  2XN9 C;  3TUO A;  2Q5W D;  3AE9 B;  2JX5 A;  4XWW A;  2L52 A;  1NYQ A;  2WXG A;  3BWU D;  1EWC A;  3ETR A;  4MAC A;  1FFV A;  1C4A A;  1JCK B;  1XLQ A;  4LTU A;  3NUH B;  3DWM A;  5HHD G;  1RWS A;  1AYF A;  2K22 A;  2MJE A;  1L5P A;  3HRD D;  1FXI A;  2NTT A;  1KFY B;  2W55 A;  2WDQ B;  4WQM A;  1J7A A;  4YTP B;  2GB1 A;  3AE8 B;  2LFI A;  3W2D A;  1DOI A;  1VJK A;  2ZW1 A;  5EE3 A;  4NZL B;  3EUB 2;  3AEG B;  1KLG D;  1Q10 A;  1FM0 D;  4M0W A;  1TS5 A;  1V1P A;  2L83 A;  3P4P B;  3UI3 A;  2QMT A;  4C56 C;  2QEJ C;  1L0X B;  2OED A;  1E6E B;  5EE0 A;  2G9H D;  2WXJ A;  2G1E A;  5E6J A;  1VR9 A;  3MHZ A;  2IDY A;  2BBC A;  4P6V F;  2FE8 A;  4WWM A;  1XO3 A;  3C8Y A;  2JSV X;  4KKJ A;  5BMH A;  3VQI A;  2Z8L A;  4RCO A;  5HI1 A;  3TEZ A;  1QOA A;  5TSS A;  1SXT A;  2BS3 B;  4MM3 B;  4XDD A;  3RFZ B;  4C7Z A;  1J7B A;  3R2T A;  1B1Z A;  2JXT A;  3AB5 A;  5D3I B;  1JWA D;  1NEN B;  1XCT L;  1K53 A;  3URY A;  4YSZ B;  1TKG A;  1N63 A;  4WUR A;  4RGT A;  1DGJ A;  1VZ8 A;  3EA6 A;  4N58 A;  1WSP A;  2MJD A;  3W1S A;  1QOB A;  1ZDV A;  3BII D;  1I4G A;  4JWU C;  4OZC A;  1D4B A;  1PUT A;  1C76 A;  1DYQ A;  3T3N A;  2LJI A;  1ET6 A;  2KDM A;  1ZOY B;  1TY0 A;  1C79 A;  4AS1 A;  4YSY B;  4TQ0 A;  2PVO D;  2IGG A;  3KQ4 A;  4EE2 A;  1PGB A;  1PYW D;  5G5H A;  2V0G A;  3PO0 A;  2W3R A;  3U52 E;  2DWQ A;  3Q69 A;  1TS2 A;  4ZYS A;  2H88 B;  3NVV A;  4OHJ A;  2IGH A;  4RF1 A;  1EWY C;  2WS3 B;  1K52 A;  1F2R C;  1OQQ A;  2WXK A;  2BB6 A;  2W54 A;  4RNA A;  2Y5P A;  4HKZ E;  1P7E A;  5I4D A;  3EGR A;  3SFE B;  4A8X C;  2KAJ A;  2RDG A;  3ZJV A;  1F2R I;  2WU5 B;  2RPV A;  3Q8F A;  1ROE A;  3VRA B;  5FK9 C;  1JWB D;  1C9F A;  1HXY D;  1T6B X;  1L0V B;  3MJ5 A;  3LB8 C;  4RFB A;  1SF0 A;  1SE4 A;  4NJC A;  2WXH A;  1GB1 A;  1I4H A;  4DXF A;  2GRI A;  2MEK A;  4KGR A;  1V97 A;  2KAC A;  4ITK A;  2BW2 A;  2CU3 A;  2N0S B;  2WXR A;  2YEP B;  1ZUD 2;  3V3X A;  5HG2 A;  1FNU A;  4HEA 1;  2N9L A;  1JWS D;  1JWU D;  4KGS A;  3VR8 B;  3IT4 B;  3ABV B;  1FNV A;  2AX5 A;  2PIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...