2LJIA

Structure of a protein from haloferax volcanii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 2
total genus 5
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ljiA00
2L32A 2LJIA
chains in the Genus database with same CATH superfamily
1AN8A 1F52A 4LJPB 2L32A 3RULA 3R8BA 5IN7A 2DZJA 1TTNA 3FILB 3AEAB 5KHQA 2CU1A 2KX0A 3JW0X 3IAS1 2WXQA 2GMIC 2JYEA 3L08A 4P6VF 3TMPB 2DWQA 2K6DB 1RWSA 1E8XA 3RT3B 3KUZA 1SE2A 3SFEB 4RCOA 2HJ8A 4HCPB 4HPLB 3KYDD 4EEWA 2K5PA 2Y5BB 1D5MC 3PLVA 3ETRA 2KQ7A 2RD0A 1N63A 5HKHA 3WIMA 1GJZA 3VHTC 2KQ4X 1HZ5A 1E5WA 2BF8B 3DHGC 4DK5A 1UELA 5GMVA 2QILA 1WJUA 1G6JA 5AUIA 4OZAA 3DPDA 1T0YA 3GS2A 4OVUA 1TS5A 2FE8A 1KLGD 4ZRQA 1FXTB 1YX6B 2KTRA 4HLEA 1TS3A 1SB3C 1WRDB 2J0JA 2JXTA 5D3DA 4FHJA 4GU2A 1EM7A 2VZKD 4A3OA 1ET9A 4S17A 2BGFA 5D7GA 4IM3A 4BBNC 4NQLB 1UD7A 1V97A 1ACCA 3VTVA 1HE8A 2IYDB 4KIKA 1I42A 2L0TA 1GOZA 3AI5A 1V49A 3AE3B 1TZ1A 2NS5A 4HROA 3U52E 4JWSC 3ZNGC 3W9CB 3R66C 1EWCA 4LCDE 3L13A 2V4LA 2CHXA 2NPTA 4HJKA 2ZVOA 3JYUA 3MP9A 4QAYA 2AQ3B 1R4NI 4YTNB 4JL9A 4W9HA 1WE6A 1I4RA 3AEFB 2VZKB 4N59A 1ZOYB 1GPXA 1IUEA 2MCNB 1P9DU 4DHJB 3K9PB 2HTME 4AP4C 2R2QA 1NYQA 4C56C 5J2RA 2MBHA 3ZNID 1H4RA 4N9F4 4XYCA 3R7RA 1K52A 2ZNVC 2KK8A 1F1HA 2KQSA 2HD5B 1WYWB 5KHOA 2LUMA 1WGDA 5BMIA 1TBEA 2J42A 3HM6X 3E9SA 2LGDA 3VDZA 2L00B 3T9LA 5HHDG 4HRSA 3QK0A 4B0EA 2Z0EB 3SU8X 3QX1A 3AXCA 3I63C 1MJDA 3A33B 3B9JA 1DGJA 4DDID 2N9XA 1RLFA 1RM6C 3Q8AA 3HVDA 2J52A 3APFA 1LM8B 3SD5A 4W9KA 5JXVA 1E8ZA 4M8MA 1NDDA 4LLGM 1MHHE 1WR1A 2G4SA 5TR5A 4UDUC 1FNVA 4B9KA 4FLHA 1PGAA 2WXPA 3IFWB 1XT9B 3P4SB 5E6OA 2BW2A 5MPOA 1P3QU 4GIVA 2PE9A 2ZPYA 3W1YA 3KVFB 1I4HA 3RUIB 5C3JB 4NNJB 5DPTA 2IDYA 3VQIA 2JF5A 1VR9A 1AYFA 2E6XA 4FADA 1F2RC 2QDFA 3PVLA 3RI7C 3O65B 3QIJA 3I9V1 1WXAA 1TS2A 1RYJA 5H8YE 2LRUA 3HUIA 4MDKE 4US9A 3O13A 2KN5A 2K6QA 5FR3A 2RPVA 4RGTA 1R7SA 3A4SC 4ARIA 3Q2AC 3RNEC 1XQQA 3VRBB 4A6QA 2KO3A 2D3CA 4JLCA 3QA8A 5HG2A 2RDHA 3ZIMA 2PEAA 1ZP0B 4DHZB 2QJLA 4N6EB 3PZDA 3A1QB 4WWMA 3Q3MC 2AWTA 1YQBA 4TKNA 2G4DB 3APDA 5E6NA 2CHZA 1TT5B 2IGDA 2IGGA 2J53A 3N1ZC 2KDFB 4ZRIA 2MJ3A 2JXXA 3MC9A 3PT2B 2MRPA 2NTTA 1NENB 3Q8FA 2WXFA 3T8MA 3GOEA 4NJCA 2HDEA 4OVZA 4IOIE 4WWOA 1EUVB 2D2QA 3A9KB 2X8XX 2LHEA 5BYSA 4HKQA 5EE9A 1XO3A 4ASWC 3VUYA 2DLBA 2OJWA 1ESFA 2NBUA 3ZW3A 2EMTA 1WMHA 2WXJA 3A9JA 3BIID 4KDLB 3FC4A 3DBSA 5EE3A 2MX2A 3EFUA 3Q69A 4EZLA 5E6JA 3ZQ4A 1E9MA 1L4ZB 4ICUA 3VTWA 1P7FA 4M02A 3X0WA 4DXAB 4ZYNA 1P98A 1PFDA 4BKTA 3RNAC 2QIEB 1PQSA 4F1SA 3AE1B 3DBRB 3U7ZA 4N58A 3EECA 3H7PA 4LTUA 3IAM1 1FPYA 2JQRB 2KAJA 2MQJA 3DBRI 4MM3A 4B95A 2ZZPB 2DNFA 3AH7A 2BYEA 4W9LA 2ZW1A 4PS3A 1L2NA 2IGHA 4KKIA 5D94A 5JHAA 3BVZA 1JWAD 4FXCA 3VR9B 2GBNA 2FCSA 2LVPA 1JRPA 3QARA 3KW5B 1FRDA 2LGIA 4LDTD 2KMAA 1WX8A 3S2AA 4CHKA 3AN1A 4MSQB 2MP2B 4MELA 3PS6A 1D4BA 2MBBB 2BKFA 3ZNHB 1HQRD 2RMMA 3UQBA 1KF6B 1L7YA 2DYOA 2X38A 2PIAA 3N20C 1JWMD 1ROEA 1QOFA 2N7EA 4MT5A 1Z2MA 1SJHD 2AYOB 1MFWA 1JWUD 1N62A 2D5GA 4I6LB 4YSYB 3DVNU 3L4PA 1XLPA 3EGRA 2DAFA 1SE3A 5IAAC 3UINB 2MA9B 2JWZA 2W54A 2XNAC 3M3JA 1F0ZA 2MJEA 2WXLA 2D3BA 2NPTB 3ZXVA 2N7DA 4ZDVA 4XGAB 2XN9C 4YTPB 4GN1A 1ZE3D 3HK0A 3J9CA 5IKCM 2K25A 2KTFA 2GRIA 1NBFC 4BZAA 2A4ZA 3B0AA 2ZJDA 3KQ4A 4JIOU 1LQBA 3U2SC 1UGMA 2KXJA 2KLGA 2J4XA 2PTLA 2JY6A 1WXMA 4NPNA 1CJEA 4TV3A 4FBJB 4LNKA 1IBXB 4ITKA 3IT4B 4IWQA 4P16A 2BYFA 2RPQA 2R61A 3NS8A 2BB6A 1VRAB 2V3NA 3L54A 3X23A 1QLBB 2O2VB 4HWIB 1PDXA 5DPWA 1TY2A 4K3CA 3AU5A 1KM7A 2D10A 5IO9A 4C4VA 4GDLA 2G1EA 1CK1A 3Q14C 1T0SC 2DZMA 1WGHA 2IO0B 2KX3A 2LJIA 3C19A 2WXKA 2WNMA 3RZFA 4L2YA 2FBWB 1WR6E 1Z5SB 2MEKA 1YNTE 3NOBA 3ZJUA 2L76A 4WJPA 2N9EB 3IXSA 1WY8A 2INNE 2BS3B 2TSSA 1QOBA 4A20A 2MSED 3V05A 3SFDB 1UWXA 4F7ZA 1LXDA 1ZKHA 4RH6A 2A5UA 2LXAA 3WALA 2WQYB 4L23A 3D32A 2WU2B 1PYWD 4MJSB 2KTRB 4ZYSA 1FFUA 3A9JB 1WMHB 4RM8A 1IP9A 1FCCC 3UI3A 4TQ1A 3TEZA 2V0GA 2DBYA 4KZ0A 3OJ3A 5AUKA 2PJHA 3H1UA 1L5PA 4ZOHC 3AV8A 4JWUC 3CSFA 3H6NA 2D11A 3CMMB 2IPKD 3H8HA 4PYZA 1TYGB 1GG3A 2GB1A 3MJ5A 1JQ4A 4GB9A 1BUIC 1WGKA 1TKYA 2V3PA 1I4PA 2M4NA 3Q3OC 4XC2A 3N3KB 4G0NB 1V6EA 4URKA 4AJYB 4S0RA 3BK1A 1OQRA 2JZPA 2LUEA 4A9AA 1PGXA 4M01A 2EELA 3M62B 2N9KA 4WWPA 3TEWA 1YMHE 1JRUA 1YQ3B 3LB8C 1SBBB 3ZTCA 1EU4A 1XF5L 2GLSA 2K8CA 3BWUD 2ZNVB 1J7BA 2KYWA 4TSSA 3GE8C 1TZOA 4ANXA 5L83A 4KV2A 2MBOA 3NVYA 3ZDTA 4TQ0A 4DDGD 4IC7B 2M0XA 5EDSA 1X1MA 2O2VA 1K53A 1YOVB 4RGNA 3N1YC 1V86A 3HRDD 2JUOA 1L0VB 3I5JC 1WH3A 3VUXA 4W9JA 4HKZE 4XE0A 3PZ7A 2FNJB 2WWZA 2FCNA 3DBHI 4RM9A 2ICIA 1WJNA 2Y5PA 1XLOA 2GBKA 1CQVA 1E7VA 1XCQL 1L4DB 3TL5A 1BMLC 1T3QA 4E3CA 2UWQA 1UBQA 1VZ7A 2GBRA 3AECB 2PE6B 5DPSA 3NJTA 4IKGA 2PLPA 4GXBA 2FIDA 2DYBA 3RYTA 3QWZB 2BKRB 1EWYC 2KMCA 1C77A 3DVGX 2JYTA 1T6BX 4WH4A 3AEEB 3CWIA 2L05A 4II3B 3SR6A 1I4XA 4RFBA 1EF5A 2KWVB 3NVWA 4NJ7A 2J0KA 1B1ZA 4YTMB 3Q3FA 2WS3B 2YLMA 3V62A 4W9EA 1SIJA 2PVOD 1WGGA 2FUG1 1RFKA 2LASA 3RNFC 2M17A 3P42A 2KANA 4IUMB 1GNUA 4BVUC 1WM3A 2WYQA 4K81A 1YD8U 1ZDVA 4MEMA 2DENB 5FR6A 2INCC 3TIXA 1P1AA 3R2IA 4KVGB 4AWJA 1XEEA 2D3GA 4JGHB 4MSMB 4A8XC 5H92C 5LNK1 4GDKB 2AL3A 1EU3A 1NVID 2VH1A 5LLIA 1DOXA 1DOIA 1E8WA 3PRMB 4YL8A 5L95C 4A55A 2UYZB 1Q10A 3WA0A 3QC8B 2J7QB 1ZXIA 3BINA 2HTHA 5CHWA 1WRIA 1CMXB 4IM0A 2XBBC 2LGYA 2O6VB 1LGRA 3AE6B 2G3QB 2ASQA 1FO4A 2IO3B 4KSLC 3TBLD 2WXGA 3U8ZA 2M1MA 3OAWA 2MWSB 1MHXA 2DHZA 1KTKA 4C4VB 3Q6BA 4E71A 5C1ZA 2PMVA 1S1QB 1E7UA 3IHPC 3QQ8B 2WXRA 1B9RA 1I4QA 5CTRC 5HFYA 4WWNA 2WDVB 3NG0A 3PGEA 1BXTA 3FILA 2MH7A 4BKSD 4W9GA 1SSNA 1N5XA 3AE2B 2DYMA 4A3PA 2IJ0A 3GZNI 2KFKB 2WXMA 2O6VD 5DPRA 2B3AA 1U4AA 1STEA 2DZIA 3KLSX 1NI2A 2C7MB 2KNBA 3GP7A 1KJTA 4LDTB 3AEBB 2PKOA 4NJ6A 3VTUA 3PTFC 2KJRA 4IW0A 1WZ3A 4FA6A 1GB1A 3SDLC 1EO6A 3PRZA 3BK2A 1V5OA 1GC7A 3ZNZB 2AQ2B 3ZTDA 4LNIA 2W3RA 3ZVVA 4MJSA 2INPE 3DWGC 5CHVC 2L8JA 3NZ3A 3TCAA 3EFCA 1L0YB 4NAWB 2BS2B 1SXTA 5D3IB 4ACFA 3VUWA 4MM3B 5JZEB 1KRHA 2NBVB 4YSXB 2WX0A 5G5HA 3PV1A 1QOAA 2HJ1A 2G45B 1QQRA 1WXVA 1ZGUB 3AE4B 3MTNB 4MGZE 2ON8A 3LDZE 4EE2A 3I3TB 3CF6E 2KVRA 4MACA 2LVQA 4FHKA 4KSKC 1FCLA 2IY0B 1GC6A 3E56A 4RNAA 1WI0A 4BAXA 3HHMA 1ZXHA 3ZJTA 2CKHB 1KFYB 3FAHA 2N9LA 3WAPA 1FM0D 4TMAB 4LNNA 3AE9B 2N7JA 3PHWB 2V3SA 1N60A 3TSSA 4WJQA 1R4MI 2WGSA 4RF0A 1C3TA 2JRHA 3GZNB 4K7WA 5BMGA 3NHEB 3NRZA 1GUAB 4IM2A 1UF0A 2PPHA 4DQOC 3ZUNA 2LVOA 4MGKE 4ANUA 5G2NA 3TJPA 2I38A 2KWDA 1KH0A 3C0RB 2SAKA 2L83A 1A70A 3ZYYX 2KDMA 1C4CA 1VZ6A 2NBWB 2ZCBA 1QKZA 1E7PB 3DVNV 3APCA 2BTEA 3EC8A 2IO2B 2BT6A 5GXGB 3NVZA 2CHWA 4HXDA 5G5GA 1V80A 4BOSC 4EOYA 3ZLZA 1WJ6A 1JALA 4MGYE 4PK1A 4BBNF 2Z59B 2XK5B 4K7SA 1TIFA 3U30A 2N1VA 5CX3A 3ENEA 2O6VA 3UF8A 2LD9A 5BYQA 2N9PC 1F9JA 4LNFA 1HXYD 2IZVB 5FK9C 4M00A 1IGCA 2MBEA 2BPSA 2DX5B 2JZZA 5CHFA 1NI3A 3NY5A 3ML8A 3N32A 2KVZA 4DBGA 3V60A 2BYVE 4C80A 2LJ5A 2KFKA 5J17A 3U4EG 4ICVA 4B6WA 1OFFA 1J7CA 1V1PA 3UQAA 2AQ1B 2Z0DB 2RSUA 3R3MA 3AULA 1SF0A 3PREA 2LHDA 1WJ4A 5AZFA 1WF9A 1K8RB 4HJGE 4REZA 2ZEQA 2REXA 2RDGA 3RPFC 1AARA 2L7RA 4RMAA 3P4QB 2I1JA 3IT6B 2PVGC 2FUHB 3WAMA 4AUQC 3ECIA 5IP4D 4OZCA 3V3XA 3ABVB 4DWFA 3VRAB 4G3XB 4GSWA 4AQ7A 1KLVA 1MI0A 3V6EB 3MFGA 4OHJA 3AB5A 3ZJVA 3DVGY 4WQMA 4GOCA 3TUOA 4MH8A 2QHOA 2LRWA 3LXFA 1RFAA 2L52A 3DWMA 3VXWA 2KC1A 1L0XB 2XEWA 2Q5WD 4EFOA 3MC8A 5I4DA 1Q1OA 2KMMA 5EE1A 4GDKA 2KN4A 2JT4B 3AU4A 3URYA 3DBHB 2LI5A 1YX5B 3W2DA 1TJEA 2RR9A 3N1XC 3UGBB 3M95A 4XWWA 3RD2A 3WAOA 2KLCA 1D6EC 4BKGA 1WIAA 3RMKC 2DAJA 1PUTA 2W55A 1IGDA 3AEDB 3DBLB 1HA5A 4FJYA 4HK2A 2K8BA 2JZ3B 2OHFA 1UWMA 2MBQA 2JRIB 2BYTA 3BY4B 5FKAC 3ONSA 2KD0A 3ZO5B 4WURA 3JSVA 4ARCA 4Q2JA 1C1YB 3VVWB 4KKJA 4ZRJA 2BQQA 1C79A 2K0PA 5LXIB 1WGYA 2M56B 4RGOS 2M19A 1YQ4B 5TSSA 3AE5B 3MHZA 2QMTA 1SE9A 2JVCA 3RCZA 2LFIA 3WANA 5E6PA 1LFDA 2LWPA 4C00A 1ZDXA 2KJ6A 2C5LC 3R2TA 3R7QA 2WDTB 3KUCB 3JSVB 1OEYA 4WQOB 2FCMA 1UUPA 4EZKA 3WCQA 1OQYA 3BVMA 1MPEA 2WDRB 1XXGA 3DBLI 4PS8A 2GBMA 2KKCA 2D3AA 3Q8BA 2KWCA 4KGSA 1V1OA 1VLBA 1OQQA 1V81A 1YN5A 2WDQB 3B08A 1UBIA 1C78A 1P7EA 3UIPB 1E6EB 2GBJA 4FN2A 4P1BC 1ENFA 4ZHOA 4USAA 1ZUD2 4C7ZA 4FULA 4KZCA 4WAAA 1WM2A 1YJIA 4FJVB 4KX6B 1T0QC 2FAZA 4EUTA 4O1NA 3ML9A 4JQWC 3QCAA 1UZXB 2CJOA 5AZGA 1N6ZA 3BVGA 3DHHC 3JVZX 2W9NA 1QOGA 1DOYA 4I6NB 1D5XC 4K1RB 1JW9D 1Q0WB 1YJ1A 1ET6A 3DHIC 2J0MA 2BWES 3EA6A 1R4MB 2QCZA 4D2KA 2KWUB 3PO0A 4MGIE 3U7DA 2NTSA 5C23A 1JMLA 4JPSA 2OOBB 4WJNA 5AEKB 3RNBC 1VZ8A 2WU5B 3NS1A 3VH4B 1QILA 4YXDB 2L0FA 1MG4A 2WX1A 1CZPA 1RRBA 2K9XA 4BKSA 2KDEB 2NVUI 3VH3B 3B2FA 2W3SA 2K39A 1FIQA 2C60A 4II2B 2JX5A 1VCBA 3I57A 1HTQA 3SHQA 2GI9A 3ZDMC 3NZUA 3V61A 3BYYB 4BOZB 3H9DA 2BS4B 3W5VB 4US8A 3AE8B 2BVCA 1HZ6A 2CR5A 2V4IB 4P1CC 1GAQB 1C9FA 1N61A 1D5ZC 1TGZB 2INDC 3A4RA 1XLQA 2CU3A 1UGJA 4C7YA 3P63A 3PZ8A 1TS4A 4YWGG 1IYFA 1UH6A 4HCNB 3HVZA 4PT5A 1WX9A 4E74A 3NUHB 1S3SG 1FRRA 2N1WA 1C4AA 1GB4A 3N30A 3T3OA 2LXCA 3Q3NC 3CSTA 4ZHPA 4W9CA 1FMAD 3Q3JA 2MLBA 2KDBA 4HPMB 2QSDA 3UIOB 2WXHA 3QAQA 1JCKB 3A1QA 3RNCC 4AJWA 3ZGZA 2ZCCA 1NYRA 1I7HA 2EMSA 2MP2A 4KDIC 4DXGA 1Y8RC 2C7NB 2VH2A 1XD3B 1WYGA 4LJOB 2AEHA 5C2TB 3OWEB 3SEBA 3AE7B 1JROA 4RGMA 4EKUA 4JE3B 2LEKA 5IOIA 1VJKA 4FJZA 4W9DA 2WP9B 1OEYJ 1V8CA 1SIFA 2NMQA 2K1FA 3C8YA 1WXQA 3PHXB 1WX7A 5JHBA 2JWUA 3H7PB 4PYUA 3MHSD 3P4RB 4P7IA 3K9OB 2K8HA 4DHJD 4HDOA 5T8IA 2MW5A 3ZXRA 1FNWA 4LK0M 3RZWC 5D6JB 4NY0A 5AZHA 1TKEA 3VFKA 4OW0A 3GE3C 3L10B 3ZKJC 2WLBA 1K51A 1WXSA 2JPHA 3A9KA 2I2YA 2NR2A 2RDBC 3QHTA 4GMVA 4GGQA 5BO4B 2E3TA 3IVFA 2KDIA 1DYQA 1P0RA 2ZW0A 2KOXA 1WSPA 3MC0B 4J3OD 4RF1A 3B2GA 3OLMD 1C76A 2OJRA 1AWDA 4B0MA 1L6UA 2WHIA 3N9YC 5D2MB 4WAFA 2QEJC 3ALBA 4NQKE 4TUUA 3AM9A 4DXFA 1C4PA 4ZRKA 1F2RI 3OJ4B 2H89B 4KGRA 4K7UA 1T5XD 1D3ZA 1HEZE 4X57B 3ZRCA 3V6CB 1VD2A 1E90A 4BFRA 1UNSA 3EUB2 4JX1C 4M0WB 2KJHB 3KUDB 3QJZA 3NVVA 4F8CB 2QC8A 1JWBD 1PGBA 1XLNA 2ZVNA 4OVVA 4HPPA 3KWLA 1V1PB 2RGFA 3IG3A 2C9WB 4G50A 3PSEB 3H7SA 2PW9A 4J6IA 1SJED 1WGRA 4IWOA 2MHJA 1BT0A 3VR8B 1E0ZA 3PPAA 1T0RC 1JWSD 2XK5A 4XDDA 1E8YA 3VAWA 4CO7A 4DHZE 4IG7B 1E10A 3DDCB 2VRRB 5JH5C 1WWTA 1F77A 1XCTL 4H2AA 1TKGA 4AS1A 1QF6A 2IY1B 1V2YA 2H88B 2WXNA 1ZW7A 3Q8EA 4NAMA 3CIRB 2KT7A 4XDCA 3P4PB 4LNOA 1I4GA 4GDLB 1NEKB 2Y3AA 2YEPF 1WE7A 4WJOA 1WFYA 1I35A 4A90A 3LJ3A 3PRPB 1H8CA 3L17A 4WIPA 3TEXA 4KIKB 3T3NA 2LMCA 5BMHA 3TEYA 3OG5A 3EHVA 1R4NB 5IA7A 2I1KA 2EKIA 1TY0A 2KZRA 1LO5D 3AMZA 3DOWA 4I6PA 4AOFA 5G55A 3L0WB 2V1YA 4PS7A 1YIWA 1MVKA 4ZRPA 4G11A 2LZ6A 4GLSC 1FXIA 1N5WA 1VDVA 3NZSA 2C7HA 2KHWB 1EF1A 2UU7A 2CJNA 1HTOA 3KH0A 1YJJA 2ZPNA 2N0SB 2FCQA 1K50A 3HIZA 3GB1A 1M94A 1FFVA 1SEBD 1FD6A 4HVBA 4MH0E 2M0AA 4CQNA 1SGHA 2BWFA 2CS4A 4W9FA 3W1SA 2BB5A 1KLUD 3HM3A 1QZEA 4L1BA 2G9HD 4HEA1 2FIFA 4OZBA 4M8NA 2HE7A 2LGXA 3L16A 2K3UA 2JSVX 1WZ0A 4XZ4A 2IBIB 4YSZB 4ANVA 2L3ZA 3B1LX 1FXAA 5J18A 2W82A 4KGTA 1IPGA 2B76B 3P1MA 2NCNA 3DCGA 1M4VA 3BYTB 1ISNA 2KFJA 3RN9C 1FNUA 3IBEA 2K22A 2MJDA 2OEDA 1QT9A 3AEGB 3BZDB 2YVCA 1YN3A 2WXOA 3P2BA 2ONQA 1J19A 1OTRB 2Z8LA 4IDIA 2LGSA 1L6VA 3KWVA 2SEBD 4HDQA 2WXIA 1A5RA 3FKYA 1KOTA 4NAWA 5DCNA 2YEPB 4IWPA 3RFZB 3DQVA 3W1SC 2L1AA 4CYEA 1RAXA 3KYCD 2R2OA 4W9IA 3LYYA 3PLUA 4XX5A 1MG8A 2DZKA 2N4FA 3ZRFA 1Q5WB 4ANWA 2M8SA 2D07B 4R3DA 2JU6X 1IBXA 2KC2A 5BYRA 2KACA 3M63B 4K3BA 1Y56A 4XWTA 1J7AA 1V9JA 1V5TA 3RNGC 3MJWA 2IO1B 1OGWA 2V9HA 2EKEC 2AL6A 1AW7A 2AX5A 1J0GA 1YN4A 2ACZB 2BBCA 1SE4A 5LXHA 3Q8CA 4NZLB 4M0WA 2Y5CA 1FEHA 4EZJA 5HI1A 1ZPSA 5EE0A 4YT0B 3W5UB 2GOWA 1J8CA
chains in the Genus database with same CATH topology
2W54A 2XNAC 1AN8A 2W3RA 1F0ZA 2MJEA 3B2FA 2W3SA 2WXLA 2L32A 1FIQA 3R8BA 2JX5A 2XN9C 3I57A 4YTPB 3FILB 3AEAB 2GI9A 2INPE 1ZE3D 3BYYB 3DWGC 3IAS1 3J9CA 2WXQA 2JYEA 3NZ3A 2BS4B 4P6VF 3W5VB 2DWQA 2GRIA 1L0YB 3AE8B 2BS2B 4NAWB 4US8A 1SXTA 1HZ6A 1RWSA 5D3IB 2V4IB 1SE2A 3SFEB 4RCOA 3KQ4A 1GAQB 1C9FA 4MM3B 2K5PA 1N61A 1D5ZC 1KRHA 1D5MC 4YSXB 3ETRA 5G5HA 3U2SC 1QOAA 1XLQA 2J4XA 1N63A 2PTLA 1QQRA 1CJEA 2CU3A 1UGJA 4C7YA 3P63A 3PZ8A 3AE4B 2ON8A 1TS4A 2KQ4X 1IBXB 1HZ5A 4EE2A 4YWGG 4ITKA 3IT4B 4P16A 3HVZA 4MACA 2QILA 1FCLA 4PT5A 2R61A 2BB6A 5AUIA 3E56A 4RNAA 1VRAB 2V3NA 1QLBB 1ZXHA 4OZAA 1PDXA 3ZJTA 3NUHB 1TY2A 1FRRA 3GS2A 1TS5A 1C4AA 1KFYB 2FE8A 1KLGD 3FAHA 4ZRQA 2N9LA 1GB4A 1FM0D 3T3OA 4TMAB 3AE9B 2N7JA 4ZHPA 1FMAD 1TS3A 1SB3C 2G1EA 2JXTA 2QSDA 1CK1A 1N60A 3TSSA 5D3DA 2WXHA 1JCKB 4RF0A 2LJIA 1EM7A 5BMGA 3ZGZA 2VZKD 2WXKA 3NRZA 2WNMA 4DQOC 1ET9A 1NYRA 4L2YA 2FBWB 5D7GA 1I7HA 2MEKA 1YNTE 4DXGA 3ZJUA 1V97A 1ACCA 3IXSA 2INNE 2BS3B 1WYGA 1GOZA 2TSSA 1QOBA 2I38A 2KWDA 1KH0A 3AE3B 3V05A 2SAKA 5C2TB 2L83A 4HROA 1A70A 3SFDB 3ZYYX 2KDMA 3OWEB 1UWXA 3SEBA 4RH6A 3AE7B 3U52E 1JROA 1C4CA 4JWSC 1VZ6A 2WQYB 3W9CB 4L23A 4RGMA 4JE3B 1QKZA 2LEKA 2WU2B 1VJKA 1E7PB 1PYWD 4ZYSA 1EWCA 2WP9B 2BTEA 1FFUA 1V8CA 2NMQA 3C8YA 1FCCC 3UI3A 2BT6A 5GXGB 1WXQA 3NVZA 4TQ1A 3TEZA 2JWUA 2V0GA 2DBYA 5AUKA 5G5GA 3MP9A 1L5PA 2AQ3B 3P4RB 4ZOHC 4YTNB 3AV8A 4JWUC 1I4RA 3AEFB 5T8IA 1JALA 2VZKB 4N59A 1ZOYB 1FNWA 1GPXA 4LK0M 2IPKD 3H8HA 1TKEA 1TYGB 2GB1A 1IUEA 3MJ5A 1JQ4A 4OW0A 2HTME 1BUIC 1WGKA 1TKYA 2V3PA 2WLBA 1I4PA 1K51A 5BYQA 1NYQA 4C56C 1HXYD 2I2YA 3BK1A 5FK9C 1OQRA 2JZPA 1IGCA 1K52A 2E3TA 4A9AA 1PGXA 1DYQA 2ZW0A 1NI3A 2EELA 1WSPA 2N9KA 3TEWA 3MC0B 4J3OD 4RF1A 2LUMA 1YMHE 3B2GA 1YQ3B 5BMIA 2J42A 3LB8C 1C76A 1SBBB 1EU4A 1AWDA 1XF5L 3E9SA 4B0MA 3BWUD 1J7BA 4C80A 5HHDG 4HRSA 1L6UA 4TSSA 3U4EG 3N9YC 4WAFA 4B0EA 1TZOA 1OFFA 2QEJC 1J7CA 1V1PA 2AQ1B 3NVYA 3AM9A 3B9JA 1C4PA 4DXFA 4TQ0A 1SF0A 1F2RI 2H89B 2LHDA 1DGJA 4KGRA 1K53A 1T5XD 4RGNA 4HJGE 4REZA 1HEZE 2RDGA 3RPFC 1RM6C 1UNSA 3HRDD 3EUB2 4JX1C 1L0VB 3Q8AA 3HVDA 3P4QB 3NVVA 2J52A 4HKZE 4XE0A 1JWBD 1PGBA 1XLNA 3PZ7A 5JXVA 3IT6B 3KWLA 1V1PB 2PVGC 4LLGM 4OZCA 1MHHE 3V3XA 2ICIA 2PW9A 2Y5PA 1XLOA 1SJED 4UDUC 3ABVB 1CQVA 3VRAB 1FNVA 4AQ7A 1XCQL 1L4DB 1PGAA 3VR8B 2WXPA 1E0ZA 1BMLC 1JWSD 1MI0A 3P4SB 4XDDA 1T3QA 3MFGA 4OHJA 2BW2A 3AB5A 5MPOA 1VZ7A 3ZJVA 4WQMA 1E10A 1I4HA 3TUOA 3AECB 4IKGA 1WWTA 2PLPA 4MH8A 1F77A 1XCTL 4H2AA 3LXFA 2L52A 1TKGA 5C3JB 4AS1A 3DWMA 1EWYC 1QF6A 1C77A 2H88B 2IDYA 2WXNA 3VQIA 3Q8EA 1L0XB 2JYTA 1T6BX 1VR9A 4NAMA 4WH4A 3CIRB 1AYFA 4XDCA 2E6XA 3P4PB 1F2RC 1I4GA 4GDLB 1NEKB 3AEEB 3CWIA 3SR6A 2Q5WD 2Y3AA 1I4XA 5I4DA 4RFBA 2KMMA 2YEPF 5EE1A 3I9V1 3NVWA 2KN4A 1TS2A 1RYJA 5H8YE 3HUIA 4US9A 3O13A 3URYA 1B1ZA 4A90A 4YTMB 5FR3A 2RPVA 4RGTA 1R7SA 4ARIA 4WIPA 2WS3B 3TEXA 3VRBB 3T3NA 4A6QA 2LMCA 5BMHA 3TEYA 3W2DA 1SIJA 1TJEA 2PVOD 5HG2A 2FUG1 2RDHA 4XWWA 1RFKA 1D6EC 1TY0A 2EKIA 3AMZA 1LO5D 1ZP0B 2QJLA 3P42A 4N6EB 1PUTA 2W55A 1IGDA 3AEDB 4WWMA 1HA5A 1MVKA 1ZDVA 2IGDA 4ZRPA 2IGGA 2J53A 4GLSC 1FXIA 1N5WA 1VDVA 2OHFA 2MJ3A 1UWMA 3R2IA 2BYTA 5FKAC 1XEEA 2NTTA 1NENB 4WURA 2CJNA 3Q8FA 4ARCA 4Q2JA 1YJJA 2N0SB 1K50A 4KKJA 2WXFA 3GB1A 1FFVA 1C79A 2K0PA 1SEBD 4NJCA 1FD6A 4A8XC 5H92C 5LNK1 2M56B 2HDEA 4GDKB 4OVZA 2M0AA 4IOIE 4RGOS 4CQNA 1EU3A 1NVID 1YQ4B 2M19A 5TSSA 1DOXA 3W1SA 2BB5A 3AE5B 3MHZA 1KLUD 1DOIA 2LHEA 2QMTA 5BYSA 4HKQA 4L1BA 5EE9A 2G9HD 1XO3A 4HEA1 4OZBA 4A55A 1Q10A 2DLBA 2LFIA 1ZDXA 1ESFA 1ZXIA 2K3UA 2WXJA 3BIID 2JSVX 3R2TA 3FC4A 4YSZB 1WRIA 1UUPA 5EE3A 3WCQA 3BVMA 1MPEA 3Q69A 1FXAA 2WDRB 1XXGA 2W82A 4KGTA 2B76B 3P1MA 1M4VA 3BYTB 3AE6B 5E6JA 3Q8BA 4KGSA 1FO4A 1FNUA 2K22A 3ZQ4A 2MJDA 2OEDA 1QT9A 1V1OA 3AEGB 1VLBA 3BZDB 1E9MA 1OQQA 1L4ZB 2WXGA 1YN5A 1YN3A 2WDQB 1P7FA 2WXOA 2ONQA 1C78A 1MHXA 1P7EA 2Z8LA 1E6EB 1KTKA 1PFDA 4IDIA 1L6VA 1ENFA 3KWVA 4USAA 4ZHOA 1ZUD2 2QIEB 2SEBD 2PMVA 4C7ZA 3AE1B 2WXIA 3U7ZA 4N58A 1YJIA 2YEPB 4KX6B 2WXRA 3RFZB 1B9RA 4LTUA 1I4QA 3IAM1 2L1AA 5HFYA 2JQRB 2KAJA 2WDVB 4O1NA 3LYYA 1BXTA 2CJOA 3FILA 2MH7A 3AH7A 2ZW1A 3BVGA 2IGHA 1SSNA 4R3DA 2JU6X 4KKIA 1QOGA 1DOYA 1N5XA 1IBXA 3BVZA 5BYRA 1JWAD 3AE2B 4FXCA 2KACA 3VR9B 2DYMA 1D5XC 1Y56A 1JW9D 4XWTA 1J7AA 1JRPA 2IJ0A 2WXMA 1FRDA 1ET6A 2LGIA 3EA6A 4D2KA 3PO0A 3AN1A 1STEA 3KLSX 1AW7A 2AX5A 3GP7A 1YN4A 2ACZB 2BBCA 2NTSA 1D4BA 1JMLA 1SE4A 4JPSA 1HQRD 2RMMA 3AEBB 3Q8CA 2PKOA 1KF6B 2DYOA 2X38A 4NZLB 2PIAA 1JWMD 1ROEA 1QOFA 1VZ8A 2Y5CA 4M0WA 1FEHA 4MT5A 2WU5B 5HI1A 1SJHD 3NS1A 2D5GA 1JWUD 1N62A 4YSYB 1GB1A 1QILA 3L4PA 4YXDB 1XLPA 1ZPSA 3EGRA 5EE0A 1SE3A 1CZPA 3BK2A 4YT0B 3W5UB 2K9XA 2AQ2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L32 A;  2LJI A; 
#chains in the Genus database with same CATH topology
 1AN8 A;  1F52 A;  4LJP B;  2L32 A;  3RUL A;  3R8B A;  5IN7 A;  2DZJ A;  1TTN A;  3FIL B;  3AEA B;  5KHQ A;  2CU1 A;  2KX0 A;  3JW0 X;  3IAS 1;  2WXQ A;  2GMI C;  2JYE A;  3L08 A;  4P6V F;  3TMP B;  2DWQ A;  2K6D B;  1RWS A;  1E8X A;  3RT3 B;  3KUZ A;  1SE2 A;  3SFE B;  4RCO A;  2HJ8 A;  4HCP B;  4HPL B;  3KYD D;  4EEW A;  2K5P A;  2Y5B B;  1D5M C;  3PLV A;  3ETR A;  2KQ7 A;  2RD0 A;  1N63 A;  5HKH A;  3WIM A;  1GJZ A;  3VHT C;  2KQ4 X;  1HZ5 A;  1E5W A;  2BF8 B;  3DHG C;  4DK5 A;  1UEL A;  5GMV A;  2QIL A;  1WJU A;  1G6J A;  5AUI A;  4OZA A;  3DPD A;  1T0Y A;  3GS2 A;  4OVU A;  1TS5 A;  2FE8 A;  1KLG D;  4ZRQ A;  1FXT B;  1YX6 B;  2KTR A;  4HLE A;  1TS3 A;  1SB3 C;  1WRD B;  2J0J A;  2JXT A;  5D3D A;  4FHJ A;  4GU2 A;  1EM7 A;  2VZK D;  4A3O A;  1ET9 A;  4S17 A;  2BGF A;  5D7G A;  4IM3 A;  4BBN C;  4NQL B;  1UD7 A;  1V97 A;  1ACC A;  3VTV A;  1HE8 A;  2IYD B;  4KIK A;  1I42 A;  2L0T A;  1GOZ A;  3AI5 A;  1V49 A;  3AE3 B;  1TZ1 A;  2NS5 A;  4HRO A;  3U52 E;  4JWS C;  3ZNG C;  3W9C B;  3R66 C;  1EWC A;  4LCD E;  3L13 A;  2V4L A;  2CHX A;  2NPT A;  4HJK A;  2ZVO A;  3JYU A;  3MP9 A;  4QAY A;  2AQ3 B;  1R4N I;  4YTN B;  4JL9 A;  4W9H A;  1WE6 A;  1I4R A;  3AEF B;  2VZK B;  4N59 A;  1ZOY B;  1GPX A;  1IUE A;  2MCN B;  1P9D U;  4DHJ B;  3K9P B;  2HTM E;  4AP4 C;  2R2Q A;  1NYQ A;  4C56 C;  5J2R A;  2MBH A;  3ZNI D;  1H4R A;  4N9F 4;  4XYC A;  3R7R A;  1K52 A;  2ZNV C;  2KK8 A;  1F1H A;  2KQS A;  2HD5 B;  1WYW B;  5KHO A;  2LUM A;  1WGD A;  5BMI A;  1TBE A;  2J42 A;  3HM6 X;  3E9S A;  2LGD A;  3VDZ A;  2L00 B;  3T9L A;  5HHD G;  4HRS A;  3QK0 A;  4B0E A;  2Z0E B;  3SU8 X;  3QX1 A;  3AXC A;  3I63 C;  1MJD A;  3A33 B;  3B9J A;  1DGJ A;  4DDI D;  2N9X A;  1RLF A;  1RM6 C;  3Q8A A;  3HVD A;  2J52 A;  3APF A;  1LM8 B;  3SD5 A;  4W9K A;  5JXV A;  1E8Z A;  4M8M A;  1NDD A;  4LLG M;  1MHH E;  1WR1 A;  2G4S A;  5TR5 A;  4UDU C;  1FNV A;  4B9K A;  4FLH A;  1PGA A;  2WXP A;  3IFW B;  1XT9 B;  3P4S B;  5E6O A;  2BW2 A;  5MPO A;  1P3Q U;  4GIV A;  2PE9 A;  2ZPY A;  3W1Y A;  3KVF B;  1I4H A;  3RUI B;  5C3J B;  4NNJ B;  5DPT A;  2IDY A;  3VQI A;  2JF5 A;  1VR9 A;  1AYF A;  2E6X A;  4FAD A;  1F2R C;  2QDF A;  3PVL A;  3RI7 C;  3O65 B;  3QIJ A;  3I9V 1;  1WXA A;  1TS2 A;  1RYJ A;  5H8Y E;  2LRU A;  3HUI A;  4MDK E;  4US9 A;  3O13 A;  2KN5 A;  2K6Q A;  5FR3 A;  2RPV A;  4RGT A;  1R7S A;  3A4S C;  4ARI A;  3Q2A C;  3RNE C;  1XQQ A;  3VRB B;  4A6Q A;  2KO3 A;  2D3C A;  4JLC A;  3QA8 A;  5HG2 A;  2RDH A;  3ZIM A;  2PEA A;  1ZP0 B;  4DHZ B;  2QJL A;  4N6E B;  3PZD A;  3A1Q B;  4WWM A;  3Q3M C;  2AWT A;  1YQB A;  4TKN A;  2G4D B;  3APD A;  5E6N A;  2CHZ A;  1TT5 B;  2IGD A;  2IGG A;  2J53 A;  3N1Z C;  2KDF B;  4ZRI A;  2MJ3 A;  2JXX A;  3MC9 A;  3PT2 B;  2MRP A;  2NTT A;  1NEN B;  3Q8F A;  2WXF A;  3T8M A;  3GOE A;  4NJC A;  2HDE A;  4OVZ A;  4IOI E;  4WWO A;  1EUV B;  2D2Q A;  3A9K B;  2X8X X;  2LHE A;  5BYS A;  4HKQ A;  5EE9 A;  1XO3 A;  4ASW C;  3VUY A;  2DLB A;  2OJW A;  1ESF A;  2NBU A;  3ZW3 A;  2EMT A;  1WMH A;  2WXJ A;  3A9J A;  3BII D;  4KDL B;  3FC4 A;  3DBS A;  5EE3 A;  2MX2 A;  3EFU A;  3Q69 A;  4EZL A;  5E6J A;  3ZQ4 A;  1E9M A;  1L4Z B;  4ICU A;  3VTW A;  1P7F A;  4M02 A;  3X0W A;  4DXA B;  4ZYN A;  1P98 A;  1PFD A;  4BKT A;  3RNA C;  2QIE B;  1PQS A;  4F1S A;  3AE1 B;  3DBR B;  3U7Z A;  4N58 A;  3EEC A;  3H7P A;  4LTU A;  3IAM 1;  1FPY A;  2JQR B;  2KAJ A;  2MQJ A;  3DBR I;  4MM3 A;  4B95 A;  2ZZP B;  2DNF A;  3AH7 A;  2BYE A;  4W9L A;  2ZW1 A;  4PS3 A;  1L2N A;  2IGH A;  4KKI A;  5D94 A;  5JHA A;  3BVZ A;  1JWA D;  4FXC A;  3VR9 B;  2GBN A;  2FCS A;  2LVP A;  1JRP A;  3QAR A;  3KW5 B;  1FRD A;  2LGI A;  4LDT D;  2KMA A;  1WX8 A;  3S2A A;  4CHK A;  3AN1 A;  4MSQ B;  2MP2 B;  4MEL A;  3PS6 A;  1D4B A;  2MBB B;  2BKF A;  3ZNH B;  1HQR D;  2RMM A;  3UQB A;  1KF6 B;  1L7Y A;  2DYO A;  2X38 A;  2PIA A;  3N20 C;  1JWM D;  1ROE A;  1QOF A;  2N7E A;  4MT5 A;  1Z2M A;  1SJH D;  2AYO B;  1MFW A;  1JWU D;  1N62 A;  2D5G A;  4I6L B;  4YSY B;  3DVN U;  3L4P A;  1XLP A;  3EGR A;  2DAF A;  1SE3 A;  5IAA C;  3UIN B;  2MA9 B;  2JWZ A;  2W54 A;  2XNA C;  3M3J A;  1F0Z A;  2MJE A;  2WXL A;  2D3B A;  2NPT B;  3ZXV A;  2N7D A;  4ZDV A;  4XGA B;  2XN9 C;  4YTP B;  4GN1 A;  1ZE3 D;  3HK0 A;  3J9C A;  5IKC M;  2K25 A;  2KTF A;  2GRI A;  1NBF C;  4BZA A;  2A4Z A;  3B0A A;  2ZJD A;  3KQ4 A;  4JIO U;  1LQB A;  3U2S C;  1UGM A;  2KXJ A;  2KLG A;  2J4X A;  2PTL A;  2JY6 A;  1WXM A;  4NPN A;  1CJE A;  4TV3 A;  4FBJ B;  4LNK A;  1IBX B;  4ITK A;  3IT4 B;  4IWQ A;  4P16 A;  2BYF A;  2RPQ A;  2R61 A;  3NS8 A;  2BB6 A;  1VRA B;  2V3N A;  3L54 A;  3X23 A;  1QLB B;  2O2V B;  4HWI B;  1PDX A;  5DPW A;  1TY2 A;  4K3C A;  3AU5 A;  1KM7 A;  2D10 A;  5IO9 A;  4C4V A;  4GDL A;  2G1E A;  1CK1 A;  3Q14 C;  1T0S C;  2DZM A;  1WGH A;  2IO0 B;  2KX3 A;  2LJI A;  3C19 A;  2WXK A;  2WNM A;  3RZF A;  4L2Y A;  2FBW B;  1WR6 E;  1Z5S B;  2MEK A;  1YNT E;  3NOB A;  3ZJU A;  2L76 A;  4WJP A;  2N9E B;  3IXS A;  1WY8 A;  2INN E;  2BS3 B;  2TSS A;  1QOB A;  4A20 A;  2MSE D;  3V05 A;  3SFD B;  1UWX A;  4F7Z A;  1LXD A;  1ZKH A;  4RH6 A;  2A5U A;  2LXA A;  3WAL A;  2WQY B;  4L23 A;  3D32 A;  2WU2 B;  1PYW D;  4MJS B;  2KTR B;  4ZYS A;  1FFU A;  3A9J B;  1WMH B;  4RM8 A;  1IP9 A;  1FCC C;  3UI3 A;  4TQ1 A;  3TEZ A;  2V0G A;  2DBY A;  4KZ0 A;  3OJ3 A;  5AUK A;  2PJH A;  3H1U A;  1L5P A;  4ZOH C;  3AV8 A;  4JWU C;  3CSF A;  3H6N A;  2D11 A;  3CMM B;  2IPK D;  3H8H A;  4PYZ A;  1TYG B;  1GG3 A;  2GB1 A;  3MJ5 A;  1JQ4 A;  4GB9 A;  1BUI C;  1WGK A;  1TKY A;  2V3P A;  1I4P A;  2M4N A;  3Q3O C;  4XC2 A;  3N3K B;  4G0N B;  1V6E A;  4URK A;  4AJY B;  4S0R A;  3BK1 A;  1OQR A;  2JZP A;  2LUE A;  4A9A A;  1PGX A;  4M01 A;  2EEL A;  3M62 B;  2N9K A;  4WWP A;  3TEW A;  1YMH E;  1JRU A;  1YQ3 B;  3LB8 C;  1SBB B;  3ZTC A;  1EU4 A;  1XF5 L;  2GLS A;  2K8C A;  3BWU D;  2ZNV B;  1J7B A;  2KYW A;  4TSS A;  3GE8 C;  1TZO A;  4ANX A;  5L83 A;  4KV2 A;  2MBO A;  3NVY A;  3ZDT A;  4TQ0 A;  4DDG D;  4IC7 B;  2M0X A;  5EDS A;  1X1M A;  2O2V A;  1K53 A;  1YOV B;  4RGN A;  3N1Y C;  1V86 A;  3HRD D;  2JUO A;  1L0V B;  3I5J C;  1WH3 A;  3VUX A;  4W9J A;  4HKZ E;  4XE0 A;  3PZ7 A;  2FNJ B;  2WWZ A;  2FCN A;  3DBH I;  4RM9 A;  2ICI A;  1WJN A;  2Y5P A;  1XLO A;  2GBK A;  1CQV A;  1E7V A;  1XCQ L;  1L4D B;  3TL5 A;  1BML C;  1T3Q A;  4E3C A;  2UWQ A;  1UBQ A;  1VZ7 A;  2GBR A;  3AEC B;  2PE6 B;  5DPS A;  3NJT A;  4IKG A;  2PLP A;  4GXB A;  2FID A;  2DYB A;  3RYT A;  3QWZ B;  2BKR B;  1EWY C;  2KMC A;  1C77 A;  3DVG X;  2JYT A;  1T6B X;  4WH4 A;  3AEE B;  3CWI A;  2L05 A;  4II3 B;  3SR6 A;  1I4X A;  4RFB A;  1EF5 A;  2KWV B;  3NVW A;  4NJ7 A;  2J0K A;  1B1Z A;  4YTM B;  3Q3F A;  2WS3 B;  2YLM A;  3V62 A;  4W9E A;  1SIJ A;  2PVO D;  1WGG A;  2FUG 1;  1RFK A;  2LAS A;  3RNF C;  2M17 A;  3P42 A;  2KAN A;  4IUM B;  1GNU A;  4BVU C;  1WM3 A;  2WYQ A;  4K81 A;  1YD8 U;  1ZDV A;  4MEM A;  2DEN B;  5FR6 A;  2INC C;  3TIX A;  1P1A A;  3R2I A;  4KVG B;  4AWJ A;  1XEE A;  2D3G A;  4JGH B;  4MSM B;  4A8X C;  5H92 C;  5LNK 1;  4GDK B;  2AL3 A;  1EU3 A;  1NVI D;  2VH1 A;  5LLI A;  1DOX A;  1DOI A;  1E8W A;  3PRM B;  4YL8 A;  5L95 C;  4A55 A;  2UYZ B;  1Q10 A;  3WA0 A;  3QC8 B;  2J7Q B;  1ZXI A;  3BIN A;  2HTH A;  5CHW A;  1WRI A;  1CMX B;  4IM0 A;  2XBB C;  2LGY A;  2O6V B;  1LGR A;  3AE6 B;  2G3Q B;  2ASQ A;  1FO4 A;  2IO3 B;  4KSL C;  3TBL D;  2WXG A;  3U8Z A;  2M1M A;  3OAW A;  2MWS B;  1MHX A;  2DHZ A;  1KTK A;  4C4V B;  3Q6B A;  4E71 A;  5C1Z A;  2PMV A;  1S1Q B;  1E7U A;  3IHP C;  3QQ8 B;  2WXR A;  1B9R A;  1I4Q A;  5CTR C;  5HFY A;  4WWN A;  2WDV B;  3NG0 A;  3PGE A;  1BXT A;  3FIL A;  2MH7 A;  4BKS D;  4W9G A;  1SSN A;  1N5X A;  3AE2 B;  2DYM A;  4A3P A;  2IJ0 A;  3GZN I;  2KFK B;  2WXM A;  2O6V D;  5DPR A;  2B3A A;  1U4A A;  1STE A;  2DZI A;  3KLS X;  1NI2 A;  2C7M B;  2KNB A;  3GP7 A;  1KJT A;  4LDT B;  3AEB B;  2PKO A;  4NJ6 A;  3VTU A;  3PTF C;  2KJR A;  4IW0 A;  1WZ3 A;  4FA6 A;  1GB1 A;  3SDL C;  1EO6 A;  3PRZ A;  3BK2 A;  1V5O A;  1GC7 A;  3ZNZ B;  2AQ2 B;  3ZTD A;  4LNI A;  2W3R A;  3ZVV A;  4MJS A;  2INP E;  3DWG C;  5CHV C;  2L8J A;  3NZ3 A;  3TCA A;  3EFC A;  1L0Y B;  4NAW B;  2BS2 B;  1SXT A;  5D3I B;  4ACF A;  3VUW A;  4MM3 B;  5JZE B;  1KRH A;  2NBV B;  4YSX B;  2WX0 A;  5G5H A;  3PV1 A;  1QOA A;  2HJ1 A;  2G45 B;  1QQR A;  1WXV A;  1ZGU B;  3AE4 B;  3MTN B;  4MGZ E;  2ON8 A;  3LDZ E;  4EE2 A;  3I3T B;  3CF6 E;  2KVR A;  4MAC A;  2LVQ A;  4FHK A;  4KSK C;  1FCL A;  2IY0 B;  1GC6 A;  3E56 A;  4RNA A;  1WI0 A;  4BAX A;  3HHM A;  1ZXH A;  3ZJT A;  2CKH B;  1KFY B;  3FAH A;  2N9L A;  3WAP A;  1FM0 D;  4TMA B;  4LNN A;  3AE9 B;  2N7J A;  3PHW B;  2V3S A;  1N60 A;  3TSS A;  4WJQ A;  1R4M I;  2WGS A;  4RF0 A;  1C3T A;  2JRH A;  3GZN B;  4K7W A;  5BMG A;  3NHE B;  3NRZ A;  1GUA B;  4IM2 A;  1UF0 A;  2PPH A;  4DQO C;  3ZUN A;  2LVO A;  4MGK E;  4ANU A;  5G2N A;  3TJP A;  2I38 A;  2KWD A;  1KH0 A;  3C0R B;  2SAK A;  2L83 A;  1A70 A;  3ZYY X;  2KDM A;  1C4C A;  1VZ6 A;  2NBW B;  2ZCB A;  1QKZ A;  1E7P B;  3DVN V;  3APC A;  2BTE A;  3EC8 A;  2IO2 B;  2BT6 A;  5GXG B;  3NVZ A;  2CHW A;  4HXD A;  5G5G A;  1V80 A;  4BOS C;  4EOY A;  3ZLZ A;  1WJ6 A;  1JAL A;  4MGY E;  4PK1 A;  4BBN F;  2Z59 B;  2XK5 B;  4K7S A;  1TIF A;  3U30 A;  2N1V A;  5CX3 A;  3ENE A;  2O6V A;  3UF8 A;  2LD9 A;  5BYQ A;  2N9P C;  1F9J A;  4LNF A;  1HXY D;  2IZV B;  5FK9 C;  4M00 A;  1IGC A;  2MBE A;  2BPS A;  2DX5 B;  2JZZ A;  5CHF A;  1NI3 A;  3NY5 A;  3ML8 A;  3N32 A;  2KVZ A;  4DBG A;  3V60 A;  2BYV E;  4C80 A;  2LJ5 A;  2KFK A;  5J17 A;  3U4E G;  4ICV A;  4B6W A;  1OFF A;  1J7C A;  1V1P A;  3UQA A;  2AQ1 B;  2Z0D B;  2RSU A;  3R3M A;  3AUL A;  1SF0 A;  3PRE A;  2LHD A;  1WJ4 A;  5AZF A;  1WF9 A;  1K8R B;  4HJG E;  4REZ A;  2ZEQ A;  2REX A;  2RDG A;  3RPF C;  1AAR A;  2L7R A;  4RMA A;  3P4Q B;  2I1J A;  3IT6 B;  2PVG C;  2FUH B;  3WAM A;  4AUQ C;  3ECI A;  5IP4 D;  4OZC A;  3V3X A;  3ABV B;  4DWF A;  3VRA B;  4G3X B;  4GSW A;  4AQ7 A;  1KLV A;  1MI0 A;  3V6E B;  3MFG A;  4OHJ A;  3AB5 A;  3ZJV A;  3DVG Y;  4WQM A;  4GOC A;  3TUO A;  4MH8 A;  2QHO A;  2LRW A;  3LXF A;  1RFA A;  2L52 A;  3DWM A;  3VXW A;  2KC1 A;  1L0X B;  2XEW A;  2Q5W D;  4EFO A;  3MC8 A;  5I4D A;  1Q1O A;  2KMM A;  5EE1 A;  4GDK A;  2KN4 A;  2JT4 B;  3AU4 A;  3URY A;  3DBH B;  2LI5 A;  1YX5 B;  3W2D A;  1TJE A;  2RR9 A;  3N1X C;  3UGB B;  3M95 A;  4XWW A;  3RD2 A;  3WAO A;  2KLC A;  1D6E C;  4BKG A;  1WIA A;  3RMK C;  2DAJ A;  1PUT A;  2W55 A;  1IGD A;  3AED B;  3DBL B;  1HA5 A;  4FJY A;  4HK2 A;  2K8B A;  2JZ3 B;  2OHF A;  1UWM A;  2MBQ A;  2JRI B;  2BYT A;  3BY4 B;  5FKA C;  3ONS A;  2KD0 A;  3ZO5 B;  4WUR A;  3JSV A;  4ARC A;  4Q2J A;  1C1Y B;  3VVW B;  4KKJ A;  4ZRJ A;  2BQQ A;  1C79 A;  2K0P A;  5LXI B;  1WGY A;  2M56 B;  4RGO S;  2M19 A;  1YQ4 B;  5TSS A;  3AE5 B;  3MHZ A;  2QMT A;  1SE9 A;  2JVC A;  3RCZ A;  2LFI A;  3WAN A;  5E6P A;  1LFD A;  2LWP A;  4C00 A;  1ZDX A;  2KJ6 A;  2C5L C;  3R2T A;  3R7Q A;  2WDT B;  3KUC B;  3JSV B;  1OEY A;  4WQO B;  2FCM A;  1UUP A;  4EZK A;  3WCQ A;  1OQY A;  3BVM A;  1MPE A;  2WDR B;  1XXG A;  3DBL I;  4PS8 A;  2GBM A;  2KKC A;  2D3A A;  3Q8B A;  2KWC A;  4KGS A;  1V1O A;  1VLB A;  1OQQ A;  1V81 A;  1YN5 A;  2WDQ B;  3B08 A;  1UBI A;  1C78 A;  1P7E A;  3UIP B;  1E6E B;  2GBJ A;  4FN2 A;  4P1B C;  1ENF A;  4ZHO A;  4USA A;  1ZUD 2;  4C7Z A;  4FUL A;  4KZC A;  4WAA A;  1WM2 A;  1YJI A;  4FJV B;  4KX6 B;  1T0Q C;  2FAZ A;  4EUT A;  4O1N A;  3ML9 A;  4JQW C;  3QCA A;  1UZX B;  2CJO A;  5AZG A;  1N6Z A;  3BVG A;  3DHH C;  3JVZ X;  2W9N A;  1QOG A;  1DOY A;  4I6N B;  1D5X C;  4K1R B;  1JW9 D;  1Q0W B;  1YJ1 A;  1ET6 A;  3DHI C;  2J0M A;  2BWE S;  3EA6 A;  1R4M B;  2QCZ A;  4D2K A;  2KWU B;  3PO0 A;  4MGI E;  3U7D A;  2NTS A;  5C23 A;  1JML A;  4JPS A;  2OOB B;  4WJN A;  5AEK B;  3RNB C;  1VZ8 A;  2WU5 B;  3NS1 A;  3VH4 B;  1QIL A;  4YXD B;  2L0F A;  1MG4 A;  2WX1 A;  1CZP A;  1RRB A;  2K9X A;  4BKS A;  2KDE B;  2NVU I;  3VH3 B;  3B2F A;  2W3S A;  2K39 A;  1FIQ A;  2C60 A;  4II2 B;  2JX5 A;  1VCB A;  3I57 A;  1HTQ A;  3SHQ A;  2GI9 A;  3ZDM C;  3NZU A;  3V61 A;  3BYY B;  4BOZ B;  3H9D A;  2BS4 B;  3W5V B;  4US8 A;  3AE8 B;  2BVC A;  1HZ6 A;  2CR5 A;  2V4I B;  4P1C C;  1GAQ B;  1C9F A;  1N61 A;  1D5Z C;  1TGZ B;  2IND C;  3A4R A;  1XLQ A;  2CU3 A;  1UGJ A;  4C7Y A;  3P63 A;  3PZ8 A;  1TS4 A;  4YWG G;  1IYF A;  1UH6 A;  4HCN B;  3HVZ A;  4PT5 A;  1WX9 A;  4E74 A;  3NUH B;  1S3S G;  1FRR A;  2N1W A;  1C4A A;  1GB4 A;  3N30 A;  3T3O A;  2LXC A;  3Q3N C;  3CST A;  4ZHP A;  4W9C A;  1FMA D;  3Q3J A;  2MLB A;  2KDB A;  4HPM B;  2QSD A;  3UIO B;  2WXH A;  3QAQ A;  1JCK B;  3A1Q A;  3RNC C;  4AJW A;  3ZGZ A;  2ZCC A;  1NYR A;  1I7H A;  2EMS A;  2MP2 A;  4KDI C;  4DXG A;  1Y8R C;  2C7N B;  2VH2 A;  1XD3 B;  1WYG A;  4LJO B;  2AEH A;  5C2T B;  3OWE B;  3SEB A;  3AE7 B;  1JRO A;  4RGM A;  4EKU A;  4JE3 B;  2LEK A;  5IOI A;  1VJK A;  4FJZ A;  4W9D A;  2WP9 B;  1OEY J;  1V8C A;  1SIF A;  2NMQ A;  2K1F A;  3C8Y A;  1WXQ A;  3PHX B;  1WX7 A;  5JHB A;  2JWU A;  3H7P B;  4PYU A;  3MHS D;  3P4R B;  4P7I A;  3K9O B;  2K8H A;  4DHJ D;  4HDO A;  5T8I A;  2MW5 A;  3ZXR A;  1FNW A;  4LK0 M;  3RZW C;  5D6J B;  4NY0 A;  5AZH A;  1TKE A;  3VFK A;  4OW0 A;  3GE3 C;  3L10 B;  3ZKJ C;  2WLB A;  1K51 A;  1WXS A;  2JPH A;  3A9K A;  2I2Y A;  2NR2 A;  2RDB C;  3QHT A;  4GMV A;  4GGQ A;  5BO4 B;  2E3T A;  3IVF A;  2KDI A;  1DYQ A;  1P0R A;  2ZW0 A;  2KOX A;  1WSP A;  3MC0 B;  4J3O D;  4RF1 A;  3B2G A;  3OLM D;  1C76 A;  2OJR A;  1AWD A;  4B0M A;  1L6U A;  2WHI A;  3N9Y C;  5D2M B;  4WAF A;  2QEJ C;  3ALB A;  4NQK E;  4TUU A;  3AM9 A;  4DXF A;  1C4P A;  4ZRK A;  1F2R I;  3OJ4 B;  2H89 B;  4KGR A;  4K7U A;  1T5X D;  1D3Z A;  1HEZ E;  4X57 B;  3ZRC A;  3V6C B;  1VD2 A;  1E90 A;  4BFR A;  1UNS A;  3EUB 2;  4JX1 C;  4M0W B;  2KJH B;  3KUD B;  3QJZ A;  3NVV A;  4F8C B;  2QC8 A;  1JWB D;  1PGB A;  1XLN A;  2ZVN A;  4OVV A;  4HPP A;  3KWL A;  1V1P B;  2RGF A;  3IG3 A;  2C9W B;  4G50 A;  3PSE B;  3H7S A;  2PW9 A;  4J6I A;  1SJE D;  1WGR A;  4IWO A;  2MHJ A;  1BT0 A;  3VR8 B;  1E0Z A;  3PPA A;  1T0R C;  1JWS D;  2XK5 A;  4XDD A;  1E8Y A;  3VAW A;  4CO7 A;  4DHZ E;  4IG7 B;  1E10 A;  3DDC B;  2VRR B;  5JH5 C;  1WWT A;  1F77 A;  1XCT L;  4H2A A;  1TKG A;  4AS1 A;  1QF6 A;  2IY1 B;  1V2Y A;  2H88 B;  2WXN A;  1ZW7 A;  3Q8E A;  4NAM A;  3CIR B;  2KT7 A;  4XDC A;  3P4P B;  4LNO A;  1I4G A;  4GDL B;  1NEK B;  2Y3A A;  2YEP F;  1WE7 A;  4WJO A;  1WFY A;  1I35 A;  4A90 A;  3LJ3 A;  3PRP B;  1H8C A;  3L17 A;  4WIP A;  3TEX A;  4KIK B;  3T3N A;  2LMC A;  5BMH A;  3TEY A;  3OG5 A;  3EHV A;  1R4N B;  5IA7 A;  2I1K A;  2EKI A;  1TY0 A;  2KZR A;  1LO5 D;  3AMZ A;  3DOW A;  4I6P A;  4AOF A;  5G55 A;  3L0W B;  2V1Y A;  4PS7 A;  1YIW A;  1MVK A;  4ZRP A;  4G11 A;  2LZ6 A;  4GLS C;  1FXI A;  1N5W A;  1VDV A;  3NZS A;  2C7H A;  2KHW B;  1EF1 A;  2UU7 A;  2CJN A;  1HTO A;  3KH0 A;  1YJJ A;  2ZPN A;  2N0S B;  2FCQ A;  1K50 A;  3HIZ A;  3GB1 A;  1M94 A;  1FFV A;  1SEB D;  1FD6 A;  4HVB A;  4MH0 E;  2M0A A;  4CQN A;  1SGH A;  2BWF A;  2CS4 A;  4W9F A;  3W1S A;  2BB5 A;  1KLU D;  3HM3 A;  1QZE A;  4L1B A;  2G9H D;  4HEA 1;  2FIF A;  4OZB A;  4M8N A;  2HE7 A;  2LGX A;  3L16 A;  2K3U A;  2JSV X;  1WZ0 A;  4XZ4 A;  2IBI B;  4YSZ B;  4ANV A;  2L3Z A;  3B1L X;  1FXA A;  5J18 A;  2W82 A;  4KGT A;  1IPG A;  2B76 B;  3P1M A;  2NCN A;  3DCG A;  1M4V A;  3BYT B;  1ISN A;  2KFJ A;  3RN9 C;  1FNU A;  3IBE A;  2K22 A;  2MJD A;  2OED A;  1QT9 A;  3AEG B;  3BZD B;  2YVC A;  1YN3 A;  2WXO A;  3P2B A;  2ONQ A;  1J19 A;  1OTR B;  2Z8L A;  4IDI A;  2LGS A;  1L6V A;  3KWV A;  2SEB D;  4HDQ A;  2WXI A;  1A5R A;  3FKY A;  1KOT A;  4NAW A;  5DCN A;  2YEP B;  4IWP A;  3RFZ B;  3DQV A;  3W1S C;  2L1A A;  4CYE A;  1RAX A;  3KYC D;  2R2O A;  4W9I A;  3LYY A;  3PLU A;  4XX5 A;  1MG8 A;  2DZK A;  2N4F A;  3ZRF A;  1Q5W B;  4ANW A;  2M8S A;  2D07 B;  4R3D A;  2JU6 X;  1IBX A;  2KC2 A;  5BYR A;  2KAC A;  3M63 B;  4K3B A;  1Y56 A;  4XWT A;  1J7A A;  1V9J A;  1V5T A;  3RNG C;  3MJW A;  2IO1 B;  1OGW A;  2V9H A;  2EKE C;  2AL6 A;  1AW7 A;  2AX5 A;  1J0G A;  1YN4 A;  2ACZ B;  2BBC A;  1SE4 A;  5LXH A;  3Q8C A;  4NZL B;  4M0W A;  2Y5C A;  1FEH A;  4EZJ A;  5HI1 A;  1ZPS A;  5EE0 A;  4YT0 B;  3W5U B;  2GOW A;  1J8C A; 
#chains in the Genus database with same CATH homology
 2W54 A;  2XNA C;  1AN8 A;  2W3R A;  1F0Z A;  2MJE A;  3B2F A;  2W3S A;  2WXL A;  2L32 A;  1FIQ A;  3R8B A;  2JX5 A;  2XN9 C;  3I57 A;  4YTP B;  3FIL B;  3AEA B;  2GI9 A;  2INP E;  1ZE3 D;  3BYY B;  3DWG C;  3IAS 1;  3J9C A;  2WXQ A;  2JYE A;  3NZ3 A;  2BS4 B;  4P6V F;  3W5V B;  2DWQ A;  2GRI A;  1L0Y B;  3AE8 B;  2BS2 B;  4NAW B;  4US8 A;  1SXT A;  1HZ6 A;  1RWS A;  5D3I B;  2V4I B;  1SE2 A;  3SFE B;  4RCO A;  3KQ4 A;  1GAQ B;  1C9F A;  4MM3 B;  2K5P A;  1N61 A;  1D5Z C;  1KRH A;  1D5M C;  4YSX B;  3ETR A;  5G5H A;  3U2S C;  1QOA A;  1XLQ A;  2J4X A;  1N63 A;  2PTL A;  1QQR A;  1CJE A;  2CU3 A;  1UGJ A;  4C7Y A;  3P63 A;  3PZ8 A;  3AE4 B;  2ON8 A;  1TS4 A;  2KQ4 X;  1IBX B;  1HZ5 A;  4EE2 A;  4YWG G;  4ITK A;  3IT4 B;  4P16 A;  3HVZ A;  4MAC A;  2QIL A;  1FCL A;  4PT5 A;  2R61 A;  2BB6 A;  5AUI A;  3E56 A;  4RNA A;  1VRA B;  2V3N A;  1QLB B;  1ZXH A;  4OZA A;  1PDX A;  3ZJT A;  3NUH B;  1TY2 A;  1FRR A;  3GS2 A;  1TS5 A;  1C4A A;  1KFY B;  2FE8 A;  1KLG D;  3FAH A;  4ZRQ A;  2N9L A;  1GB4 A;  1FM0 D;  3T3O A;  4TMA B;  3AE9 B;  2N7J A;  4ZHP A;  1FMA D;  1TS3 A;  1SB3 C;  2G1E A;  2JXT A;  2QSD A;  1CK1 A;  1N60 A;  3TSS A;  5D3D A;  2WXH A;  1JCK B;  4RF0 A;  2LJI A;  1EM7 A;  5BMG A;  3ZGZ A;  2VZK D;  2WXK A;  3NRZ A;  2WNM A;  4DQO C;  1ET9 A;  1NYR A;  4L2Y A;  2FBW B;  5D7G A;  1I7H A;  2MEK A;  1YNT E;  4DXG A;  3ZJU A;  1V97 A;  1ACC A;  3IXS A;  2INN E;  2BS3 B;  1WYG A;  1GOZ A;  2TSS A;  1QOB A;  2I38 A;  2KWD A;  1KH0 A;  3AE3 B;  3V05 A;  2SAK A;  5C2T B;  2L83 A;  4HRO A;  1A70 A;  3SFD B;  3ZYY X;  2KDM A;  3OWE B;  1UWX A;  3SEB A;  4RH6 A;  3AE7 B;  3U52 E;  1JRO A;  1C4C A;  4JWS C;  1VZ6 A;  2WQY B;  3W9C B;  4L23 A;  4RGM A;  4JE3 B;  1QKZ A;  2LEK A;  2WU2 B;  1VJK A;  1E7P B;  1PYW D;  4ZYS A;  1EWC A;  2WP9 B;  2BTE A;  1FFU A;  1V8C A;  2NMQ A;  3C8Y A;  1FCC C;  3UI3 A;  2BT6 A;  5GXG B;  1WXQ A;  3NVZ A;  4TQ1 A;  3TEZ A;  2JWU A;  2V0G A;  2DBY A;  5AUK A;  5G5G A;  3MP9 A;  1L5P A;  2AQ3 B;  3P4R B;  4ZOH C;  4YTN B;  3AV8 A;  4JWU C;  1I4R A;  3AEF B;  5T8I A;  1JAL A;  2VZK B;  4N59 A;  1ZOY B;  1FNW A;  1GPX A;  4LK0 M;  2IPK D;  3H8H A;  1TKE A;  1TYG B;  2GB1 A;  1IUE A;  3MJ5 A;  1JQ4 A;  4OW0 A;  2HTM E;  1BUI C;  1WGK A;  1TKY A;  2V3P A;  2WLB A;  1I4P A;  1K51 A;  5BYQ A;  1NYQ A;  4C56 C;  1HXY D;  2I2Y A;  3BK1 A;  5FK9 C;  1OQR A;  2JZP A;  1IGC A;  1K52 A;  2E3T A;  4A9A A;  1PGX A;  1DYQ A;  2ZW0 A;  1NI3 A;  2EEL A;  1WSP A;  2N9K A;  3TEW A;  3MC0 B;  4J3O D;  4RF1 A;  2LUM A;  1YMH E;  3B2G A;  1YQ3 B;  5BMI A;  2J42 A;  3LB8 C;  1C76 A;  1SBB B;  1EU4 A;  1AWD A;  1XF5 L;  3E9S A;  4B0M A;  3BWU D;  1J7B A;  4C80 A;  5HHD G;  4HRS A;  1L6U A;  4TSS A;  3U4E G;  3N9Y C;  4WAF A;  4B0E A;  1TZO A;  1OFF A;  2QEJ C;  1J7C A;  1V1P A;  2AQ1 B;  3NVY A;  3AM9 A;  3B9J A;  1C4P A;  4DXF A;  4TQ0 A;  1SF0 A;  1F2R I;  2H89 B;  2LHD A;  1DGJ A;  4KGR A;  1K53 A;  1T5X D;  4RGN A;  4HJG E;  4REZ A;  1HEZ E;  2RDG A;  3RPF C;  1RM6 C;  1UNS A;  3HRD D;  3EUB 2;  4JX1 C;  1L0V B;  3Q8A A;  3HVD A;  3P4Q B;  3NVV A;  2J52 A;  4HKZ E;  4XE0 A;  1JWB D;  1PGB A;  1XLN A;  3PZ7 A;  5JXV A;  3IT6 B;  3KWL A;  1V1P B;  2PVG C;  4LLG M;  4OZC A;  1MHH E;  3V3X A;  2ICI A;  2PW9 A;  2Y5P A;  1XLO A;  1SJE D;  4UDU C;  3ABV B;  1CQV A;  3VRA B;  1FNV A;  4AQ7 A;  1XCQ L;  1L4D B;  1PGA A;  3VR8 B;  2WXP A;  1E0Z A;  1BML C;  1JWS D;  1MI0 A;  3P4S B;  4XDD A;  1T3Q A;  3MFG A;  4OHJ A;  2BW2 A;  3AB5 A;  5MPO A;  1VZ7 A;  3ZJV A;  4WQM A;  1E10 A;  1I4H A;  3TUO A;  3AEC B;  4IKG A;  1WWT A;  2PLP A;  4MH8 A;  1F77 A;  1XCT L;  4H2A A;  3LXF A;  2L52 A;  1TKG A;  5C3J B;  4AS1 A;  3DWM A;  1EWY C;  1QF6 A;  1C77 A;  2H88 B;  2IDY A;  2WXN A;  3VQI A;  3Q8E A;  1L0X B;  2JYT A;  1T6B X;  1VR9 A;  4NAM A;  4WH4 A;  3CIR B;  1AYF A;  4XDC A;  2E6X A;  3P4P B;  1F2R C;  1I4G A;  4GDL B;  1NEK B;  3AEE B;  3CWI A;  3SR6 A;  2Q5W D;  2Y3A A;  1I4X A;  5I4D A;  4RFB A;  2KMM A;  2YEP F;  5EE1 A;  3I9V 1;  3NVW A;  2KN4 A;  1TS2 A;  1RYJ A;  5H8Y E;  3HUI A;  4US9 A;  3O13 A;  3URY A;  1B1Z A;  4A90 A;  4YTM B;  5FR3 A;  2RPV A;  4RGT A;  1R7S A;  4ARI A;  4WIP A;  2WS3 B;  3TEX A;  3VRB B;  3T3N A;  4A6Q A;  2LMC A;  5BMH A;  3TEY A;  3W2D A;  1SIJ A;  1TJE A;  2PVO D;  5HG2 A;  2FUG 1;  2RDH A;  4XWW A;  1RFK A;  1D6E C;  1TY0 A;  2EKI A;  3AMZ A;  1LO5 D;  1ZP0 B;  2QJL A;  3P42 A;  4N6E B;  1PUT A;  2W55 A;  1IGD A;  3AED B;  4WWM A;  1HA5 A;  1MVK A;  1ZDV A;  2IGD A;  4ZRP A;  2IGG A;  2J53 A;  4GLS C;  1FXI A;  1N5W A;  1VDV A;  2OHF A;  2MJ3 A;  1UWM A;  3R2I A;  2BYT A;  5FKA C;  1XEE A;  2NTT A;  1NEN B;  4WUR A;  2CJN A;  3Q8F A;  4ARC A;  4Q2J A;  1YJJ A;  2N0S B;  1K50 A;  4KKJ A;  2WXF A;  3GB1 A;  1FFV A;  1C79 A;  2K0P A;  1SEB D;  4NJC A;  1FD6 A;  4A8X C;  5H92 C;  5LNK 1;  2M56 B;  2HDE A;  4GDK B;  4OVZ A;  2M0A A;  4IOI E;  4RGO S;  4CQN A;  1EU3 A;  1NVI D;  1YQ4 B;  2M19 A;  5TSS A;  1DOX A;  3W1S A;  2BB5 A;  3AE5 B;  3MHZ A;  1KLU D;  1DOI A;  2LHE A;  2QMT A;  5BYS A;  4HKQ A;  4L1B A;  5EE9 A;  2G9H D;  1XO3 A;  4HEA 1;  4OZB A;  4A55 A;  1Q10 A;  2DLB A;  2LFI A;  1ZDX A;  1ESF A;  1ZXI A;  2K3U A;  2WXJ A;  3BII D;  2JSV X;  3R2T A;  3FC4 A;  4YSZ B;  1WRI A;  1UUP A;  5EE3 A;  3WCQ A;  3BVM A;  1MPE A;  3Q69 A;  1FXA A;  2WDR B;  1XXG A;  2W82 A;  4KGT A;  2B76 B;  3P1M A;  1M4V A;  3BYT B;  3AE6 B;  5E6J A;  3Q8B A;  4KGS A;  1FO4 A;  1FNU A;  2K22 A;  3ZQ4 A;  2MJD A;  2OED A;  1QT9 A;  1V1O A;  3AEG B;  1VLB A;  3BZD B;  1E9M A;  1OQQ A;  1L4Z B;  2WXG A;  1YN5 A;  1YN3 A;  2WDQ B;  1P7F A;  2WXO A;  2ONQ A;  1C78 A;  1MHX A;  1P7E A;  2Z8L A;  1E6E B;  1KTK A;  1PFD A;  4IDI A;  1L6V A;  1ENF A;  3KWV A;  4USA A;  4ZHO A;  1ZUD 2;  2QIE B;  2SEB D;  2PMV A;  4C7Z A;  3AE1 B;  2WXI A;  3U7Z A;  4N58 A;  1YJI A;  2YEP B;  4KX6 B;  2WXR A;  3RFZ B;  1B9R A;  4LTU A;  1I4Q A;  3IAM 1;  2L1A A;  5HFY A;  2JQR B;  2KAJ A;  2WDV B;  4O1N A;  3LYY A;  1BXT A;  2CJO A;  3FIL A;  2MH7 A;  3AH7 A;  2ZW1 A;  3BVG A;  2IGH A;  1SSN A;  4R3D A;  2JU6 X;  4KKI A;  1QOG A;  1DOY A;  1N5X A;  1IBX A;  3BVZ A;  5BYR A;  1JWA D;  3AE2 B;  4FXC A;  2KAC A;  3VR9 B;  2DYM A;  1D5X C;  1Y56 A;  1JW9 D;  4XWT A;  1J7A A;  1JRP A;  2IJ0 A;  2WXM A;  1FRD A;  1ET6 A;  2LGI A;  3EA6 A;  4D2K A;  3PO0 A;  3AN1 A;  1STE A;  3KLS X;  1AW7 A;  2AX5 A;  3GP7 A;  1YN4 A;  2ACZ B;  2BBC A;  2NTS A;  1D4B A;  1JML A;  1SE4 A;  4JPS A;  1HQR D;  2RMM A;  3AEB B;  3Q8C A;  2PKO A;  1KF6 B;  2DYO A;  2X38 A;  4NZL B;  2PIA A;  1JWM D;  1ROE A;  1QOF A;  1VZ8 A;  2Y5C A;  4M0W A;  1FEH A;  4MT5 A;  2WU5 B;  5HI1 A;  1SJH D;  3NS1 A;  2D5G A;  1JWU D;  1N62 A;  4YSY B;  1GB1 A;  1QIL A;  3L4P A;  4YXD B;  1XLP A;  1ZPS A;  3EGR A;  5EE0 A;  1SE3 A;  1CZP A;  3BK2 A;  4YT0 B;  3W5U B;  2K9X A;  2AQ2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...