2LJIA

Structure of a protein from haloferax volcanii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRPVPEDQSVEVDRVKVLRLIKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 2
publication title Structure of a protein from Haloferax volcanii
rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 5
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.630 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ljiA00
2L32A 2LJIA
chains in the Genus database with same CATH superfamily
1J7AA 1ZE3D 1L0VB 3HVZA 2K22A 5G2NA 2JRHA 3SDLC 4D2KA 4E3CA 2ZW0A 4ANVA 3Q69A 4CO7A 2WU2B 3PV1A 3HRDD 1MJDA 5E6PA 4LJPB 1C1YB 1UBIA 3JYUA 4MEMA 2WP9B 2WGSA 4MM3A 3KYCD 1EF1A 3V6EB 3BINA 2XK5B 3K9OB 4K3BA 4KKIA 3AE7B 2INDC 1C3TA 1J7CA 1C77A 2WXFA 1OQQA 4W9KA 1F2RI 2ZW1A 4YWGG 4ARCA 4WWMA 3Q3NC 3J9CA 2J4XA 1NYRA 3DHHC 2MWSB 3EUB2 3QARA 2KTRB 1G6JA 1PGAA 1EWYC 2J0JA 2IO2B 1GB4A 3Q6BA 1GPXA 4KGRA 1N6ZA 1GG3A 3VUWA 2LVPA 1V81A 2L3ZA 2KLCA 5DCNA 2W9NA 1JCKB 1RAXA 4YTMB 3WCQA 5G5HA 2VZKD 3RYTA 5C2TB 3ZLZA 2XEWA 3R8BA 3RULA 2JY6A 1P7FA 4MH0E 4MT5A 4TUUA 3HK0A 1VZ8A 2NTTA 1OTRB 2KYWA 4J6IA 3RZFA 2WNMA 4AOFA 3ZRFA 3V05A 4CHKA 2PPHA 3AB5A 2X8XX 2ZZPB 1SIFA 2JSVX 2QCZA 1A5RA 3X23A 2QILA 2FNJB 3ZRCA 2KT7A 1VJKA 1PGXA 3FAHA 2JXXA 1WJNA 2C7NB 4HDOA 3IG3A 1EUVB 2K6QA 2LZ6A 2VH2A 1TBEA 2QDFA 1DYQA 3ML8A 2D2QA 2DLBA 3KUCB 1LGRA 1FNUA 5EE1A 1N5WA 2WDQB 3FKYA 4ZHPA 2J42A 1ESFA 1XLNA 1PDXA 3ZO5B 4A3OA 1SGHA 2YVCA 1L0YB 4GU2A 4C4VA 1I35A 1EF5A 1BT0A 3V62A 2KKCA 1YN4A 3L54A 1NENB 1EU4A 3B0AA 1V5TA 5IKCM 3AV8A 3ABVB 3DHGC 1QQRA 4MGIE 1L0XB 2MHJA 3DBHI 2D07B 3VRAB 4G50A 3VUYA 2FBWB 2LGYA 4RFBA 3AEEB 4M0WB 2HJ1A 1WFYA 2GBRA 3M3JA 1GNUA 3IBEA 2WXHA 3UINB 1PGBA 4CYEA 4WJPA 1WYGA 1MVKA 1QF6A 2KVZA 4WWOA 1JWBD 1V1OA 3ZYYX 1UGMA 3N1XC 2CU3A 2IPKD 3DHIC 3VHTC 4K3CA 2A4ZA 2LGXA 3AE2B 3PPAA 3NRZA 5BYRA 1YJ1A 2D11A 3DWGC 3PT2B 1J19A 2K8BA 3BK2A 1R4MB 1TY0A 2ICIA 2J53A 3DDCB 2BW2A 4EFOA 1UWMA 1MG8A 3ZXVA 1YMHE 3JSVB 4F1SA 5J18A 4BBNF 4RM8A 4GB9A 5CHWA 2PEAA 2NBUA 3RNEC 1ENFA 2OJRA 1V80A 3EC8A 4NPNA 4MH8A 2OHFA 2KJ6A 4KKJA 2Y3AA 3A4RA 1FPYA 3MJWA 2XK5A 2K39A 3MHSD 2ASQA 1WYWB 3E9SA 3K9PB 4IWPA 4AJYB 3VVWB 3GS2A 4NJ6A 1FIQA 4AJWA 1DOIA 3UQAA 2BWES 3ZW3A 1ZDVA 1E8YA 2JYTA 2KTRA 3T3NA 1EO6A 2WXNA 2MJ3A 1L2NA 1WX9A 4GDKB 4YT0B 2Q5WD 5L95C 2M1MA 1TS4A 2KMCA 1RLFA 3QCAA 3RD2A 4AUQC 2LD9A 4RGNA 1L4ZB 2RDGA 3N3KB 2KX0A 1VZ6A 4LNKA 4YL8A 5KHQA 3A4SC 3NVVA 1MHHE 1IYFA 1WMHB 1E5WA 3B1LX 5BMIA 4WWPA 2KDBA 3ONSA 3X0WA 4OVZA 4OZAA 5DPSA 2WXGA 1IPGA 3MJ5A 2IBIB 1J7BA 2PKOA 3V3XA 4GDLB 1LO5D 4P16A 1YNTE 4NY0A 1E8WA 3APDA 3KQ4A 1SE2A 1P3QU 2L7RA 1OEYA 2E6XA 2J0MA 2KO3A 5BYSA 2PLPA 4HPPA 2GOWA 4C7YA 1K51A 2R2QA 4MELA 1NBFC 1FM0D 3ZJTA 2WXPA 2CHZA 3W1YA 3AE9B 4P7IA 1VD2A 4A90A 2G4DB 3P42A 1I4QA 2L76A 4NJCA 3QHTA 2WQYB 4EZLA 3CMMB 3S2AA 3VTUA 5J17A 2K8HA 4RH6A 2IYDB 4K7UA 3PO0A 4GXBA 1E7PB 3B2GA 3R3MA 4L23A 4F8CB 2KHWB 3N1ZC 2JWZA 2YEPB 1E10A 3KYDD 4KV2A 2LHEA 4M0WA 2N7EA 3JW0X 1QT9A 3BIID 2ACZB 3PLUA 4X57B 2N4FA 4DQOC 2KDIA 4ITKA 4DDID 1UD7A 1WGHA 4BFRA 3GE8C 4ICVA 2AL6A 1K52A 2Z0EB 3PZ8A 2KQ7A 5KHOA 1VLBA 4YSXB 1ZXIA 2ZVOA 4BKSA 4IW0A 4KDLB 3MC0B 3OG5A 3PZDA 3RUIB 2OEDA 1F9JA 1V1PB 3CF6E 2IDYA 2PVGC 1C9FA 3DBHB 4A3PA 2FUG1 2L0FA 1KF6B 1FXAA 1GAQB 1B9RA 3DVGX 3L08A 3PTFC 4UDUC 3ZJUA 1Q0WB 2DZMA 1HXYD 4GN1A 3A9JB 3JSVA 1SJED 4YTPB 2RDHA 2K5PA 4PYZA 2GBKA 3ZUNA 2G45B 1WY8A 2RDBC 5AZHA 2VH1A 2QEJC 4G3XB 2JZ3B 4FLHA 3AXCA 4GMVA 1TGZB 2BTEA 2BT6A 1CQVA 4ZOHC 2IGDA 1TZOA 3BYYB 1LXDA 2FCQA 1XEEA 1Z2MA 1PUTA 4ZDVA 4HPMB 4GLSC 3NG0A 3LB8C 2MW5A 1WJUA 1GJZA 2INCC 4KGTA 1OEYJ 2PW9A 4M01A 2VRRB 1Q1OA 2V4LA 3ENEA 3W1SA 3IAS1 2JU6X 2MBEA 4N58A 2KOXA 1WXMA 2JZZA 3UQBA 4BBNC 1XO3A 2MEKA 4MSQB 4GDKA 1SF0A 3IFWB 3NVZA 5T8IA 1T0RC 3SEBA 3APFA 1TTNA 1P1AA 1XD3B 4FXCA 2JPHA 5D2MB 1F52A 1VR9A 4IM3A 1SIJA 1M94A 2KX3A 4ZRPA 2BKRB 2O6VB 4B6WA 1GC7A 3PVLA 2IY0B 3GE3C 1E8XA 1WMHA 4W9GA 4DK5A 4M8NA 1H8CA 2BYVE 1HZ6A 2REXA 3T8MA 3EA6A 3VXWA 4XZ4A 2LJ5A 4E71A 3W5UB 3EFCA 3PS6A 2NCNA 2Y5PA 1C4AA 3MFGA 3WALA 5IO9A 1HTQA 2MBHA 4KZCA 3HM3A 4XWWA 2FCNA 4IM0A 3H8HA 4GDLA 4BKGA 3ZDTA 3SU8X 2NBWB 2D5GA 1CMXB 4I6LB 5CHFA 4JLCA 4PYUA 4C00A 3HHMA 2AEHA 3IVFA 4DWFA 3NZUA 4FJVB 2FE8A 3LJ3A 5H92C 4NAMA 3WIMA 2LASA 3Q3FA 3UIOB 2R61A 3ZGZA 4HXDA 3AE4B 3B9JA 2ONQA 4XYCA 3WA0A 2KWUB 2RPQA 4GOCA 4NAWB 3ZNID 3GZNI 3NOBA 1BXTA 4N6EB 2W82A 1SJHD 2BS4B 5I4DA 1Y56A 3TSSA 1NI3A 2AYOB 1R4NI 2JF5A 1D6EC 2L83A 3R2IA 4K7SA 3PREA 3DWMA 3GB1A 5CX3A 1K8RB 4IKGA 5LLIA 3ALBA 1DGJA 1ZGUB 4ZHOA 4URKA 4MDKE 4WURA 2CKHB 3Q8FA 4FA6A 3BVMA 2LRWA 1LQBA 1WR6E 2Y5BB 3R66C 3LDZE 3PZ7A 4ANWA 4A9AA 2INNE 2KVRA 3SFDB 1B1ZA 3AN1A 2K0PA 2WDRB 1MFWA 5G55A 1A70A 3AE6B 3HVDA 2KANA 3NY5A 2IJ0A 4EOYA 1V49A 2WX1A 3AE3B 1JRUA 1V1PA 4II3B 4NNJB 3SR6A 3NZSA 2WXQA 4HROA 4ANXA 3PHXB 4F7ZA 4BVUC 2WS3B 1K50A 2LVOA 2GMIC 4BKSD 1SE9A 5E6OA 5IAAC 3VFKA 3A9JA 2RD0A 3NS8A 2N9KA 3TL5A 3H6NA 2W54A 5DPWA 2K1FA 2RGFA 4RF1A 1HQRD 4WQMA 4LNOA 3R2TA 2WWZA 2G3QB 2KWDA 4ZRKA 1L7YA 1WGGA 1V6EA 2MBBB 2DHZA 3PRPB 1QZEA 3V61A 1E7UA 1ET6A 1VCBA 2I1KA 4DDGD 4IUMB 1RYJA 4RNAA 2L0TA 3KUZA 3N1YC 4M02A 1IGDA 1UUPA 2LGDA 1WXAA 1L6VA 1ET9A 3WAPA 2VZKB 1YN5A 1XT9B 4LNNA 3DQVA 2M17A 1QKZA 2WDVB 4W9FA 2LRUA 3MHZA 1KM7A 2B3AA 2IGGA 4TQ1A 4IOIE 4AS1A 5AUKA 5TSSA 2R2OA 3Q3JA 4A55A 3BY4B 3AEAB 2O6VA 2GLSA 2G4SA 1VRAB 3ZIMA 1FMAD 1UH6A 3IXSA 3DPDA 2OJWA 2JX5A 2I38A 1IBXB 2N9EB 2O2VB 4HRSA 1E0ZA 1C79A 5IN7A 3V60A 1MPEA 1IP9A 3APCA 2WLBA 3NHEB 3CSFA 3AU5A 4GSWA 3DBSA 2LUMA 4RGOS 1T3QA 1D4BA 3TBLD 1QILA 1ZXHA 4LK0M 5EE0A 2IO3B 2ZEQA 1WJ6A 3M62B 3ZNHB 5D7GA 1C76A 4WJQA 1SEBD 2DNFA 2M19A 4FHJA 1J0GA 1RM6C 1SXTA 1CJEA 2YEPF 3L17A 2Y5CA 5E6NA 4NAWA 3C19A 1V9JA 3BK1A 3VH3B 2KMMA 3AE5B 4XWTA 2HD5B 1QOGA 2KDEB 3ZXRA 3ECIA 3TMPB 4KSKC 4G0NB 1ZKHA 2K25A 4O1NA 1JW9D 1KFYB 2IZVB 4A8XC 4OHJA 2ZNVB 3RNCC 1JALA 1V8CA 4ICUA 3OJ4B 1QOBA 2KACA 3UI3A 2KNBA 2KMAA 5JHAA 1FCCC 2BGFA 3L13A 3RN9C 3Q3OC 1EM7A 2BPSA 2JVCA 2DWQA 1U4AA 2LEKA 2KWCA 1IGCA 3RCZA 5BO4B 3SFEB 2QSDA 2BYTA 4DHJB 1TKYA 1YOVB 5GMVA 5C1ZA 5C3JB 2AQ2B 3CIRB 5G5GA 1MHXA 1XLQA 2CR5A 1R4NB 2LGSA 1OQYA 3LYYA 1I4XA 4LTUA 4B0MA 4RGMA 3N9YC 2WXOA 3O13A 5CHVC 2PE6B 1GOZA 4W9CA 1GB1A 5HG2A 1WWTA 4W9IA 1GUAB 1S3SG 2DX5B 1V5OA 3KVFB 3UF8A 1PQSA 4AQ7A 2C5LC 1FO4A 4PK1A 4LDTD 2BYFA 2ZVNA 1SE3A 4OW0A 2B76B 2JQRB 1D5MC 4RGTA 1C78A 1WX8A 2MLBA 1RFAA 1WX7A 4ANUA 2V4IB 2H88B 3GP7A 1T6BX 1X1MA 1AARA 2EKIA 3GOEA 2QHOA 4BOZB 3RMKC 1JRPA 3U30A 1YIWA 4W9EA 4JQWC 3A33B 2M56B 2LWPA 3EGRA 1P9DU 2WXIA 5HHDG 1SBBB 2GBJA 1YX6B 1TKEA 3LXFA 3P4SB 1E9MA 2XNAC 3C0RB 5MPOA 2IGHA 4R3DA 3W1SC 1WH3A 3A9KB 4KX6B 4JPSA 1BUIC 2NTSA 3QQ8B 4WJOA 2DYOA 1ZDXA 4EKUA 1MG4A 1QLBB 3CSTA 1F1HA 3BYTB 2M0XA 2C9WB 2WXRA 2X38A 1BMLC 1F0ZA 1FRDA 4FJYA 4XC2A 2KQ4X 2BS3B 4WWNA 1E7VA 2ZJDA 2BWFA 2CHXA 2MBQA 5HKHA 4WAAA 5TR5A 3ZTCA 1Z5SB 1XCQL 1TJEA 2MBOA 2MH7A 4KVGB 1IBXA 2V3SA 2AQ1B 4PS8A 2MX2A 1JMLA 2O2VA 1TS3A 2D10A 1F2RC 2O6VD 1FFUA 2TSSA 4YSZB 1QOAA 4USAA 4C7ZA 2H89B 4XDCA 4MGZE 4JL9A 2G1EA 4YSYB 1FFVA 4NQKE 4ZRQA 1HTOA 3H7SA 3N20C 2MQJA 1WGRA 4TV3A 4L2YA 1TY2A 2K8CA 1J8CA 1NVID 2C60A 4RF0A 3VTVA 1EWCA 1WI0A 3WANA 5C23A 4ZRJA 3E56A 1UBQA 1E90A 1WXQA 4TMAB 4DXFA 1P98A 5FK9C 2ZCCA 2BB6A 5GXGB 3VAWA 3ZKJC 3ZQ4A 4KGSA 2MP2A 3B2FA 2FAZA 2PJHA 4XGAB 3DVNU 1HE8A 2KC2A 5BYQA 3DBRI 2HDEA 5D3IB 1ZOYB 2JRIB 1T5XD 2RR9A 2RSUA 3P1MA 1ACCA 4OVUA 2L00B 3QK0A 4N59A 1KTKA 2RPVA 3PGEA 2D3GA 1CZPA 5DPTA 3A1QB 3AULA 3TJPA 2NVUI 3U8ZA 1C4CA 2DAJA 4G11A 3H9DA 4FJZA 4BKTA 2ZPYA 3VRBB 4OZCA 4ASWC 1S1QB 1XF5L 1P7EA 2KDFB 4IC7B 4DBGA 1HZ5A 4LJOB 3R7RA 3UGBB 2V3NA 3AEBB 4HJKA 1UWXA 3RI7C 3I63C 3Q8CA 2WHIA 1E6EB 2MCNB 4EEWA 4KZ0A 3VUXA 3RFZB 2I2YA 4BAXA 4JWUC 3U2SC 1ROEA 3P63A 5JHBA 2NPTB 3QIJA 4WJNA 3FILB 1DOXA 2N9LA 2N1VA 1WRDB 4DXAB 4S0RA 3TIXA 1Q5WB 2M0AA 2JXTA 3VTWA 1WXVA 1FD6A 4TKNA 2E3TA 1FRRA 3MC9A 3EHVA 2RMMA 4RMAA 4EUTA 3PLVA 4P1BC 1WM2A 1N62A 4S17A 4C80A 2AWTA 2NMQA 4N9F4 2KFKB 4WIPA 5FKAC 4E74A 2LVQA 4HDQA 3H7PB 3TUOA 1WM3A 3PSEB 2LXAA 5AEKB 3I57A 3IT6B 3SD5A 2WDTB 4NQLB 4DHZB 1Y8RC 1N5XA 1YQ3B 3L16A 3AE1B 4K1RB 3TEXA 2KN4A 1FNWA 1JWAD 1XQQA 1R7SA 3A9KA 1LFDA 2DZJA 4A6QA 1WSPA 2LMCA 1CK1A 2FCSA 1XLOA 3RPFC 4JGHB 3N32A 1UF0A 1V86A 2CU1A 4HCNB 4EZJA 2HTHA 5AZFA 2V9HA 3NVWA 3AMZA 2HE7A 2SEBD 3L0WB 2IO0B 2XN9C 2CS4A 3ETRA 2PVOD 4ZYSA 3KW5B 3RNAC 1YJIA 2NBVB 1UGJA 3T9LA 3AEFB 1NEKB 1D3ZA 2WXKA 2KJHB 3BVGA 2W3RA 1WF9A 1I42A 4EE2A 2KQSA 3N30A 4HJGE 1TIFA 3B08A 5H8YE 2DYMA 2WXLA 3HM6X 2N7DA 3KLSX 1OGWA 4IWQA 2SAKA 4GIVA 2OOBB 2UWQA 3O65B 2INPE 5IOIA 3RT3B 3AECB 1DOYA 4QAYA 1D5XC 4MJSB 1I7HA 2CJOA 2EELA 1KOTA 3I5JC 1YJJA 2KN5A 2HTME 3M63B 3Q3MC 3WAMA 4AWJA 3C8YA 4XE0A 1ISNA 2EMTA 3AM9A 2QMTA 1N61A 2EKEC 3OAWA 4JIOU 4ZRIA 3P4QB 1SSNA 1TT5B 4KDIC 3ZNGC 2KWVB 1MI0A 1UELA 3DOWA 2DYBA 1JQ4A 1NI2A 3SHQA 1I4HA 3ZTDA 4C56C 4I6PA 2GRIA 3M95A 1T0SC 4P1CC 4I6NB 1L6UA 2C7HA 5BMHA 4P6VF 3HIZA 2KLGA 3H1UA 4OZBA 3A1QA 5D3DA 1FEHA 3PRMB 1RRBA 5EE9A 1NDDA 2UU7A 2KD0A 2YLMA 5HFYA 3VQIA 3KH0A 2LGIA 3ZNZB 1C4PA 4FHKA 2W55A 3TEZA 1ZPSA 4DHZE 2V0GA 3T3OA 1JWMD 4YXDB 2AQ3B 2ZCBA 2HJ8A 2KXJA 3IHPC 1OFFA 2L52A 1WIAA 1RFKA 2V1YA 4REZA 2WU5B 3RNBC 3U52E 3DBRB 3P2BA 4WAFA 3W9CB 2PE9A 2W3SA 2M8SA 1PFDA 2N7JA 2NPTA 3U7DA 2N1WA 2J0KA 4L1BA 3FILA 2K6DB 1HEZE 1EU3A 4DHJD 1AW7A 4AP4C 3JVZX 4XX5A 4J3OD 2GB1A 5JXVA 1RWSA 2KDMA 4HPLB 3DCGA 5CTRC 3BZDB 2FCMA 3IAM1 1XCTL 4RCOA 4RM9A 1ZP0B 2I1JA 3DBLI 1ZW7A 2MP2B 3DVGY 2KFKA 1N60A 3ZJVA 5FR3A 4W9LA 1YX5B 3H7PA 4MSMB 1JWUD 1L5PA 2AL3A 1KRHA 3I3TB 4LNIA 2L8JA 1AWDA 3VR8B 4B9KA 1HA5A 2CHWA 2D3BA 4CQNA 1FNVA 3ML9A 4PS7A 1JWSD 3RNGC 4ARIA 1OQRA 1TS2A 2XBBC 2GI9A 3Q2AC 1M4VA 5IA7A 1H4RA 2KZRA 4K7WA 5D94A 1WR1A 2EMSA 4IG7B 2BVCA 4OVVA 3R7QA 3Q8BA 2L32A 2N9XA 5JZEB 3UIPB 1FCLA 2JWUA 5E6JA 1NYQA 3QC8B 1I4GA 3GZNB 5FR6A 3VH4B 3ZVVA 3HUIA 5EE3A 1WZ0A 2MJDA 1YN3A 4KIKB 3QJZA 5JH5C 2BKFA 2AX5A 2BBCA 1IUEA 1KLGD 3D32A 2LJIA 4HEA1 3NVYA 4B0EA 3AU4A 3PHWB 3Q14C 3Q8EA 3TEWA 1STEA 2L05A 2WXJA 3OLMD 1VDVA 2J7QB 2GBMA 2JZPA 3MP9A 3NS1A 1WGKA 2BF8B 4Q2JA 3QAQA 4HCPB 3NUHB 2MA9B 2FUHB 3OJ3A 2CJNA 3FC4A 3KUDB 4M8MA 2PTLA 5LXHA 2ZPNA 1KLUD 2KC1A 2MRPA 2L1AA 3QWZB 1YD8U 4FBJB 1D5ZC 2C7MB 1WE6A 3P4RB 4YTNB 2PIAA 2IO1B 2QJLA 2JYEA 4B95A 2MJEA 4LNFA 2NS5A 1V2YA 1FXIA 2BB5A 4HWIB 2PMVA 1UNSA 4MJSA 1WXSA 4FN2A 1KH0A 1TS5A 2K3UA 4JWSC 4MM3B 4M00A 4TSSA 4IWOA 1I4PA 1XXGA 1T0YA 4FULA 2LI5A 4HKQA 4PS3A 1YQ4B 1E8ZA 5L83A 2KJRA 3TCAA 4A20A 2QIEB 4NJ7A 4LLGM 2DENB 3P4PB 2LFIA 3V6CB 4ZYNA 3QA8A 5J2RA 1LM8B 2JT4B 2V3PA 1QOFA 3I9V1 2N0SB 3RZWC 2ON8A 3KWLA 2FIDA 4MACA 5BMGA 3Q8AA 4MGKE 2FIFA 2BQQA 5AUIA 2Z8LA 2ZNVC 1SB3C 1JROA 2QC8A 2WX0A 4II2B 3NJTA 2GBNA 5LXIB 3L4PA 3WAOA 4WQOB 5D6JB 2WYQA 4FADA 2DAFA 5LNK1 3AI5A 1TYGB 4DXGA 2LXCA 2M4NA 2D3AA 1WE7A 4HKZE 3W2DA 1FXTB 1KJTA 2KAJA 2NR2A 4IM2A 4LDTB 5EDSA 4US9A 5AZGA 3NZ3A 2KK8A 4WH4A 3MTNB 1WJ4A 3OWEB 4BZAA 5HI1A 3VR9B 1I4RA 4W9JA 1KLVA 4W9HA 3TEYA 3L10B 3IT4B 1PYWD 3MC8A 2A5UA 4KSLC 1WGYA 2N9PC 3BWUD 3U4EG 1TKGA 4JX1C 1P0RA 1VZ7A 1XLPA 4ACFA 3AE8B 3QX1A 4NZLB 4PT5A 4XDDA 4K81A 1YQBA 2K9XA 4TQ0A 2Z0DB 4HVBA 4GGQA 4LCDE 2J52A 2BYEA 2G9HD 4C4VB 2LHDA 2DBYA 1F77A 4IDIA 3DVNV 2DZKA 4EZKA 1UZXB 5IP4D 1GC6A 4W9DA 4JE3B 3KWVA 3W5VB 5DPRA 4HK2A 1SE4A 1TZ1A 1L4DB 2UYZB 2KTFA 4MGYE 1R4MI 4BOSC 1WZ3A 2BS2B 3BVZA 1N63A 1ZUD2 3EFUA 2WXMA 2D3CA 4US8A 2LUEA 1WGDA 3DBLB 1T0QC 3AH7A 3U7ZA 3PRZA 2DZIA 4KIKA 2JUOA 3AEGB 2IY1B 4H2AA 1K53A 2MSED 1V97A 3ZDMC 3EECA 3URYA 2Z59B 2KFJA 3AEDB 3CWIA 1AYFA 3VDZA 4HLEA 1AN8A 1Q10A 3RNFC 1WRIA
chains in the Genus database with same CATH topology
2HTME 1JALA 1J7AA 1V8CA 1ZE3D 3C8YA 4XE0A 1K52A 3PZ8A 1L0VB 1VLBA 3AM9A 2K22A 3HVZA 1QOBA 4YSXB 1ZXIA 2QMTA 1N61A 2KACA 3UI3A 4D2KA 3MC0B 3P4QB 1SSNA 2OEDA 1FCCC 1V1PB 2ZW0A 3Q69A 1MI0A 2IDYA 2PVGC 2WU2B 3HRDD 1C9FA 1JQ4A 2FUG1 2WP9B 1KF6B 1I4HA 1FXAA 1GAQB 4C56C 1B9RA 1EM7A 2GRIA 4UDUC 2DWQA 3ZJUA 2LEKA 1IGCA 1HXYD 4KKIA 3AE7B 1L6UA 1J7CA 1SJED 5BMHA 1C77A 4P6VF 4YTPB 2WXFA 2QSDA 3SFEB 1OQQA 2RDHA 2K5PA 2BYTA 1TKYA 4OZBA 5C3JB 2AQ2B 3CIRB 5G5GA 1F2RI 2ZW1A 1MHXA 1XLQA 4YWGG 2QEJC 4ARCA 5D3DA 4WWMA 3LYYA 1FEHA 3J9CA 2J4XA 1I4XA 4LTUA 1NYRA 5EE9A 4B0MA 4RGMA 3N9YC 2WXOA 3O13A 3EUB2 2BTEA 5HFYA 2BT6A 1GOZA 1PGAA 3VQIA 1GB1A 2LGIA 1C4PA 1EWYC 5HG2A 1CQVA 1WWTA 4ZOHC 2IGDA 1GB4A 2W55A 3TEZA 1TZOA 1ZPSA 4AQ7A 3BYYB 1GPXA 1XEEA 2V0GA 4KGRA 1PUTA 3T3OA 1JWMD 4YXDB 1FO4A 2AQ3B 4GLSC 3LB8C 1OFFA 1SE3A 4OW0A 2L52A 1RFKA 2B76B 4REZA 2JQRB 1D5MC 2WU5B 4RGTA 1JCKB 1C78A 4KGTA 3U52E 4YTMB 2PW9A 4WAFA 3W9CB 3WCQA 5G5HA 2VZKD 2V4IB 2W3SA 5C2TB 3W1SA 1PFDA 3IAS1 2N7JA 2H88B 2JU6X 3R8BA 3GP7A 4N58A 1P7FA 1T6BX 4MT5A 4L1BA 3FILA 1XO3A 1HEZE 2MEKA 1EU3A 1SF0A 1VZ8A 2NTTA 3NVZA 5T8IA 1AW7A 2WNMA 3V05A 3SEBA 3AB5A 4J3OD 2EKIA 2GB1A 4FXCA 2JSVX 1JRPA 1VR9A 5JXVA 1RWSA 1SIJA 2QILA 2KDMA 4ZRPA 2M56B 3EGRA 2WXIA 5HHDG 3BZDB 1SBBB 1VJKA 3IAM1 1XCTL 4RCOA 1TKEA 3LXFA 1ZP0B 1PGXA 3FAHA 3P4SB 1E9MA 2XNAC 5MPOA 2IGHA 1HZ6A 4R3DA 1N60A 3EA6A 3ZJVA 5FR3A 4KX6B 4JPSA 1BUIC 1JWUD 1L5PA 1DYQA 2NTSA 3W5UB 1KRHA 2DLBA 2Y5PA 1C4AA 1AWDA 3MFGA 1FNUA 3VR8B 2DYOA 1HA5A 1ZDXA 5EE1A 1N5WA 4CQNA 2WDQB 4XWWA 1FNVA 1QLBB 4ZHPA 3H8HA 2J42A 1ESFA 3BYTB 2X38A 1JWSD 2WXRA 4ARIA 1BMLC 1F0ZA 1OQRA 1XLNA 1FRDA 1PDXA 2D5GA 1TS2A 2KQ4X 2GI9A 2BS3B 1M4VA 1L0YB 1XCQL 1TJEA 1YN4A 2MH7A 3Q8BA 1NENB 1EU4A 2L32A 2FE8A 5H92C 4NAMA 1IBXA 3AV8A 1FCLA 2AQ1B 3ABVB 2JWUA 2R61A 5E6JA 1JMLA 1NYQA 3ZGZA 1I4GA 1TS3A 3AE4B 1F2RC 1QQRA 1L0XB 3B9JA 3HUIA 5EE3A 1FFUA 2ONQA 2TSSA 3VRAB 4YSZB 2MJDA 1YN3A 2AX5A 2BBCA 1IUEA 1KLGD 2LJIA 1QOAA 4NAWB 2FBWB 4USAA 4C7ZA 2H89B 4RFBA 4HEA1 3AEEB 4XDCA 3NVYA 2G1EA 4B0EA 4YSYB 1FFVA 3Q8EA 3TEWA 1STEA 1BXTA 4N6EB 4ZRQA 2WXJA 2W82A 1SJHD 2BS4B 5I4DA 1VDVA 1Y56A 2JZPA 2WXHA 3MP9A 3TSSA 1PGBA 4L2YA 3NS1A 1TY2A 1WGKA 1NI3A 4Q2JA 1NVID 4RF0A 1WYGA 3NUHB 1EWCA 1MVKA 2CJNA 3FC4A 3R2IA 1D6EC 2L83A 3E56A 1QF6A 3DWMA 3GB1A 1WXQA 4TMAB 1JWBD 1V1OA 4IKGA 3ZYYX 4DXFA 2PTLA 5FK9C 2CU3A 2IPKD 1DGJA 1KLUD 2BB6A 5GXGB 4ZHOA 2L1AA 4WURA 3ZQ4A 1D5ZC 3P4RB 4YTNB 3Q8FA 2PIAA 3BVMA 3AE2B 2QJLA 4KGSA 2JYEA 3B2FA 3NRZA 2MJEA 5BYRA 1FXIA 3PZ7A 2BB5A 3DWGC 2PMVA 1UNSA 4A9AA 2INNE 5BYQA 3SFDB 3BK2A 1KH0A 1B1ZA 2HDEA 3AN1A 1TS5A 2K3UA 2K0PA 5D3IB 2WDRB 1ZOYB 4JWSC 1TY0A 2ICIA 2J53A 4MM3B 2BW2A 1T5XD 4TSSA 1A70A 1UWMA 1I4PA 1KFYB 1ACCA 1XXGA 1YMHE 3AE6B 3HVDA 3P1MA 4N59A 1KTKA 2RPVA 1CZPA 4HKQA 2IJ0A 1YQ4B 3AE3B 1V1PA 1ENFA 1C4CA 3SR6A 2QIEB 2WXQA 4HROA 2OHFA 4LLGM 4KKJA 4MH8A 3P4PB 2LFIA 2Y3AA 3VRBB 4OZCA 1XF5L 2V3PA 1P7EA 1QOFA 2WS3B 1K50A 1HZ5A 3I9V1 2N0SB 2V3NA 2ON8A 3KWLA 3AEBB 4MACA 1UWXA 5BMGA 3Q8AA 3Q8CA 3E9SA 1E6EB 5AUIA 2Z8LA 1SB3C 1JROA 2N9KA 3RFZB 2I2YA 3GS2A 2W54A 1FIQA 4RF1A 1HQRD 4JWUC 4WQMA 3U2SC 3L4PA 1DOIA 1ROEA 3P63A 1ZDVA 2JYTA 3R2TA 3T3NA 5LNK1 2WXNA 3FILB 1DOXA 2MJ3A 1TYGB 4DXGA 2KWDA 4GDKB 2N9LA 4HKZE 4YT0B 2Q5WD 3W2DA 1TS4A 1ET6A 4RGNA 2KAJA 1L4ZB 2RDGA 2M0AA 2JXTA 1RYJA 1FD6A 4RNAA 4US9A 1VZ6A 2E3TA 1FRRA 3NZ3A 1IGDA 2RMMA 1UUPA 4WH4A 1L6VA 3NVVA 1MHHE 1ET9A 1N62A 3OWEB 4C80A 5HI1A 2VZKB 3VR9B 1YN5A 1I4RA 2NMQA 3TEYA 3IT4B 5BMIA 1QKZA 2WDVB 1PYWD 4WIPA 3MHZA 5FKAC 2IGGA 3BWUD 4OVZA 3U4EG 3TUOA 4TQ1A 1TKGA 4OZAA 4IOIE 4AS1A 5AUKA 4JX1C 5TSSA 2WXGA 3MJ5A 1VZ7A 1J7BA 2PKOA 3I57A 3IT6B 1XLPA 3V3XA 3AE8B 4NZLB 4A55A 3AEAB 4PT5A 1N5XA 4GDLB 1LO5D 4XDDA 1YQ3B 4P16A 2K9XA 3AE1B 4TQ0A 1YNTE 2J52A 1VRAB 3TEXA 3KQ4A 2KN4A 1SE2A 2G9HD 1FMAD 2LHDA 2DBYA 1F77A 4IDIA 1FNWA 1JWAD 3IXSA 2E6XA 2JX5A 5BYSA 1R7SA 2PLPA 2I38A 4C7YA 4JE3B 4A6QA 1WSPA 1K51A 2LMCA 1IBXB 1CK1A 3KWVA 1XLOA 3RPFC 3W5VB 4HRSA 1FM0D 3ZJTA 2WXPA 1E0ZA 1C79A 1MPEA 3AE9B 3NVWA 1SE4A 2WLBA 3AMZA 4A90A 1L4DB 2SEBD 2XN9C 3P42A 1I4QA 2LUMA 3ETRA 4RGOS 1T3QA 2BS2B 4NJCA 2PVOD 1D4BA 3BVZA 1N63A 4ZYSA 1QILA 1ZXHA 1YJIA 1ZUD2 4LK0M 5EE0A 2WQYB 1UGJA 4RH6A 3AEFB 2WXMA 5D7GA 1C76A 1NEKB 4US8A 1SEBD 3PO0A 2WXKA 3AH7A 3BVGA 2W3RA 2M19A 3U7ZA 4EE2A 1RM6C 1E7PB 1SXTA 3B2GA 1CJEA 2YEPF 4HJGE 4L23A 3AEGB 5H8YE 2Y5CA 2DYMA 4H2AA 1K53A 2YEPB 1E10A 2WXLA 2LHEA 3BK1A 4M0WA 2KMMA 3AE5B 3KLSX 4XWTA 1QT9A 1V97A 3BIID 2SAKA 2ACZB 3URYA 1QOGA 2INPE 3AEDB 3CWIA 1AYFA 3AECB 4DQOC 1AN8A 1DOYA 4ITKA 1Q10A 1D5XC 1I7HA 2CJOA 2EELA 4O1NA 1JW9D 1YJJA 1WRIA 4A8XC 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L32 A;  2LJI A; 
#chains in the Genus database with same CATH topology
 1J7A A;  1ZE3 D;  1L0V B;  3HVZ A;  2K22 A;  5G2N A;  2JRH A;  3SDL C;  4D2K A;  4E3C A;  2ZW0 A;  4ANV A;  3Q69 A;  4CO7 A;  2WU2 B;  3PV1 A;  3HRD D;  1MJD A;  5E6P A;  4LJP B;  1C1Y B;  1UBI A;  3JYU A;  4MEM A;  2WP9 B;  2WGS A;  4MM3 A;  3KYC D;  1EF1 A;  3V6E B;  3BIN A;  2XK5 B;  3K9O B;  4K3B A;  4KKI A;  3AE7 B;  2IND C;  1C3T A;  1J7C A;  1C77 A;  2WXF A;  1OQQ A;  4W9K A;  1F2R I;  2ZW1 A;  4YWG G;  4ARC A;  4WWM A;  3Q3N C;  3J9C A;  2J4X A;  1NYR A;  3DHH C;  2MWS B;  3EUB 2;  3QAR A;  2KTR B;  1G6J A;  1PGA A;  1EWY C;  2J0J A;  2IO2 B;  1GB4 A;  3Q6B A;  1GPX A;  4KGR A;  1N6Z A;  1GG3 A;  3VUW A;  2LVP A;  1V81 A;  2L3Z A;  2KLC A;  5DCN A;  2W9N A;  1JCK B;  1RAX A;  4YTM B;  3WCQ A;  5G5H A;  2VZK D;  3RYT A;  5C2T B;  3ZLZ A;  2XEW A;  3R8B A;  3RUL A;  2JY6 A;  1P7F A;  4MH0 E;  4MT5 A;  4TUU A;  3HK0 A;  1VZ8 A;  2NTT A;  1OTR B;  2KYW A;  4J6I A;  3RZF A;  2WNM A;  4AOF A;  3ZRF A;  3V05 A;  4CHK A;  2PPH A;  3AB5 A;  2X8X X;  2ZZP B;  1SIF A;  2JSV X;  2QCZ A;  1A5R A;  3X23 A;  2QIL A;  2FNJ B;  3ZRC A;  2KT7 A;  1VJK A;  1PGX A;  3FAH A;  2JXX A;  1WJN A;  2C7N B;  4HDO A;  3IG3 A;  1EUV B;  2K6Q A;  2LZ6 A;  2VH2 A;  1TBE A;  2QDF A;  1DYQ A;  3ML8 A;  2D2Q A;  2DLB A;  3KUC B;  1LGR A;  1FNU A;  5EE1 A;  1N5W A;  2WDQ B;  3FKY A;  4ZHP A;  2J42 A;  1ESF A;  1XLN A;  1PDX A;  3ZO5 B;  4A3O A;  1SGH A;  2YVC A;  1L0Y B;  4GU2 A;  4C4V A;  1I35 A;  1EF5 A;  1BT0 A;  3V62 A;  2KKC A;  1YN4 A;  3L54 A;  1NEN B;  1EU4 A;  3B0A A;  1V5T A;  5IKC M;  3AV8 A;  3ABV B;  3DHG C;  1QQR A;  4MGI E;  1L0X B;  2MHJ A;  3DBH I;  2D07 B;  3VRA B;  4G50 A;  3VUY A;  2FBW B;  2LGY A;  4RFB A;  3AEE B;  4M0W B;  2HJ1 A;  1WFY A;  2GBR A;  3M3J A;  1GNU A;  3IBE A;  2WXH A;  3UIN B;  1PGB A;  4CYE A;  4WJP A;  1WYG A;  1MVK A;  1QF6 A;  2KVZ A;  4WWO A;  1JWB D;  1V1O A;  3ZYY X;  1UGM A;  3N1X C;  2CU3 A;  2IPK D;  3DHI C;  3VHT C;  4K3C A;  2A4Z A;  2LGX A;  3AE2 B;  3PPA A;  3NRZ A;  5BYR A;  1YJ1 A;  2D11 A;  3DWG C;  3PT2 B;  1J19 A;  2K8B A;  3BK2 A;  1R4M B;  1TY0 A;  2ICI A;  2J53 A;  3DDC B;  2BW2 A;  4EFO A;  1UWM A;  1MG8 A;  3ZXV A;  1YMH E;  3JSV B;  4F1S A;  5J18 A;  4BBN F;  4RM8 A;  4GB9 A;  5CHW A;  2PEA A;  2NBU A;  3RNE C;  1ENF A;  2OJR A;  1V80 A;  3EC8 A;  4NPN A;  4MH8 A;  2OHF A;  2KJ6 A;  4KKJ A;  2Y3A A;  3A4R A;  1FPY A;  3MJW A;  2XK5 A;  2K39 A;  3MHS D;  2ASQ A;  1WYW B;  3E9S A;  3K9P B;  4IWP A;  4AJY B;  3VVW B;  3GS2 A;  4NJ6 A;  1FIQ A;  4AJW A;  1DOI A;  3UQA A;  2BWE S;  3ZW3 A;  1ZDV A;  1E8Y A;  2JYT A;  2KTR A;  3T3N A;  1EO6 A;  2WXN A;  2MJ3 A;  1L2N A;  1WX9 A;  4GDK B;  4YT0 B;  2Q5W D;  5L95 C;  2M1M A;  1TS4 A;  2KMC A;  1RLF A;  3QCA A;  3RD2 A;  4AUQ C;  2LD9 A;  4RGN A;  1L4Z B;  2RDG A;  3N3K B;  2KX0 A;  1VZ6 A;  4LNK A;  4YL8 A;  5KHQ A;  3A4S C;  3NVV A;  1MHH E;  1IYF A;  1WMH B;  1E5W A;  3B1L X;  5BMI A;  4WWP A;  2KDB A;  3ONS A;  3X0W A;  4OVZ A;  4OZA A;  5DPS A;  2WXG A;  1IPG A;  3MJ5 A;  2IBI B;  1J7B A;  2PKO A;  3V3X A;  4GDL B;  1LO5 D;  4P16 A;  1YNT E;  4NY0 A;  1E8W A;  3APD A;  3KQ4 A;  1SE2 A;  1P3Q U;  2L7R A;  1OEY A;  2E6X A;  2J0M A;  2KO3 A;  5BYS A;  2PLP A;  4HPP A;  2GOW A;  4C7Y A;  1K51 A;  2R2Q A;  4MEL A;  1NBF C;  1FM0 D;  3ZJT A;  2WXP A;  2CHZ A;  3W1Y A;  3AE9 B;  4P7I A;  1VD2 A;  4A90 A;  2G4D B;  3P42 A;  1I4Q A;  2L76 A;  4NJC A;  3QHT A;  2WQY B;  4EZL A;  3CMM B;  3S2A A;  3VTU A;  5J17 A;  2K8H A;  4RH6 A;  2IYD B;  4K7U A;  3PO0 A;  4GXB A;  1E7P B;  3B2G A;  3R3M A;  4L23 A;  4F8C B;  2KHW B;  3N1Z C;  2JWZ A;  2YEP B;  1E10 A;  3KYD D;  4KV2 A;  2LHE A;  4M0W A;  2N7E A;  3JW0 X;  1QT9 A;  3BII D;  2ACZ B;  3PLU A;  4X57 B;  2N4F A;  4DQO C;  2KDI A;  4ITK A;  4DDI D;  1UD7 A;  1WGH A;  4BFR A;  3GE8 C;  4ICV A;  2AL6 A;  1K52 A;  2Z0E B;  3PZ8 A;  2KQ7 A;  5KHO A;  1VLB A;  4YSX B;  1ZXI A;  2ZVO A;  4BKS A;  4IW0 A;  4KDL B;  3MC0 B;  3OG5 A;  3PZD A;  3RUI B;  2OED A;  1F9J A;  1V1P B;  3CF6 E;  2IDY A;  2PVG C;  1C9F A;  3DBH B;  4A3P A;  2FUG 1;  2L0F A;  1KF6 B;  1FXA A;  1GAQ B;  1B9R A;  3DVG X;  3L08 A;  3PTF C;  4UDU C;  3ZJU A;  1Q0W B;  2DZM A;  1HXY D;  4GN1 A;  3A9J B;  3JSV A;  1SJE D;  4YTP B;  2RDH A;  2K5P A;  4PYZ A;  2GBK A;  3ZUN A;  2G45 B;  1WY8 A;  2RDB C;  5AZH A;  2VH1 A;  2QEJ C;  4G3X B;  2JZ3 B;  4FLH A;  3AXC A;  4GMV A;  1TGZ B;  2BTE A;  2BT6 A;  1CQV A;  4ZOH C;  2IGD A;  1TZO A;  3BYY B;  1LXD A;  2FCQ A;  1XEE A;  1Z2M A;  1PUT A;  4ZDV A;  4HPM B;  4GLS C;  3NG0 A;  3LB8 C;  2MW5 A;  1WJU A;  1GJZ A;  2INC C;  4KGT A;  1OEY J;  2PW9 A;  4M01 A;  2VRR B;  1Q1O A;  2V4L A;  3ENE A;  3W1S A;  3IAS 1;  2JU6 X;  2MBE A;  4N58 A;  2KOX A;  1WXM A;  2JZZ A;  3UQB A;  4BBN C;  1XO3 A;  2MEK A;  4MSQ B;  4GDK A;  1SF0 A;  3IFW B;  3NVZ A;  5T8I A;  1T0R C;  3SEB A;  3APF A;  1TTN A;  1P1A A;  1XD3 B;  4FXC A;  2JPH A;  5D2M B;  1F52 A;  1VR9 A;  4IM3 A;  1SIJ A;  1M94 A;  2KX3 A;  4ZRP A;  2BKR B;  2O6V B;  4B6W A;  1GC7 A;  3PVL A;  2IY0 B;  3GE3 C;  1E8X A;  1WMH A;  4W9G A;  4DK5 A;  4M8N A;  1H8C A;  2BYV E;  1HZ6 A;  2REX A;  3T8M A;  3EA6 A;  3VXW A;  4XZ4 A;  2LJ5 A;  4E71 A;  3W5U B;  3EFC A;  3PS6 A;  2NCN A;  2Y5P A;  1C4A A;  3MFG A;  3WAL A;  5IO9 A;  1HTQ A;  2MBH A;  4KZC A;  3HM3 A;  4XWW A;  2FCN A;  4IM0 A;  3H8H A;  4GDL A;  4BKG A;  3ZDT A;  3SU8 X;  2NBW B;  2D5G A;  1CMX B;  4I6L B;  5CHF A;  4JLC A;  4PYU A;  4C00 A;  3HHM A;  2AEH A;  3IVF A;  4DWF A;  3NZU A;  4FJV B;  2FE8 A;  3LJ3 A;  5H92 C;  4NAM A;  3WIM A;  2LAS A;  3Q3F A;  3UIO B;  2R61 A;  3ZGZ A;  4HXD A;  3AE4 B;  3B9J A;  2ONQ A;  4XYC A;  3WA0 A;  2KWU B;  2RPQ A;  4GOC A;  4NAW B;  3ZNI D;  3GZN I;  3NOB A;  1BXT A;  4N6E B;  2W82 A;  1SJH D;  2BS4 B;  5I4D A;  1Y56 A;  3TSS A;  1NI3 A;  2AYO B;  1R4N I;  2JF5 A;  1D6E C;  2L83 A;  3R2I A;  4K7S A;  3PRE A;  3DWM A;  3GB1 A;  5CX3 A;  1K8R B;  4IKG A;  5LLI A;  3ALB A;  1DGJ A;  1ZGU B;  4ZHO A;  4URK A;  4MDK E;  4WUR A;  2CKH B;  3Q8F A;  4FA6 A;  3BVM A;  2LRW A;  1LQB A;  1WR6 E;  2Y5B B;  3R66 C;  3LDZ E;  3PZ7 A;  4ANW A;  4A9A A;  2INN E;  2KVR A;  3SFD B;  1B1Z A;  3AN1 A;  2K0P A;  2WDR B;  1MFW A;  5G55 A;  1A70 A;  3AE6 B;  3HVD A;  2KAN A;  3NY5 A;  2IJ0 A;  4EOY A;  1V49 A;  2WX1 A;  3AE3 B;  1JRU A;  1V1P A;  4II3 B;  4NNJ B;  3SR6 A;  3NZS A;  2WXQ A;  4HRO A;  4ANX A;  3PHX B;  4F7Z A;  4BVU C;  2WS3 B;  1K50 A;  2LVO A;  2GMI C;  4BKS D;  1SE9 A;  5E6O A;  5IAA C;  3VFK A;  3A9J A;  2RD0 A;  3NS8 A;  2N9K A;  3TL5 A;  3H6N A;  2W54 A;  5DPW A;  2K1F A;  2RGF A;  4RF1 A;  1HQR D;  4WQM A;  4LNO A;  3R2T A;  2WWZ A;  2G3Q B;  2KWD A;  4ZRK A;  1L7Y A;  1WGG A;  1V6E A;  2MBB B;  2DHZ A;  3PRP B;  1QZE A;  3V61 A;  1E7U A;  1ET6 A;  1VCB A;  2I1K A;  4DDG D;  4IUM B;  1RYJ A;  4RNA A;  2L0T A;  3KUZ A;  3N1Y C;  4M02 A;  1IGD A;  1UUP A;  2LGD A;  1WXA A;  1L6V A;  1ET9 A;  3WAP A;  2VZK B;  1YN5 A;  1XT9 B;  4LNN A;  3DQV A;  2M17 A;  1QKZ A;  2WDV B;  4W9F A;  2LRU A;  3MHZ A;  1KM7 A;  2B3A A;  2IGG A;  4TQ1 A;  4IOI E;  4AS1 A;  5AUK A;  5TSS A;  2R2O A;  3Q3J A;  4A55 A;  3BY4 B;  3AEA B;  2O6V A;  2GLS A;  2G4S A;  1VRA B;  3ZIM A;  1FMA D;  1UH6 A;  3IXS A;  3DPD A;  2OJW A;  2JX5 A;  2I38 A;  1IBX B;  2N9E B;  2O2V B;  4HRS A;  1E0Z A;  1C79 A;  5IN7 A;  3V60 A;  1MPE A;  1IP9 A;  3APC A;  2WLB A;  3NHE B;  3CSF A;  3AU5 A;  4GSW A;  3DBS A;  2LUM A;  4RGO S;  1T3Q A;  1D4B A;  3TBL D;  1QIL A;  1ZXH A;  4LK0 M;  5EE0 A;  2IO3 B;  2ZEQ A;  1WJ6 A;  3M62 B;  3ZNH B;  5D7G A;  1C76 A;  4WJQ A;  1SEB D;  2DNF A;  2M19 A;  4FHJ A;  1J0G A;  1RM6 C;  1SXT A;  1CJE A;  2YEP F;  3L17 A;  2Y5C A;  5E6N A;  4NAW A;  3C19 A;  1V9J A;  3BK1 A;  3VH3 B;  2KMM A;  3AE5 B;  4XWT A;  2HD5 B;  1QOG A;  2KDE B;  3ZXR A;  3ECI A;  3TMP B;  4KSK C;  4G0N B;  1ZKH A;  2K25 A;  4O1N A;  1JW9 D;  1KFY B;  2IZV B;  4A8X C;  4OHJ A;  2ZNV B;  3RNC C;  1JAL A;  1V8C A;  4ICU A;  3OJ4 B;  1QOB A;  2KAC A;  3UI3 A;  2KNB A;  2KMA A;  5JHA A;  1FCC C;  2BGF A;  3L13 A;  3RN9 C;  3Q3O C;  1EM7 A;  2BPS A;  2JVC A;  2DWQ A;  1U4A A;  2LEK A;  2KWC A;  1IGC A;  3RCZ A;  5BO4 B;  3SFE B;  2QSD A;  2BYT A;  4DHJ B;  1TKY A;  1YOV B;  5GMV A;  5C1Z A;  5C3J B;  2AQ2 B;  3CIR B;  5G5G A;  1MHX A;  1XLQ A;  2CR5 A;  1R4N B;  2LGS A;  1OQY A;  3LYY A;  1I4X A;  4LTU A;  4B0M A;  4RGM A;  3N9Y C;  2WXO A;  3O13 A;  5CHV C;  2PE6 B;  1GOZ A;  4W9C A;  1GB1 A;  5HG2 A;  1WWT A;  4W9I A;  1GUA B;  1S3S G;  2DX5 B;  1V5O A;  3KVF B;  3UF8 A;  1PQS A;  4AQ7 A;  2C5L C;  1FO4 A;  4PK1 A;  4LDT D;  2BYF A;  2ZVN A;  1SE3 A;  4OW0 A;  2B76 B;  2JQR B;  1D5M C;  4RGT A;  1C78 A;  1WX8 A;  2MLB A;  1RFA A;  1WX7 A;  4ANU A;  2V4I B;  2H88 B;  3GP7 A;  1T6B X;  1X1M A;  1AAR A;  2EKI A;  3GOE A;  2QHO A;  4BOZ B;  3RMK C;  1JRP A;  3U30 A;  1YIW A;  4W9E A;  4JQW C;  3A33 B;  2M56 B;  2LWP A;  3EGR A;  1P9D U;  2WXI A;  5HHD G;  1SBB B;  2GBJ A;  1YX6 B;  1TKE A;  3LXF A;  3P4S B;  1E9M A;  2XNA C;  3C0R B;  5MPO A;  2IGH A;  4R3D A;  3W1S C;  1WH3 A;  3A9K B;  4KX6 B;  4JPS A;  1BUI C;  2NTS A;  3QQ8 B;  4WJO A;  2DYO A;  1ZDX A;  4EKU A;  1MG4 A;  1QLB B;  3CST A;  1F1H A;  3BYT B;  2M0X A;  2C9W B;  2WXR A;  2X38 A;  1BML C;  1F0Z A;  1FRD A;  4FJY A;  4XC2 A;  2KQ4 X;  2BS3 B;  4WWN A;  1E7V A;  2ZJD A;  2BWF A;  2CHX A;  2MBQ A;  5HKH A;  4WAA A;  5TR5 A;  3ZTC A;  1Z5S B;  1XCQ L;  1TJE A;  2MBO A;  2MH7 A;  4KVG B;  1IBX A;  2V3S A;  2AQ1 B;  4PS8 A;  2MX2 A;  1JML A;  2O2V A;  1TS3 A;  2D10 A;  1F2R C;  2O6V D;  1FFU A;  2TSS A;  4YSZ B;  1QOA A;  4USA A;  4C7Z A;  2H89 B;  4XDC A;  4MGZ E;  4JL9 A;  2G1E A;  4YSY B;  1FFV A;  4NQK E;  4ZRQ A;  1HTO A;  3H7S A;  3N20 C;  2MQJ A;  1WGR A;  4TV3 A;  4L2Y A;  1TY2 A;  2K8C A;  1J8C A;  1NVI D;  2C60 A;  4RF0 A;  3VTV A;  1EWC A;  1WI0 A;  3WAN A;  5C23 A;  4ZRJ A;  3E56 A;  1UBQ A;  1E90 A;  1WXQ A;  4TMA B;  4DXF A;  1P98 A;  5FK9 C;  2ZCC A;  2BB6 A;  5GXG B;  3VAW A;  3ZKJ C;  3ZQ4 A;  4KGS A;  2MP2 A;  3B2F A;  2FAZ A;  2PJH A;  4XGA B;  3DVN U;  1HE8 A;  2KC2 A;  5BYQ A;  3DBR I;  2HDE A;  5D3I B;  1ZOY B;  2JRI B;  1T5X D;  2RR9 A;  2RSU A;  3P1M A;  1ACC A;  4OVU A;  2L00 B;  3QK0 A;  4N59 A;  1KTK A;  2RPV A;  3PGE A;  2D3G A;  1CZP A;  5DPT A;  3A1Q B;  3AUL A;  3TJP A;  2NVU I;  3U8Z A;  1C4C A;  2DAJ A;  4G11 A;  3H9D A;  4FJZ A;  4BKT A;  2ZPY A;  3VRB B;  4OZC A;  4ASW C;  1S1Q B;  1XF5 L;  1P7E A;  2KDF B;  4IC7 B;  4DBG A;  1HZ5 A;  4LJO B;  3R7R A;  3UGB B;  2V3N A;  3AEB B;  4HJK A;  1UWX A;  3RI7 C;  3I63 C;  3Q8C A;  2WHI A;  1E6E B;  2MCN B;  4EEW A;  4KZ0 A;  3VUX A;  3RFZ B;  2I2Y A;  4BAX A;  4JWU C;  3U2S C;  1ROE A;  3P63 A;  5JHB A;  2NPT B;  3QIJ A;  4WJN A;  3FIL B;  1DOX A;  2N9L A;  2N1V A;  1WRD B;  4DXA B;  4S0R A;  3TIX A;  1Q5W B;  2M0A A;  2JXT A;  3VTW A;  1WXV A;  1FD6 A;  4TKN A;  2E3T A;  1FRR A;  3MC9 A;  3EHV A;  2RMM A;  4RMA A;  4EUT A;  3PLV A;  4P1B C;  1WM2 A;  1N62 A;  4S17 A;  4C80 A;  2AWT A;  2NMQ A;  4N9F 4;  2KFK B;  4WIP A;  5FKA C;  4E74 A;  2LVQ A;  4HDQ A;  3H7P B;  3TUO A;  1WM3 A;  3PSE B;  2LXA A;  5AEK B;  3I57 A;  3IT6 B;  3SD5 A;  2WDT B;  4NQL B;  4DHZ B;  1Y8R C;  1N5X A;  1YQ3 B;  3L16 A;  3AE1 B;  4K1R B;  3TEX A;  2KN4 A;  1FNW A;  1JWA D;  1XQQ A;  1R7S A;  3A9K A;  1LFD A;  2DZJ A;  4A6Q A;  1WSP A;  2LMC A;  1CK1 A;  2FCS A;  1XLO A;  3RPF C;  4JGH B;  3N32 A;  1UF0 A;  1V86 A;  2CU1 A;  4HCN B;  4EZJ A;  2HTH A;  5AZF A;  2V9H A;  3NVW A;  3AMZ A;  2HE7 A;  2SEB D;  3L0W B;  2IO0 B;  2XN9 C;  2CS4 A;  3ETR A;  2PVO D;  4ZYS A;  3KW5 B;  3RNA C;  1YJI A;  2NBV B;  1UGJ A;  3T9L A;  3AEF B;  1NEK B;  1D3Z A;  2WXK A;  2KJH B;  3BVG A;  2W3R A;  1WF9 A;  1I42 A;  4EE2 A;  2KQS A;  3N30 A;  4HJG E;  1TIF A;  3B08 A;  5H8Y E;  2DYM A;  2WXL A;  3HM6 X;  2N7D A;  3KLS X;  1OGW A;  4IWQ A;  2SAK A;  4GIV A;  2OOB B;  2UWQ A;  3O65 B;  2INP E;  5IOI A;  3RT3 B;  3AEC B;  1DOY A;  4QAY A;  1D5X C;  4MJS B;  1I7H A;  2CJO A;  2EEL A;  1KOT A;  3I5J C;  1YJJ A;  2KN5 A;  2HTM E;  3M63 B;  3Q3M C;  3WAM A;  4AWJ A;  3C8Y A;  4XE0 A;  1ISN A;  2EMT A;  3AM9 A;  2QMT A;  1N61 A;  2EKE C;  3OAW A;  4JIO U;  4ZRI A;  3P4Q B;  1SSN A;  1TT5 B;  4KDI C;  3ZNG C;  2KWV B;  1MI0 A;  1UEL A;  3DOW A;  2DYB A;  1JQ4 A;  1NI2 A;  3SHQ A;  1I4H A;  3ZTD A;  4C56 C;  4I6P A;  2GRI A;  3M95 A;  1T0S C;  4P1C C;  4I6N B;  1L6U A;  2C7H A;  5BMH A;  4P6V F;  3HIZ A;  2KLG A;  3H1U A;  4OZB A;  3A1Q A;  5D3D A;  1FEH A;  3PRM B;  1RRB A;  5EE9 A;  1NDD A;  2UU7 A;  2KD0 A;  2YLM A;  5HFY A;  3VQI A;  3KH0 A;  2LGI A;  3ZNZ B;  1C4P A;  4FHK A;  2W55 A;  3TEZ A;  1ZPS A;  4DHZ E;  2V0G A;  3T3O A;  1JWM D;  4YXD B;  2AQ3 B;  2ZCB A;  2HJ8 A;  2KXJ A;  3IHP C;  1OFF A;  2L52 A;  1WIA A;  1RFK A;  2V1Y A;  4REZ A;  2WU5 B;  3RNB C;  3U52 E;  3DBR B;  3P2B A;  4WAF A;  3W9C B;  2PE9 A;  2W3S A;  2M8S A;  1PFD A;  2N7J A;  2NPT A;  3U7D A;  2N1W A;  2J0K A;  4L1B A;  3FIL A;  2K6D B;  1HEZ E;  1EU3 A;  4DHJ D;  1AW7 A;  4AP4 C;  3JVZ X;  4XX5 A;  4J3O D;  2GB1 A;  5JXV A;  1RWS A;  2KDM A;  4HPL B;  3DCG A;  5CTR C;  3BZD B;  2FCM A;  3IAM 1;  1XCT L;  4RCO A;  4RM9 A;  1ZP0 B;  2I1J A;  3DBL I;  1ZW7 A;  2MP2 B;  3DVG Y;  2KFK A;  1N60 A;  3ZJV A;  5FR3 A;  4W9L A;  1YX5 B;  3H7P A;  4MSM B;  1JWU D;  1L5P A;  2AL3 A;  1KRH A;  3I3T B;  4LNI A;  2L8J A;  1AWD A;  3VR8 B;  4B9K A;  1HA5 A;  2CHW A;  2D3B A;  4CQN A;  1FNV A;  3ML9 A;  4PS7 A;  1JWS D;  3RNG C;  4ARI A;  1OQR A;  1TS2 A;  2XBB C;  2GI9 A;  3Q2A C;  1M4V A;  5IA7 A;  1H4R A;  2KZR A;  4K7W A;  5D94 A;  1WR1 A;  2EMS A;  4IG7 B;  2BVC A;  4OVV A;  3R7Q A;  3Q8B A;  2L32 A;  2N9X A;  5JZE B;  3UIP B;  1FCL A;  2JWU A;  5E6J A;  1NYQ A;  3QC8 B;  1I4G A;  3GZN B;  5FR6 A;  3VH4 B;  3ZVV A;  3HUI A;  5EE3 A;  1WZ0 A;  2MJD A;  1YN3 A;  4KIK B;  3QJZ A;  5JH5 C;  2BKF A;  2AX5 A;  2BBC A;  1IUE A;  1KLG D;  3D32 A;  2LJI A;  4HEA 1;  3NVY A;  4B0E A;  3AU4 A;  3PHW B;  3Q14 C;  3Q8E A;  3TEW A;  1STE A;  2L05 A;  2WXJ A;  3OLM D;  1VDV A;  2J7Q B;  2GBM A;  2JZP A;  3MP9 A;  3NS1 A;  1WGK A;  2BF8 B;  4Q2J A;  3QAQ A;  4HCP B;  3NUH B;  2MA9 B;  2FUH B;  3OJ3 A;  2CJN A;  3FC4 A;  3KUD B;  4M8M A;  2PTL A;  5LXH A;  2ZPN A;  1KLU D;  2KC1 A;  2MRP A;  2L1A A;  3QWZ B;  1YD8 U;  4FBJ B;  1D5Z C;  2C7M B;  1WE6 A;  3P4R B;  4YTN B;  2PIA A;  2IO1 B;  2QJL A;  2JYE A;  4B95 A;  2MJE A;  4LNF A;  2NS5 A;  1V2Y A;  1FXI A;  2BB5 A;  4HWI B;  2PMV A;  1UNS A;  4MJS A;  1WXS A;  4FN2 A;  1KH0 A;  1TS5 A;  2K3U A;  4JWS C;  4MM3 B;  4M00 A;  4TSS A;  4IWO A;  1I4P A;  1XXG A;  1T0Y A;  4FUL A;  2LI5 A;  4HKQ A;  4PS3 A;  1YQ4 B;  1E8Z A;  5L83 A;  2KJR A;  3TCA A;  4A20 A;  2QIE B;  4NJ7 A;  4LLG M;  2DEN B;  3P4P B;  2LFI A;  3V6C B;  4ZYN A;  3QA8 A;  5J2R A;  1LM8 B;  2JT4 B;  2V3P A;  1QOF A;  3I9V 1;  2N0S B;  3RZW C;  2ON8 A;  3KWL A;  2FID A;  4MAC A;  5BMG A;  3Q8A A;  4MGK E;  2FIF A;  2BQQ A;  5AUI A;  2Z8L A;  2ZNV C;  1SB3 C;  1JRO A;  2QC8 A;  2WX0 A;  4II2 B;  3NJT A;  2GBN A;  5LXI B;  3L4P A;  3WAO A;  4WQO B;  5D6J B;  2WYQ A;  4FAD A;  2DAF A;  5LNK 1;  3AI5 A;  1TYG B;  4DXG A;  2LXC A;  2M4N A;  2D3A A;  1WE7 A;  4HKZ E;  3W2D A;  1FXT B;  1KJT A;  2KAJ A;  2NR2 A;  4IM2 A;  4LDT B;  5EDS A;  4US9 A;  5AZG A;  3NZ3 A;  2KK8 A;  4WH4 A;  3MTN B;  1WJ4 A;  3OWE B;  4BZA A;  5HI1 A;  3VR9 B;  1I4R A;  4W9J A;  1KLV A;  4W9H A;  3TEY A;  3L10 B;  3IT4 B;  1PYW D;  3MC8 A;  2A5U A;  4KSL C;  1WGY A;  2N9P C;  3BWU D;  3U4E G;  1TKG A;  4JX1 C;  1P0R A;  1VZ7 A;  1XLP A;  4ACF A;  3AE8 B;  3QX1 A;  4NZL B;  4PT5 A;  4XDD A;  4K81 A;  1YQB A;  2K9X A;  4TQ0 A;  2Z0D B;  4HVB A;  4GGQ A;  4LCD E;  2J52 A;  2BYE A;  2G9H D;  4C4V B;  2LHD A;  2DBY A;  1F77 A;  4IDI A;  3DVN V;  2DZK A;  4EZK A;  1UZX B;  5IP4 D;  1GC6 A;  4W9D A;  4JE3 B;  3KWV A;  3W5V B;  5DPR A;  4HK2 A;  1SE4 A;  1TZ1 A;  1L4D B;  2UYZ B;  2KTF A;  4MGY E;  1R4M I;  4BOS C;  1WZ3 A;  2BS2 B;  3BVZ A;  1N63 A;  1ZUD 2;  3EFU A;  2WXM A;  2D3C A;  4US8 A;  2LUE A;  1WGD A;  3DBL B;  1T0Q C;  3AH7 A;  3U7Z A;  3PRZ A;  2DZI A;  4KIK A;  2JUO A;  3AEG B;  2IY1 B;  4H2A A;  1K53 A;  2MSE D;  1V97 A;  3ZDM C;  3EEC A;  3URY A;  2Z59 B;  2KFJ A;  3AED B;  3CWI A;  1AYF A;  3VDZ A;  4HLE A;  1AN8 A;  1Q10 A;  3RNF C;  1WRI A; 
#chains in the Genus database with same CATH homology
 2HTM E;  1JAL A;  1J7A A;  1V8C A;  1ZE3 D;  3C8Y A;  4XE0 A;  1K52 A;  3PZ8 A;  1L0V B;  1VLB A;  3AM9 A;  2K22 A;  3HVZ A;  1QOB A;  4YSX B;  1ZXI A;  2QMT A;  1N61 A;  2KAC A;  3UI3 A;  4D2K A;  3MC0 B;  3P4Q B;  1SSN A;  2OED A;  1FCC C;  1V1P B;  2ZW0 A;  3Q69 A;  1MI0 A;  2IDY A;  2PVG C;  2WU2 B;  3HRD D;  1C9F A;  1JQ4 A;  2FUG 1;  2WP9 B;  1KF6 B;  1I4H A;  1FXA A;  1GAQ B;  4C56 C;  1B9R A;  1EM7 A;  2GRI A;  4UDU C;  2DWQ A;  3ZJU A;  2LEK A;  1IGC A;  1HXY D;  4KKI A;  3AE7 B;  1L6U A;  1J7C A;  1SJE D;  5BMH A;  1C77 A;  4P6V F;  4YTP B;  2WXF A;  2QSD A;  3SFE B;  1OQQ A;  2RDH A;  2K5P A;  2BYT A;  1TKY A;  4OZB A;  5C3J B;  2AQ2 B;  3CIR B;  5G5G A;  1F2R I;  2ZW1 A;  1MHX A;  1XLQ A;  4YWG G;  2QEJ C;  4ARC A;  5D3D A;  4WWM A;  3LYY A;  1FEH A;  3J9C A;  2J4X A;  1I4X A;  4LTU A;  1NYR A;  5EE9 A;  4B0M A;  4RGM A;  3N9Y C;  2WXO A;  3O13 A;  3EUB 2;  2BTE A;  5HFY A;  2BT6 A;  1GOZ A;  1PGA A;  3VQI A;  1GB1 A;  2LGI A;  1C4P A;  1EWY C;  5HG2 A;  1CQV A;  1WWT A;  4ZOH C;  2IGD A;  1GB4 A;  2W55 A;  3TEZ A;  1TZO A;  1ZPS A;  4AQ7 A;  3BYY B;  1GPX A;  1XEE A;  2V0G A;  4KGR A;  1PUT A;  3T3O A;  1JWM D;  4YXD B;  1FO4 A;  2AQ3 B;  4GLS C;  3LB8 C;  1OFF A;  1SE3 A;  4OW0 A;  2L52 A;  1RFK A;  2B76 B;  4REZ A;  2JQR B;  1D5M C;  2WU5 B;  4RGT A;  1JCK B;  1C78 A;  4KGT A;  3U52 E;  4YTM B;  2PW9 A;  4WAF A;  3W9C B;  3WCQ A;  5G5H A;  2VZK D;  2V4I B;  2W3S A;  5C2T B;  3W1S A;  1PFD A;  3IAS 1;  2N7J A;  2H88 B;  2JU6 X;  3R8B A;  3GP7 A;  4N58 A;  1P7F A;  1T6B X;  4MT5 A;  4L1B A;  3FIL A;  1XO3 A;  1HEZ E;  2MEK A;  1EU3 A;  1SF0 A;  1VZ8 A;  2NTT A;  3NVZ A;  5T8I A;  1AW7 A;  2WNM A;  3V05 A;  3SEB A;  3AB5 A;  4J3O D;  2EKI A;  2GB1 A;  4FXC A;  2JSV X;  1JRP A;  1VR9 A;  5JXV A;  1RWS A;  1SIJ A;  2QIL A;  2KDM A;  4ZRP A;  2M56 B;  3EGR A;  2WXI A;  5HHD G;  3BZD B;  1SBB B;  1VJK A;  3IAM 1;  1XCT L;  4RCO A;  1TKE A;  3LXF A;  1ZP0 B;  1PGX A;  3FAH A;  3P4S B;  1E9M A;  2XNA C;  5MPO A;  2IGH A;  1HZ6 A;  4R3D A;  1N60 A;  3EA6 A;  3ZJV A;  5FR3 A;  4KX6 B;  4JPS A;  1BUI C;  1JWU D;  1L5P A;  1DYQ A;  2NTS A;  3W5U B;  1KRH A;  2DLB A;  2Y5P A;  1C4A A;  1AWD A;  3MFG A;  1FNU A;  3VR8 B;  2DYO A;  1HA5 A;  1ZDX A;  5EE1 A;  1N5W A;  4CQN A;  2WDQ B;  4XWW A;  1FNV A;  1QLB B;  4ZHP A;  3H8H A;  2J42 A;  1ESF A;  3BYT B;  2X38 A;  1JWS D;  2WXR A;  4ARI A;  1BML C;  1F0Z A;  1OQR A;  1XLN A;  1FRD A;  1PDX A;  2D5G A;  1TS2 A;  2KQ4 X;  2GI9 A;  2BS3 B;  1M4V A;  1L0Y B;  1XCQ L;  1TJE A;  1YN4 A;  2MH7 A;  3Q8B A;  1NEN B;  1EU4 A;  2L32 A;  2FE8 A;  5H92 C;  4NAM A;  1IBX A;  3AV8 A;  1FCL A;  2AQ1 B;  3ABV B;  2JWU A;  2R61 A;  5E6J A;  1JML A;  1NYQ A;  3ZGZ A;  1I4G A;  1TS3 A;  3AE4 B;  1F2R C;  1QQR A;  1L0X B;  3B9J A;  3HUI A;  5EE3 A;  1FFU A;  2ONQ A;  2TSS A;  3VRA B;  4YSZ B;  2MJD A;  1YN3 A;  2AX5 A;  2BBC A;  1IUE A;  1KLG D;  2LJI A;  1QOA A;  4NAW B;  2FBW B;  4USA A;  4C7Z A;  2H89 B;  4RFB A;  4HEA 1;  3AEE B;  4XDC A;  3NVY A;  2G1E A;  4B0E A;  4YSY B;  1FFV A;  3Q8E A;  3TEW A;  1STE A;  1BXT A;  4N6E B;  4ZRQ A;  2WXJ A;  2W82 A;  1SJH D;  2BS4 B;  5I4D A;  1VDV A;  1Y56 A;  2JZP A;  2WXH A;  3MP9 A;  3TSS A;  1PGB A;  4L2Y A;  3NS1 A;  1TY2 A;  1WGK A;  1NI3 A;  4Q2J A;  1NVI D;  4RF0 A;  1WYG A;  3NUH B;  1EWC A;  1MVK A;  2CJN A;  3FC4 A;  3R2I A;  1D6E C;  2L83 A;  3E56 A;  1QF6 A;  3DWM A;  3GB1 A;  1WXQ A;  4TMA B;  1JWB D;  1V1O A;  4IKG A;  3ZYY X;  4DXF A;  2PTL A;  5FK9 C;  2CU3 A;  2IPK D;  1DGJ A;  1KLU D;  2BB6 A;  5GXG B;  4ZHO A;  2L1A A;  4WUR A;  3ZQ4 A;  1D5Z C;  3P4R B;  4YTN B;  3Q8F A;  2PIA A;  3BVM A;  3AE2 B;  2QJL A;  4KGS A;  2JYE A;  3B2F A;  3NRZ A;  2MJE A;  5BYR A;  1FXI A;  3PZ7 A;  2BB5 A;  3DWG C;  2PMV A;  1UNS A;  4A9A A;  2INN E;  5BYQ A;  3SFD B;  3BK2 A;  1KH0 A;  1B1Z A;  2HDE A;  3AN1 A;  1TS5 A;  2K3U A;  2K0P A;  5D3I B;  2WDR B;  1ZOY B;  4JWS C;  1TY0 A;  2ICI A;  2J53 A;  4MM3 B;  2BW2 A;  1T5X D;  4TSS A;  1A70 A;  1UWM A;  1I4P A;  1KFY B;  1ACC A;  1XXG A;  1YMH E;  3AE6 B;  3HVD A;  3P1M A;  4N59 A;  1KTK A;  2RPV A;  1CZP A;  4HKQ A;  2IJ0 A;  1YQ4 B;  3AE3 B;  1V1P A;  1ENF A;  1C4C A;  3SR6 A;  2QIE B;  2WXQ A;  4HRO A;  2OHF A;  4LLG M;  4KKJ A;  4MH8 A;  3P4P B;  2LFI A;  2Y3A A;  3VRB B;  4OZC A;  1XF5 L;  2V3P A;  1P7E A;  1QOF A;  2WS3 B;  1K50 A;  1HZ5 A;  3I9V 1;  2N0S B;  2V3N A;  2ON8 A;  3KWL A;  3AEB B;  4MAC A;  1UWX A;  5BMG A;  3Q8A A;  3Q8C A;  3E9S A;  1E6E B;  5AUI A;  2Z8L A;  1SB3 C;  1JRO A;  2N9K A;  3RFZ B;  2I2Y A;  3GS2 A;  2W54 A;  1FIQ A;  4RF1 A;  1HQR D;  4JWU C;  4WQM A;  3U2S C;  3L4P A;  1DOI A;  1ROE A;  3P63 A;  1ZDV A;  2JYT A;  3R2T A;  3T3N A;  5LNK 1;  2WXN A;  3FIL B;  1DOX A;  2MJ3 A;  1TYG B;  4DXG A;  2KWD A;  4GDK B;  2N9L A;  4HKZ E;  4YT0 B;  2Q5W D;  3W2D A;  1TS4 A;  1ET6 A;  4RGN A;  2KAJ A;  1L4Z B;  2RDG A;  2M0A A;  2JXT A;  1RYJ A;  1FD6 A;  4RNA A;  4US9 A;  1VZ6 A;  2E3T A;  1FRR A;  3NZ3 A;  1IGD A;  2RMM A;  1UUP A;  4WH4 A;  1L6V A;  3NVV A;  1MHH E;  1ET9 A;  1N62 A;  3OWE B;  4C80 A;  5HI1 A;  2VZK B;  3VR9 B;  1YN5 A;  1I4R A;  2NMQ A;  3TEY A;  3IT4 B;  5BMI A;  1QKZ A;  2WDV B;  1PYW D;  4WIP A;  3MHZ A;  5FKA C;  2IGG A;  3BWU D;  4OVZ A;  3U4E G;  3TUO A;  4TQ1 A;  1TKG A;  4OZA A;  4IOI E;  4AS1 A;  5AUK A;  4JX1 C;  5TSS A;  2WXG A;  3MJ5 A;  1VZ7 A;  1J7B A;  2PKO A;  3I57 A;  3IT6 B;  1XLP A;  3V3X A;  3AE8 B;  4NZL B;  4A55 A;  3AEA B;  4PT5 A;  1N5X A;  4GDL B;  1LO5 D;  4XDD A;  1YQ3 B;  4P16 A;  2K9X A;  3AE1 B;  4TQ0 A;  1YNT E;  2J52 A;  1VRA B;  3TEX A;  3KQ4 A;  2KN4 A;  1SE2 A;  2G9H D;  1FMA D;  2LHD A;  2DBY A;  1F77 A;  4IDI A;  1FNW A;  1JWA D;  3IXS A;  2E6X A;  2JX5 A;  5BYS A;  1R7S A;  2PLP A;  2I38 A;  4C7Y A;  4JE3 B;  4A6Q A;  1WSP A;  1K51 A;  2LMC A;  1IBX B;  1CK1 A;  3KWV A;  1XLO A;  3RPF C;  3W5V B;  4HRS A;  1FM0 D;  3ZJT A;  2WXP A;  1E0Z A;  1C79 A;  1MPE A;  3AE9 B;  3NVW A;  1SE4 A;  2WLB A;  3AMZ A;  4A90 A;  1L4D B;  2SEB D;  2XN9 C;  3P42 A;  1I4Q A;  2LUM A;  3ETR A;  4RGO S;  1T3Q A;  2BS2 B;  4NJC A;  2PVO D;  1D4B A;  3BVZ A;  1N63 A;  4ZYS A;  1QIL A;  1ZXH A;  1YJI A;  1ZUD 2;  4LK0 M;  5EE0 A;  2WQY B;  1UGJ A;  4RH6 A;  3AEF B;  2WXM A;  5D7G A;  1C76 A;  1NEK B;  4US8 A;  1SEB D;  3PO0 A;  2WXK A;  3AH7 A;  3BVG A;  2W3R A;  2M19 A;  3U7Z A;  4EE2 A;  1RM6 C;  1E7P B;  1SXT A;  3B2G A;  1CJE A;  2YEP F;  4HJG E;  4L23 A;  3AEG B;  5H8Y E;  2Y5C A;  2DYM A;  4H2A A;  1K53 A;  2YEP B;  1E10 A;  2WXL A;  2LHE A;  3BK1 A;  4M0W A;  2KMM A;  3AE5 B;  3KLS X;  4XWT A;  1QT9 A;  1V97 A;  3BII D;  2SAK A;  2ACZ B;  3URY A;  1QOG A;  2INP E;  3AED B;  3CWI A;  1AYF A;  3AEC B;  4DQO C;  1AN8 A;  1DOY A;  4ITK A;  1Q10 A;  1D5X C;  1I7H A;  2CJO A;  2EEL A;  4O1N A;  1JW9 D;  1YJJ A;  1WRI A;  4A8X C;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...