2LKNA

Solution structure of the ppiase domain of human aryl-hydrocarbon receptor-interacting protein (aip)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AH receptor-interacting protein
publication title The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lknA00
1F8AB 1QPLA 3UQBA 4DRIA 1PINA 3CGNA 2KE0A 1EYMA 2XP4A 2M2AA 2MF9A 4JFKA 3KAGA 4ODOA 4TW7A 2XP6A 1FD9A 1PBKA 2RUCA 3LUOA 4DRJA 5HW7A 4C02B 2FAPA 1J6YA 4QT3A 1FKSA 3KABA 2PV1A 1Q1CA 3IK8A 3WH0A 3ODKA 4JFJA 4LAVA 1NMWA 1R9HA 2KI3A 2PV2A 4DIPA 2AWGA 2Y78A 4GGQA 4DROA 3IKDA 4QT2A 1FKGA 2OFNA 5D75A 3O5LA 4MGVA 4J4NA 3O5PA 4JFLA 5HKGA 5HTGA 2PPOA 4IPXA 2XPAA 1YATA 2LPVA 5HWBA 1Q6UA 3KAFA 1C9HA 2DG3A 2RSEA 3VAWA 1ROTA 1FKKA 3TCZA 2Q5AA 1YW5A 5DIVA 4ODPA 1A7XA 3JYJA 4G2PA 4W9OA 4DZ2A 3UQIA 1EQ3A 3UI5A 1ROUA 2ZQVA 1J4IA 1FKBA 4ODKA 1JNSA 1ZCNA 4TNSA 3O5IA 3EY6A 3PRBA 2M08A 2MLYA 4ODNA 1Y0OA 4GIVA 3TC5A 3UF8A 1D7JA 1P5QA 2XPBA 4DRPA 3O5MA 3OOBA 2F2DA 4TYOA 2ITKA 5GPGA 1L1PA 3MDYB 1B6CA 3O5EA 1FKRA 2ZR4A 2ZR6A 1KT0A 4QIBA 3PA7A 4ODMA 4MSPA 3TDBA 3GPKA 4ODQA 2MPHA 2LJ4A 2N87A 3KAIA 2PPPA 4DT4A 3O5RA 4LAYA 1NSGA 2MLZA 1FKTA 2K8IA 1T11A 4DH0A 2VCDA 4FAPA 1U79A 1D6OA 1ZK6A 2PBCA 2XP3A 1FJDA 5B8IC 4ODLA 4JYSA 3O5KA 3O5QA 3NTPA 4U84A 1Q6HA 1JVWA 2DG9A 2KFWA 3O5GA 2MNTA 1D7IA 1KT1A 3KCEA 3KZ7A 1N1AA 4TW8A 1J4HA 3IKGA 5I98A 1QZ2A 3I6CA 3KAHA 1JNTA 2VN1A 2RUDA 2XP7A 3IHZA 4R0XA 4LAWA 2ZQTA 4TX0A 3NRKA 4JFIA 3NI6A 3PRDA 4FN2A 1FKFA 5DITA 3O5JA 1HXVA 5HW8A 2UZ5A 1F40A 1FAPA 4DRQA 2ZQUA 5HW6A 2KO7A 2F21A 4G50A 4W9QA 4J4OA 4TW6A 1FKLA 2LGOA 3H9RB 3RFWA 2MLXA 4ODRA 5HWCA 1BKFA 4IQCA 3B7XA 2KGJA 2PV3A 3KADA 3O5DA 2ZR5A 2D9FA 2XP5A 4DRNA 1Q6IA 2PPNA 2LKNA 4ITZA 4U85A 4W9PA 1BL4A 1J4RA 1W26A 3RGCA 1D7HA 1FKHA 1TCOC 2FKEA 2JZVA 4DRHA 5DIUA 4DRKA 4IQ2A 4DZ3A 3O5FA 3UI4A 2XP9A 2RQSA 1NMVA 3JXVA 4NNRA 4DRMA 5BXJA 2IF4A 4U86A 3UI6A 2F4EA 1M5YA 4JFMA 4N19A 2M1IA 5HT1A 5J6EA 2RUQA 5HUAA 1FKJA 2DG4A 3JYMA 4LAXA 3KACA 3UQAA 2ZQSA 1FKDA 2RURA 4BF8A 3O5OA 2KR7A 3FAPA 1QPFA 2L2SA 1FKIA 4O2TA 2XP8A 3CGMA
chains in the Genus database with same CATH superfamily
1K9TA 2DSZA 4JFKA 2MF9A 4ODOA 4TW7A 1PBKA 3GTYX 3PR9A 5HW7A 2DPEA 4C02B 4QT3A 3KABA 4IT6A 3ODKA 4LAVA 1RD6A 2PV2A 3AROA 3RM8A 4DROA 3O5LA 4MGVA 2YBTA 2PPOA 1ZU8A 4IPXA 1Q6UA 1LG2A 3ARVA 4ZPTR 2DG3A 3VAWA 3ARSA 3TCZA 4MNLA 3UI5A 1JNSA 3B9DA 4LGXA 4TNSA 2M08A 4GIVA 2XPBA 3O5MA 4TYOA 2F2DA 3MDYB 4ODMA 3AS3A 1ZBVA 3CH9A 4LAYA 2MLZA 2DT3A 1T11A 2VCDA 1U79A 3ARXA 1D6OA 3GU0A 1FJDA 4JYSA 3O5KA 3O5QA 2DG9A 3O5GA 3AS0A 1N1AA 5I98A 1E6PA 4Z2KA 1OGBA 2B31A 3IHZA 4LAWA 4TX0A 3NRKA 1FKFA 1ITXA 3O5JA 2PI6A 4DWSA 2UZ5A 5HW8A 1FAPA 4DRQA 1NWUA 4G50A 4ZS6A 2G41A 4J4OA 1FKLA 2F23A 1W1TA 4IQCA 2D9FA 2PPNA 4ITZA 4HBOA 1BL4A 4WKAA 1EHNA 1E15A 2WM0A 3RM9A 3CHEA 1XHGA 3UI6A 2DT2A 2F4EA 5J6EA 2DT0A 1OWQA 5HUAA 2DG4A 3JYMA 3G6LA 1QPFA 3G6MA 4NZCA 1QPLA 3CGNA 3KAGA 2XP6A 2RUCA 3LUOA 2FAPA 1E6NA 1FKSA 3WD2A 4P8VA 1Q1CA 3WL1A 4JFJA 2Y78A 3ARWA 5D75A 3O5PA 4JFLA 3WD3A 1YATA 1O6IA 5HWBA 1WAWA 4MNKA 1IX5A 1C9HA 1GRJA 1ROTA 4ODPA 1EIBA 2A3AA 4G2PA 4W9OA 4DZ2A 2B5UB 2A3EA 4ODKA 3CZ8A 2ETNA 3BMBA 4WKFA 3O5IA 1GPFA 2MLYA 3UF8A 4MNMA 1Y0OA 3TC5A 1P5QA 3B9EA 3O5EA 1FKRA 2ZR6A 3AS1A 1KT0A 4IT4A 3PA7A 4QIBA 3GPKA 1NWRA 2N87A 1LL7A 4DT4A 1ZBWA 1ZL1A 1ZB5A 1GOIA 5GPRA 5DO2A 1X6LA 4FAPA 2PBCA 1HJXA 5B8IC 4P8UA 1Q6HA 1CTNA 1KT1A 1LL4A 3WIJA 3KAHA 3WD4A 2XP7A 4R0XA 2ZQTA 3NI6A 4MNJA 2F21A 1OGGA 3H9RB 2ESCA 2ZR5A 3WD1A 4U85A 4W9PA 1W26A 3WL0A 4DRHA 5DIUA 4DRKA 1HKJA 3UI4A 2RQSA 1FFQA 1UR8A 4N19A 1M5YA 4Q7NA 4XAKA 3CHDA 4Z2HA 4NSBA 1LJYA 1FKDA 4BF8A 3O5OA 4HBEA 1HKKA 1FKIA 4MAVA 1W1PA 3CGMA 1F8AB 4ZPVR 3UQBA 4MPKA 2XP4A 4S3KA 1NWSA 1NWTA 3WQWA 4DRJA 4KQZA 1W9VA 2AOSA 4KR0B 1NMWA 1R9HA 2DT1A 1VF8A 4GGQA 1UR9A 4QT2A 1FKGA 3RMEA 1E6ZA 5HTGA 3WQVA 2Q5AA 1JCHB 2G8ZA 5GQBA 3UQIA 1EQ3A 3AQUA 1ROUA 2ZQVA 3RM4A 1FKBA 4P8WA 1ZCNA 3EY6A 4ODNA 2QF8A 1D7JA 3OOBA 4ML4A 1L1PA 2ITKA 3ARTA 3TDBA 1ZBKA 1W1VA 4ODQA 3KAIA 3WD0A 2PPPA 5DF0A 3O5RA 2IUZA 1NSGA 4ZPWR 4DWSC 2P4VA 1KFWA 3FXYA 1ZK6A 1HJWA 1WNOA 2XP3A 4P8XA 4ODLA 4AY1A 1JNEA 2KFWA 4L3NA 1SYTA 1LL6A 3KCEA 3KZ7A 4TW8A 3W4RA 3IKGA 2O92A 3B9AA 4L72B 1HKIA 1JNTA 1GUVA 4JFIA 4DWSD 4HARA 3ALFA 1D2KA 4FN2A 2A3CA 3PRAA 1F40A 1NH6A 3QOKA 2ZQUA 1LG1A 1LQ0A 4TW6A 4Q22A 2LGOA 2MLXA 4ODRA 2OLHA 3OA5A 5HWCA 3B7XA 2KGJA 2PV3A 1WB0A 3KADA 3O5DA 4DRNA 2XP5A 1H0GA 3ARUA 3RGCA 1J4RA 1TFVA 1W9PA 1D7HA 2FKEA 4IQ2A 4Z2IA 4DZ3A 4PTMA 4DRMA 5HT1A 2RUQA 1FKJA 4LAXA 3UQAA 1EDQA 2RURA 3FAPA 2L2SA 2DSWA 4O2TA 3AS2A 2WLZA 1ZBCA 4DRIA 1W1YA 1PINA 1JNDA 2KE0A 1EYMA 2M2AA 1FD9A 3FY1A 1J6YA 2PV1A 3IK8A 4MTVA 3WH0A 2PN0A 2KI3A 1XRVA 4DIPA 2AWGA 3IKDA 2OFNA 2A3BA 4J4NA 5HKGA 1E9LA 2XPAA 2LPVA 3KAFA 4UDMA 1HJVA 2RSEA 4R5EA 1FKKA 1YW5A 5DIVA 1A7XA 3ARRA 3JYJA 3BXWA 4DWSB 2FDMA 1J4IA 1SR0A 3PRBA 4W5UA 4S3JA 1HXVA 4DRPA 5GPGA 1B6CA 2ZR4A 3WKZA 4MSPA 2MPHA 2LJ4A 2O9OA 3ARPA 1FKTA 2K8IA 4DH0A 3ARZA 5DEZA 2EULA 3NTPA 4U84A 1JVWA 2MNTA 1D7IA 1E44A 4Z2GA 5JH8A 1J4HA 3ARYA 1QZ2A 3I6CA 2VN1A 5HBFA 2RUDA 3PRDA 5DITA 4WK9A 1H0IA 4URIA 4Z2LA 5HW6A 3B8SA 2KO7A 4QZVB 4W9QA 4Z2JA 1W9UA 3RFWA 1BKFA 3CHCA 2YBUA 1Q6IA 2LKNA 2WLYA 1TCOC 1FKHA 4WJXA 2JZVA 1E6RA 3EIPA 3CHFA 4WKHA 1FFRA 3O5FA 2XP9A 3JXVA 1NMVA 5BXJA 4NNRA 2IF4A 4U86A 1X6NA 3ARQA 4JFMA 2M1IA 3ALGA 3KACA 2ZQSA 4WIWA 2DSVA 2KR7A 2WK2A 2DSUA 1HKMA 2XP8A
chains in the Genus database with same CATH topology
1K9TA 2DSZA 4JFKA 2MF9A 4ODOA 4TW7A 1PBKA 3PR9A 5HW7A 2DPEA 4C02B 4QT3A 3KABA 4IT6A 3ODKA 4LAVA 1RD6A 2PV2A 3AROA 3RM8A 4DROA 3O5LA 4MGVA 2YBTA 2PPOA 1ZU8A 4IPXA 1Q6UA 1LG2A 3ARVA 4ZPTR 2DG3A 3VAWA 3ARSA 3TCZA 4MNLA 3UI5A 1JNSA 3B9DA 4LGXA 4TNSA 2M08A 4GIVA 2XPBA 3O5MA 4TYOA 2F2DA 3MDYB 4ODMA 3AS3A 1ZBVA 3CH9A 4LAYA 2MLZA 2DT3A 1T11A 2VCDA 1U79A 3ARXA 1D6OA 1FJDA 4JYSA 3O5KA 3O5QA 2DG9A 3O5GA 3AS0A 1N1AA 5I98A 1E6PA 4Z2KA 1OGBA 2B31A 3IHZA 4LAWA 4TX0A 3NRKA 1FKFA 1ITXA 3O5JA 2PI6A 4DWSA 2UZ5A 5HW8A 1FAPA 4DRQA 1NWUA 4G50A 4ZS6A 2G41A 4J4OA 1FKLA 1W1TA 4IQCA 2D9FA 2PPNA 4ITZA 4HBOA 1BL4A 4WKAA 1EHNA 1E15A 2WM0A 3RM9A 3CHEA 1XHGA 3UI6A 2DT2A 2F4EA 5J6EA 2DT0A 1OWQA 5HUAA 2DG4A 3JYMA 3G6LA 1QPFA 3G6MA 4NZCA 1QPLA 3CGNA 3KAGA 2XP6A 2RUCA 3LUOA 2FAPA 1E6NA 1FKSA 3WD2A 4P8VA 1Q1CA 3WL1A 4JFJA 2Y78A 3ARWA 5D75A 3O5PA 4JFLA 3WD3A 1YATA 1O6IA 5HWBA 1WAWA 4MNKA 1IX5A 1C9HA 1ROTA 4ODPA 1EIBA 2A3AA 4G2PA 4W9OA 4DZ2A 2A3EA 4ODKA 3CZ8A 4WKFA 3O5IA 1GPFA 2MLYA 3UF8A 4MNMA 1Y0OA 3TC5A 1P5QA 3B9EA 3O5EA 1FKRA 2ZR6A 3AS1A 1KT0A 4IT4A 3PA7A 4QIBA 3GPKA 1NWRA 2N87A 1LL7A 4DT4A 1ZBWA 1ZL1A 1ZB5A 1GOIA 5GPRA 5DO2A 1X6LA 4FAPA 2PBCA 1HJXA 5B8IC 4P8UA 1Q6HA 1CTNA 1KT1A 1LL4A 3WIJA 3KAHA 3WD4A 2XP7A 4R0XA 2ZQTA 3NI6A 4MNJA 2F21A 1OGGA 3H9RB 2ESCA 2ZR5A 3WD1A 4U85A 4W9PA 1W26A 3WL0A 4DRHA 5DIUA 4DRKA 1HKJA 3UI4A 2RQSA 1FFQA 1UR8A 4N19A 1M5YA 4Q7NA 4XAKA 3CHDA 4Z2HA 4NSBA 1LJYA 1FKDA 4BF8A 3O5OA 4HBEA 1HKKA 1FKIA 4MAVA 1W1PA 3CGMA 1F8AB 4ZPVR 3UQBA 4MPKA 2XP4A 4S3KA 1NWSA 1NWTA 3WQWA 4DRJA 4KQZA 1W9VA 2AOSA 4KR0B 1NMWA 1R9HA 2DT1A 1VF8A 4GGQA 1UR9A 4QT2A 1FKGA 3RMEA 1E6ZA 5HTGA 3WQVA 2Q5AA 2G8ZA 5GQBA 3UQIA 1EQ3A 3AQUA 1ROUA 2ZQVA 3RM4A 1FKBA 4P8WA 1ZCNA 3EY6A 4ODNA 2QF8A 1D7JA 3OOBA 4ML4A 1L1PA 2ITKA 3ARTA 3TDBA 1ZBKA 1W1VA 4ODQA 3KAIA 3WD0A 2PPPA 5DF0A 3O5RA 2IUZA 1NSGA 4ZPWR 4DWSC 1KFWA 3FXYA 1ZK6A 1HJWA 1WNOA 2XP3A 4P8XA 4ODLA 4AY1A 1JNEA 2KFWA 4L3NA 1SYTA 1LL6A 3KCEA 3KZ7A 4TW8A 3W4RA 3IKGA 2O92A 3B9AA 4L72B 1HKIA 1JNTA 1GUVA 4JFIA 4DWSD 4HARA 3ALFA 1D2KA 4FN2A 2A3CA 3PRAA 1F40A 1NH6A 3QOKA 2ZQUA 1LG1A 1LQ0A 4TW6A 4Q22A 2LGOA 2MLXA 4ODRA 2OLHA 3OA5A 5HWCA 3B7XA 2KGJA 2PV3A 1WB0A 3KADA 3O5DA 4DRNA 2XP5A 1H0GA 3ARUA 3RGCA 1J4RA 1TFVA 1W9PA 1D7HA 2FKEA 4IQ2A 4Z2IA 4DZ3A 4PTMA 4DRMA 5HT1A 2RUQA 1FKJA 4LAXA 3UQAA 1EDQA 2RURA 3FAPA 2L2SA 2DSWA 4O2TA 3AS2A 2WLZA 1ZBCA 4DRIA 1W1YA 1PINA 1JNDA 2KE0A 1EYMA 2M2AA 1FD9A 3FY1A 1J6YA 2PV1A 3IK8A 4MTVA 3WH0A 2KI3A 1XRVA 4DIPA 2AWGA 3IKDA 2OFNA 2A3BA 4J4NA 5HKGA 1E9LA 2XPAA 2LPVA 3KAFA 1HJVA 2RSEA 4R5EA 1FKKA 1YW5A 5DIVA 1A7XA 3ARRA 3JYJA 3BXWA 4DWSB 2FDMA 1J4IA 1SR0A 3PRBA 4W5UA 4S3JA 1HXVA 4DRPA 5GPGA 1B6CA 2ZR4A 3WKZA 4MSPA 2MPHA 2LJ4A 2O9OA 3ARPA 1FKTA 2K8IA 4DH0A 3ARZA 5DEZA 3NTPA 4U84A 1JVWA 2MNTA 1D7IA 4Z2GA 5JH8A 1J4HA 3ARYA 1QZ2A 3I6CA 2VN1A 5HBFA 2RUDA 3PRDA 5DITA 4WK9A 1H0IA 4URIA 4Z2LA 5HW6A 3B8SA 2KO7A 4QZVB 4W9QA 4Z2JA 1W9UA 3RFWA 1BKFA 3CHCA 2YBUA 1Q6IA 2LKNA 2WLYA 1TCOC 1FKHA 4WJXA 2JZVA 1E6RA 3CHFA 4WKHA 1FFRA 3O5FA 2XP9A 3JXVA 1NMVA 5BXJA 4NNRA 2IF4A 4U86A 1X6NA 3ARQA 4JFMA 2M1IA 3ALGA 3KACA 2ZQSA 4WIWA 2DSVA 2KR7A 2WK2A 2DSUA 1HKMA 2XP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  1QPL A;  3UQB A;  4DRI A;  1PIN A;  3CGN A;  2KE0 A;  1EYM A;  2XP4 A;  2M2A A;  2MF9 A;  4JFK A;  3KAG A;  4ODO A;  4TW7 A;  2XP6 A;  1FD9 A;  1PBK A;  2RUC A;  3LUO A;  4DRJ A;  5HW7 A;  4C02 B;  2FAP A;  1J6Y A;  4QT3 A;  1FKS A;  3KAB A;  2PV1 A;  1Q1C A;  3IK8 A;  3WH0 A;  3ODK A;  4JFJ A;  4LAV A;  1NMW A;  1R9H A;  2KI3 A;  2PV2 A;  4DIP A;  2AWG A;  2Y78 A;  4GGQ A;  4DRO A;  3IKD A;  4QT2 A;  1FKG A;  2OFN A;  5D75 A;  3O5L A;  4MGV A;  4J4N A;  3O5P A;  4JFL A;  5HKG A;  5HTG A;  2PPO A;  4IPX A;  2XPA A;  1YAT A;  2LPV A;  5HWB A;  1Q6U A;  3KAF A;  1C9H A;  2DG3 A;  2RSE A;  3VAW A;  1ROT A;  1FKK A;  3TCZ A;  2Q5A A;  1YW5 A;  5DIV A;  4ODP A;  1A7X A;  3JYJ A;  4G2P A;  4W9O A;  4DZ2 A;  3UQI A;  1EQ3 A;  3UI5 A;  1ROU A;  2ZQV A;  1J4I A;  1FKB A;  4ODK A;  1JNS A;  1ZCN A;  4TNS A;  3O5I A;  3EY6 A;  3PRB A;  2M08 A;  2MLY A;  4ODN A;  1Y0O A;  4GIV A;  3TC5 A;  3UF8 A;  1D7J A;  1P5Q A;  2XPB A;  4DRP A;  3O5M A;  3OOB A;  2F2D A;  4TYO A;  2ITK A;  5GPG A;  1L1P A;  3MDY B;  1B6C A;  3O5E A;  1FKR A;  2ZR4 A;  2ZR6 A;  1KT0 A;  4QIB A;  3PA7 A;  4ODM A;  4MSP A;  3TDB A;  3GPK A;  4ODQ A;  2MPH A;  2LJ4 A;  2N87 A;  3KAI A;  2PPP A;  4DT4 A;  3O5R A;  4LAY A;  1NSG A;  2MLZ A;  1FKT A;  2K8I A;  1T11 A;  4DH0 A;  2VCD A;  4FAP A;  1U79 A;  1D6O A;  1ZK6 A;  2PBC A;  2XP3 A;  1FJD A;  5B8I C;  4ODL A;  4JYS A;  3O5K A;  3O5Q A;  3NTP A;  4U84 A;  1Q6H A;  1JVW A;  2DG9 A;  2KFW A;  3O5G A;  2MNT A;  1D7I A;  1KT1 A;  3KCE A;  3KZ7 A;  1N1A A;  4TW8 A;  1J4H A;  3IKG A;  5I98 A;  1QZ2 A;  3I6C A;  3KAH A;  1JNT A;  2VN1 A;  2RUD A;  2XP7 A;  3IHZ A;  4R0X A;  4LAW A;  2ZQT A;  4TX0 A;  3NRK A;  4JFI A;  3NI6 A;  3PRD A;  4FN2 A;  1FKF A;  5DIT A;  3O5J A;  1HXV A;  5HW8 A;  2UZ5 A;  1F40 A;  1FAP A;  4DRQ A;  2ZQU A;  5HW6 A;  2KO7 A;  2F21 A;  4G50 A;  4W9Q A;  4J4O A;  4TW6 A;  1FKL A;  2LGO A;  3H9R B;  3RFW A;  2MLX A;  4ODR A;  5HWC A;  1BKF A;  4IQC A;  3B7X A;  2KGJ A;  2PV3 A;  3KAD A;  3O5D A;  2ZR5 A;  2D9F A;  2XP5 A;  4DRN A;  1Q6I A;  2PPN A;  2LKN A;  4ITZ A;  4U85 A;  4W9P A;  1BL4 A;  1J4R A;  1W26 A;  3RGC A;  1D7H A;  1FKH A;  1TCO C;  2FKE A;  2JZV A;  4DRH A;  5DIU A;  4DRK A;  4IQ2 A;  4DZ3 A;  3O5F A;  3UI4 A;  2XP9 A;  2RQS A;  1NMV A;  3JXV A;  4NNR A;  4DRM A;  5BXJ A;  2IF4 A;  4U86 A;  3UI6 A;  2F4E A;  1M5Y A;  4JFM A;  4N19 A;  2M1I A;  5HT1 A;  5J6E A;  2RUQ A;  5HUA A;  1FKJ A;  2DG4 A;  3JYM A;  4LAX A;  3KAC A;  3UQA A;  2ZQS A;  1FKD A;  2RUR A;  4BF8 A;  3O5O A;  2KR7 A;  3FAP A;  1QPF A;  2L2S A;  1FKI A;  4O2T A;  2XP8 A;  3CGM A; 
#chains in the Genus database with same CATH topology
 1K9T A;  2DSZ A;  4JFK A;  2MF9 A;  4ODO A;  4TW7 A;  1PBK A;  3GTY X;  3PR9 A;  5HW7 A;  2DPE A;  4C02 B;  4QT3 A;  3KAB A;  4IT6 A;  3ODK A;  4LAV A;  1RD6 A;  2PV2 A;  3ARO A;  3RM8 A;  4DRO A;  3O5L A;  4MGV A;  2YBT A;  2PPO A;  1ZU8 A;  4IPX A;  1Q6U A;  1LG2 A;  3ARV A;  4ZPT R;  2DG3 A;  3VAW A;  3ARS A;  3TCZ A;  4MNL A;  3UI5 A;  1JNS A;  3B9D A;  4LGX A;  4TNS A;  2M08 A;  4GIV A;  2XPB A;  3O5M A;  4TYO A;  2F2D A;  3MDY B;  4ODM A;  3AS3 A;  1ZBV A;  3CH9 A;  4LAY A;  2MLZ A;  2DT3 A;  1T11 A;  2VCD A;  1U79 A;  3ARX A;  1D6O A;  3GU0 A;  1FJD A;  4JYS A;  3O5K A;  3O5Q A;  2DG9 A;  3O5G A;  3AS0 A;  1N1A A;  5I98 A;  1E6P A;  4Z2K A;  1OGB A;  2B31 A;  3IHZ A;  4LAW A;  4TX0 A;  3NRK A;  1FKF A;  1ITX A;  3O5J A;  2PI6 A;  4DWS A;  2UZ5 A;  5HW8 A;  1FAP A;  4DRQ A;  1NWU A;  4G50 A;  4ZS6 A;  2G41 A;  4J4O A;  1FKL A;  2F23 A;  1W1T A;  4IQC A;  2D9F A;  2PPN A;  4ITZ A;  4HBO A;  1BL4 A;  4WKA A;  1EHN A;  1E15 A;  2WM0 A;  3RM9 A;  3CHE A;  1XHG A;  3UI6 A;  2DT2 A;  2F4E A;  5J6E A;  2DT0 A;  1OWQ A;  5HUA A;  2DG4 A;  3JYM A;  3G6L A;  1QPF A;  3G6M A;  4NZC A;  1QPL A;  3CGN A;  3KAG A;  2XP6 A;  2RUC A;  3LUO A;  2FAP A;  1E6N A;  1FKS A;  3WD2 A;  4P8V A;  1Q1C A;  3WL1 A;  4JFJ A;  2Y78 A;  3ARW A;  5D75 A;  3O5P A;  4JFL A;  3WD3 A;  1YAT A;  1O6I A;  5HWB A;  1WAW A;  4MNK A;  1IX5 A;  1C9H A;  1GRJ A;  1ROT A;  4ODP A;  1EIB A;  2A3A A;  4G2P A;  4W9O A;  4DZ2 A;  2B5U B;  2A3E A;  4ODK A;  3CZ8 A;  2ETN A;  3BMB A;  4WKF A;  3O5I A;  1GPF A;  2MLY A;  3UF8 A;  4MNM A;  1Y0O A;  3TC5 A;  1P5Q A;  3B9E A;  3O5E A;  1FKR A;  2ZR6 A;  3AS1 A;  1KT0 A;  4IT4 A;  3PA7 A;  4QIB A;  3GPK A;  1NWR A;  2N87 A;  1LL7 A;  4DT4 A;  1ZBW A;  1ZL1 A;  1ZB5 A;  1GOI A;  5GPR A;  5DO2 A;  1X6L A;  4FAP A;  2PBC A;  1HJX A;  5B8I C;  4P8U A;  1Q6H A;  1CTN A;  1KT1 A;  1LL4 A;  3WIJ A;  3KAH A;  3WD4 A;  2XP7 A;  4R0X A;  2ZQT A;  3NI6 A;  4MNJ A;  2F21 A;  1OGG A;  3H9R B;  2ESC A;  2ZR5 A;  3WD1 A;  4U85 A;  4W9P A;  1W26 A;  3WL0 A;  4DRH A;  5DIU A;  4DRK A;  1HKJ A;  3UI4 A;  2RQS A;  1FFQ A;  1UR8 A;  4N19 A;  1M5Y A;  4Q7N A;  4XAK A;  3CHD A;  4Z2H A;  4NSB A;  1LJY A;  1FKD A;  4BF8 A;  3O5O A;  4HBE A;  1HKK A;  1FKI A;  4MAV A;  1W1P A;  3CGM A;  1F8A B;  4ZPV R;  3UQB A;  4MPK A;  2XP4 A;  4S3K A;  1NWS A;  1NWT A;  3WQW A;  4DRJ A;  4KQZ A;  1W9V A;  2AOS A;  4KR0 B;  1NMW A;  1R9H A;  2DT1 A;  1VF8 A;  4GGQ A;  1UR9 A;  4QT2 A;  1FKG A;  3RME A;  1E6Z A;  5HTG A;  3WQV A;  2Q5A A;  1JCH B;  2G8Z A;  5GQB A;  3UQI A;  1EQ3 A;  3AQU A;  1ROU A;  2ZQV A;  3RM4 A;  1FKB A;  4P8W A;  1ZCN A;  3EY6 A;  4ODN A;  2QF8 A;  1D7J A;  3OOB A;  4ML4 A;  1L1P A;  2ITK A;  3ART A;  3TDB A;  1ZBK A;  1W1V A;  4ODQ A;  3KAI A;  3WD0 A;  2PPP A;  5DF0 A;  3O5R A;  2IUZ A;  1NSG A;  4ZPW R;  4DWS C;  2P4V A;  1KFW A;  3FXY A;  1ZK6 A;  1HJW A;  1WNO A;  2XP3 A;  4P8X A;  4ODL A;  4AY1 A;  1JNE A;  2KFW A;  4L3N A;  1SYT A;  1LL6 A;  3KCE A;  3KZ7 A;  4TW8 A;  3W4R A;  3IKG A;  2O92 A;  3B9A A;  4L72 B;  1HKI A;  1JNT A;  1GUV A;  4JFI A;  4DWS D;  4HAR A;  3ALF A;  1D2K A;  4FN2 A;  2A3C A;  3PRA A;  1F40 A;  1NH6 A;  3QOK A;  2ZQU A;  1LG1 A;  1LQ0 A;  4TW6 A;  4Q22 A;  2LGO A;  2MLX A;  4ODR A;  2OLH A;  3OA5 A;  5HWC A;  3B7X A;  2KGJ A;  2PV3 A;  1WB0 A;  3KAD A;  3O5D A;  4DRN A;  2XP5 A;  1H0G A;  3ARU A;  3RGC A;  1J4R A;  1TFV A;  1W9P A;  1D7H A;  2FKE A;  4IQ2 A;  4Z2I A;  4DZ3 A;  4PTM A;  4DRM A;  5HT1 A;  2RUQ A;  1FKJ A;  4LAX A;  3UQA A;  1EDQ A;  2RUR A;  3FAP A;  2L2S A;  2DSW A;  4O2T A;  3AS2 A;  2WLZ A;  1ZBC A;  4DRI A;  1W1Y A;  1PIN A;  1JND A;  2KE0 A;  1EYM A;  2M2A A;  1FD9 A;  3FY1 A;  1J6Y A;  2PV1 A;  3IK8 A;  4MTV A;  3WH0 A;  2PN0 A;  2KI3 A;  1XRV A;  4DIP A;  2AWG A;  3IKD A;  2OFN A;  2A3B A;  4J4N A;  5HKG A;  1E9L A;  2XPA A;  2LPV A;  3KAF A;  4UDM A;  1HJV A;  2RSE A;  4R5E A;  1FKK A;  1YW5 A;  5DIV A;  1A7X A;  3ARR A;  3JYJ A;  3BXW A;  4DWS B;  2FDM A;  1J4I A;  1SR0 A;  3PRB A;  4W5U A;  4S3J A;  1HXV A;  4DRP A;  5GPG A;  1B6C A;  2ZR4 A;  3WKZ A;  4MSP A;  2MPH A;  2LJ4 A;  2O9O A;  3ARP A;  1FKT A;  2K8I A;  4DH0 A;  3ARZ A;  5DEZ A;  2EUL A;  3NTP A;  4U84 A;  1JVW A;  2MNT A;  1D7I A;  1E44 A;  4Z2G A;  5JH8 A;  1J4H A;  3ARY A;  1QZ2 A;  3I6C A;  2VN1 A;  5HBF A;  2RUD A;  3PRD A;  5DIT A;  4WK9 A;  1H0I A;  4URI A;  4Z2L A;  5HW6 A;  3B8S A;  2KO7 A;  4QZV B;  4W9Q A;  4Z2J A;  1W9U A;  3RFW A;  1BKF A;  3CHC A;  2YBU A;  1Q6I A;  2LKN A;  2WLY A;  1TCO C;  1FKH A;  4WJX A;  2JZV A;  1E6R A;  3EIP A;  3CHF A;  4WKH A;  1FFR A;  3O5F A;  2XP9 A;  3JXV A;  1NMV A;  5BXJ A;  4NNR A;  2IF4 A;  4U86 A;  1X6N A;  3ARQ A;  4JFM A;  2M1I A;  3ALG A;  3KAC A;  2ZQS A;  4WIW A;  2DSV A;  2KR7 A;  2WK2 A;  2DSU A;  1HKM A;  2XP8 A; 
#chains in the Genus database with same CATH homology
 1K9T A;  2DSZ A;  4JFK A;  2MF9 A;  4ODO A;  4TW7 A;  1PBK A;  3PR9 A;  5HW7 A;  2DPE A;  4C02 B;  4QT3 A;  3KAB A;  4IT6 A;  3ODK A;  4LAV A;  1RD6 A;  2PV2 A;  3ARO A;  3RM8 A;  4DRO A;  3O5L A;  4MGV A;  2YBT A;  2PPO A;  1ZU8 A;  4IPX A;  1Q6U A;  1LG2 A;  3ARV A;  4ZPT R;  2DG3 A;  3VAW A;  3ARS A;  3TCZ A;  4MNL A;  3UI5 A;  1JNS A;  3B9D A;  4LGX A;  4TNS A;  2M08 A;  4GIV A;  2XPB A;  3O5M A;  4TYO A;  2F2D A;  3MDY B;  4ODM A;  3AS3 A;  1ZBV A;  3CH9 A;  4LAY A;  2MLZ A;  2DT3 A;  1T11 A;  2VCD A;  1U79 A;  3ARX A;  1D6O A;  1FJD A;  4JYS A;  3O5K A;  3O5Q A;  2DG9 A;  3O5G A;  3AS0 A;  1N1A A;  5I98 A;  1E6P A;  4Z2K A;  1OGB A;  2B31 A;  3IHZ A;  4LAW A;  4TX0 A;  3NRK A;  1FKF A;  1ITX A;  3O5J A;  2PI6 A;  4DWS A;  2UZ5 A;  5HW8 A;  1FAP A;  4DRQ A;  1NWU A;  4G50 A;  4ZS6 A;  2G41 A;  4J4O A;  1FKL A;  1W1T A;  4IQC A;  2D9F A;  2PPN A;  4ITZ A;  4HBO A;  1BL4 A;  4WKA A;  1EHN A;  1E15 A;  2WM0 A;  3RM9 A;  3CHE A;  1XHG A;  3UI6 A;  2DT2 A;  2F4E A;  5J6E A;  2DT0 A;  1OWQ A;  5HUA A;  2DG4 A;  3JYM A;  3G6L A;  1QPF A;  3G6M A;  4NZC A;  1QPL A;  3CGN A;  3KAG A;  2XP6 A;  2RUC A;  3LUO A;  2FAP A;  1E6N A;  1FKS A;  3WD2 A;  4P8V A;  1Q1C A;  3WL1 A;  4JFJ A;  2Y78 A;  3ARW A;  5D75 A;  3O5P A;  4JFL A;  3WD3 A;  1YAT A;  1O6I A;  5HWB A;  1WAW A;  4MNK A;  1IX5 A;  1C9H A;  1ROT A;  4ODP A;  1EIB A;  2A3A A;  4G2P A;  4W9O A;  4DZ2 A;  2A3E A;  4ODK A;  3CZ8 A;  4WKF A;  3O5I A;  1GPF A;  2MLY A;  3UF8 A;  4MNM A;  1Y0O A;  3TC5 A;  1P5Q A;  3B9E A;  3O5E A;  1FKR A;  2ZR6 A;  3AS1 A;  1KT0 A;  4IT4 A;  3PA7 A;  4QIB A;  3GPK A;  1NWR A;  2N87 A;  1LL7 A;  4DT4 A;  1ZBW A;  1ZL1 A;  1ZB5 A;  1GOI A;  5GPR A;  5DO2 A;  1X6L A;  4FAP A;  2PBC A;  1HJX A;  5B8I C;  4P8U A;  1Q6H A;  1CTN A;  1KT1 A;  1LL4 A;  3WIJ A;  3KAH A;  3WD4 A;  2XP7 A;  4R0X A;  2ZQT A;  3NI6 A;  4MNJ A;  2F21 A;  1OGG A;  3H9R B;  2ESC A;  2ZR5 A;  3WD1 A;  4U85 A;  4W9P A;  1W26 A;  3WL0 A;  4DRH A;  5DIU A;  4DRK A;  1HKJ A;  3UI4 A;  2RQS A;  1FFQ A;  1UR8 A;  4N19 A;  1M5Y A;  4Q7N A;  4XAK A;  3CHD A;  4Z2H A;  4NSB A;  1LJY A;  1FKD A;  4BF8 A;  3O5O A;  4HBE A;  1HKK A;  1FKI A;  4MAV A;  1W1P A;  3CGM A;  1F8A B;  4ZPV R;  3UQB A;  4MPK A;  2XP4 A;  4S3K A;  1NWS A;  1NWT A;  3WQW A;  4DRJ A;  4KQZ A;  1W9V A;  2AOS A;  4KR0 B;  1NMW A;  1R9H A;  2DT1 A;  1VF8 A;  4GGQ A;  1UR9 A;  4QT2 A;  1FKG A;  3RME A;  1E6Z A;  5HTG A;  3WQV A;  2Q5A A;  2G8Z A;  5GQB A;  3UQI A;  1EQ3 A;  3AQU A;  1ROU A;  2ZQV A;  3RM4 A;  1FKB A;  4P8W A;  1ZCN A;  3EY6 A;  4ODN A;  2QF8 A;  1D7J A;  3OOB A;  4ML4 A;  1L1P A;  2ITK A;  3ART A;  3TDB A;  1ZBK A;  1W1V A;  4ODQ A;  3KAI A;  3WD0 A;  2PPP A;  5DF0 A;  3O5R A;  2IUZ A;  1NSG A;  4ZPW R;  4DWS C;  1KFW A;  3FXY A;  1ZK6 A;  1HJW A;  1WNO A;  2XP3 A;  4P8X A;  4ODL A;  4AY1 A;  1JNE A;  2KFW A;  4L3N A;  1SYT A;  1LL6 A;  3KCE A;  3KZ7 A;  4TW8 A;  3W4R A;  3IKG A;  2O92 A;  3B9A A;  4L72 B;  1HKI A;  1JNT A;  1GUV A;  4JFI A;  4DWS D;  4HAR A;  3ALF A;  1D2K A;  4FN2 A;  2A3C A;  3PRA A;  1F40 A;  1NH6 A;  3QOK A;  2ZQU A;  1LG1 A;  1LQ0 A;  4TW6 A;  4Q22 A;  2LGO A;  2MLX A;  4ODR A;  2OLH A;  3OA5 A;  5HWC A;  3B7X A;  2KGJ A;  2PV3 A;  1WB0 A;  3KAD A;  3O5D A;  4DRN A;  2XP5 A;  1H0G A;  3ARU A;  3RGC A;  1J4R A;  1TFV A;  1W9P A;  1D7H A;  2FKE A;  4IQ2 A;  4Z2I A;  4DZ3 A;  4PTM A;  4DRM A;  5HT1 A;  2RUQ A;  1FKJ A;  4LAX A;  3UQA A;  1EDQ A;  2RUR A;  3FAP A;  2L2S A;  2DSW A;  4O2T A;  3AS2 A;  2WLZ A;  1ZBC A;  4DRI A;  1W1Y A;  1PIN A;  1JND A;  2KE0 A;  1EYM A;  2M2A A;  1FD9 A;  3FY1 A;  1J6Y A;  2PV1 A;  3IK8 A;  4MTV A;  3WH0 A;  2KI3 A;  1XRV A;  4DIP A;  2AWG A;  3IKD A;  2OFN A;  2A3B A;  4J4N A;  5HKG A;  1E9L A;  2XPA A;  2LPV A;  3KAF A;  1HJV A;  2RSE A;  4R5E A;  1FKK A;  1YW5 A;  5DIV A;  1A7X A;  3ARR A;  3JYJ A;  3BXW A;  4DWS B;  2FDM A;  1J4I A;  1SR0 A;  3PRB A;  4W5U A;  4S3J A;  1HXV A;  4DRP A;  5GPG A;  1B6C A;  2ZR4 A;  3WKZ A;  4MSP A;  2MPH A;  2LJ4 A;  2O9O A;  3ARP A;  1FKT A;  2K8I A;  4DH0 A;  3ARZ A;  5DEZ A;  3NTP A;  4U84 A;  1JVW A;  2MNT A;  1D7I A;  4Z2G A;  5JH8 A;  1J4H A;  3ARY A;  1QZ2 A;  3I6C A;  2VN1 A;  5HBF A;  2RUD A;  3PRD A;  5DIT A;  4WK9 A;  1H0I A;  4URI A;  4Z2L A;  5HW6 A;  3B8S A;  2KO7 A;  4QZV B;  4W9Q A;  4Z2J A;  1W9U A;  3RFW A;  1BKF A;  3CHC A;  2YBU A;  1Q6I A;  2LKN A;  2WLY A;  1TCO C;  1FKH A;  4WJX A;  2JZV A;  1E6R A;  3CHF A;  4WKH A;  1FFR A;  3O5F A;  2XP9 A;  3JXV A;  1NMV A;  5BXJ A;  4NNR A;  2IF4 A;  4U86 A;  1X6N A;  3ARQ A;  4JFM A;  2M1I A;  3ALG A;  3KAC A;  2ZQS A;  4WIW A;  2DSV A;  2KR7 A;  2WK2 A;  2DSU A;  1HKM A;  2XP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...