2LKNA

Solution structure of the ppiase domain of human aryl-hydrocarbon receptor-interacting protein (aip)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
b'ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AH receptor-interacting protein
publication title The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lknA00
1QZ2A 2M08A 4LAYA 2OFNA 1FKTA 2LGOA 3JYJA 3LUOA 3O5MA 2RUDA 1FKSA 3PRBA 4JFJA 2VCDA 1JNSA 3VAWA 4J4NA 4N19A 2LKNA 4DT4A 2XP6A 2PBCA 2D9FA 4ITZA 4JFLA 2VN1A 4TX0A 5DIUA 2XPAA 5HT1A 3TC5A 4DRNA 5HWCA 3UQBA 2RUCA 5HKGA 2M1IA 3CGNA 5HWBA 2XP4A 5HUAA 5J6EA 1D7HA 4TYOA 3KAFA 2DG4A 1PBKA 3KADA 1FD9A 2RQSA 3JYMA 4IPXA 4ODPA 4QT3A 3IKGA 3RGCA 3UF8A 3O5KA 4IQCA 2K8IA 4QT2A 3EY6A 3CGMA 4TW6A 1Q6IA 1Q6HA 3PA7A 4ODQA 2XP7A 5HW6A 2MNTA 4C02B 1BKFA 2KGJA 2F21A 4J4OA 2L2SA 2PV2A 4DRIA 4ODRA 2XP8A 3KACA 3UI6A 3KCEA 3O5OA 3O5DA 1JVWA 1R9HA 4W9PA 4W9OA 3WH0A 5HW7A 2XPBA 2AWGA 2N87A 1QPLA 2KI3A 3O5IA 3O5QA 1D6OA 4GGQA 3O5FA 4DRHA 1J4RA 4ODNA 4DIPA 2JZVA 2ZR6A 1FKKA 4DRMA 2MF9A 2RURA 4JFKA 3JXVA 1QPFA 1ZK6A 4LAVA 3ODKA 2LJ4A 3I6CA 2PPOA 1YATA 4MSPA 5DIVA 2ZQVA 3MDYB 1BL4A 4ODMA 1EQ3A 1M5YA 1J6YA 4DZ2A 1ROTA 1P5QA 3O5LA 5I98A 1FAPA 4LAWA 3B7XA 3KAHA 3O5EA 1FKFA 2ZQUA 4BF8A 5BXJA 1J4IA 1A7XA 4DRPA 2KE0A 5GPGA 2XP9A 1ROUA 4FAPA 2PPNA 1U79A 3UI4A 4TNSA 4W9QA 5D75A 1KT1A 3KZ7A 3FAPA 4NNRA 1C9HA 1NMWA 4R0XA 2KR7A 2RSEA 2ZQTA 3KAGA 4IQ2A 1J4HA 1FKDA 1FKJA 3NRKA 4ODOA 5B8IC 1HXVA 2M2AA 2DG9A 2RUQA 1PINA 3O5PA 4DRKA 2KFWA 2KO7A 1FKRA 3NTPA 1B6CA 3O5JA 1TCOC 1YW5A 2MLXA 3KAIA 2ZR5A 4G50A 1L1PA 4FN2A 1EYMA 1KT0A 3IHZA 1FKIA 1ZCNA 4JFMA 2ITKA 2FAPA 4QIBA 4TW7A 5HW8A 1D7IA 4U84A 2DG3A 4DRJA 4G2PA 1Q1CA 3GPKA 1T11A 2XP5A 3RFWA 5HTGA 1FJDA 2MLYA 1Y0OA 2Y78A 1NMVA 2F4EA 1F8AB 1FKHA 1FKLA 2UZ5A 3PRDA 3UQIA 1Q6UA 3UQAA 4ODLA 2IF4A 5DITA 3UI5A 4GIVA 4DH0A 4MGVA 1FKGA 2FKEA 1N1AA 4O2TA 2ZR4A 2F2DA 4U86A 2LPVA 2ZQSA 3O5RA 4DRQA 2XP3A 1W26A 2Q5AA 3OOBA 4TW8A 2PV3A 3IKDA 3O5GA 3TDBA 4DZ3A 4DROA 2PPPA 1NSGA 3TCZA 4ODKA 2PV1A 3KABA 4JFIA 1F40A 4U85A 4JYSA 3IK8A 1D7JA 3NI6A 2MPHA 3H9RB 1JNTA 4LAXA 2MLZA 1FKBA
chains in the Genus database with same CATH superfamily
2OFNA 2LGOA 3JYJA 3RMEA 1FKSA 4DWSA 2VCDA 1W1PA 4L3NA 4J4NA 3WD1A 2LKNA 4DT4A 4DWSB 1H0IA 2PBCA 4JFLA 3AS1A 4P8VA 5HT1A 4TX0A 3TC5A 3UQBA 1E9LA 4DWSD 1FD9A 3JYMA 4ODPA 4QT3A 3O5KA 4IQCA 3EY6A 3WD0A 1Q6IA 4Z2KA 1XHGA 1BKFA 2A3CA 2F21A 2WLZA 4L72B 2DSVA 3ARZA 2XP8A 2A3BA 3WH0A 1R9HA 4MNLA 5HW7A 2XPBA 2N87A 3BXWA 1QPLA 3O5IA 1LG2A 2DT2A 1LG1A 3WQWA 1J4RA 4DRHA 1X6NA 4ODNA 1FKKA 4DRMA 2MF9A 4ZPTR 1XRVA 2PN0A 3ODKA 4MSPA 1W9VA 4Z2HA 4DWSC 2FDMA 4ODMA 3WQVA 4MNJA 1J6YA 3O5LA 1FAPA 1KFWA 3OA5A 2ZQUA 4R5EA 5BXJA 4DRPA 2KE0A 1ROUA 5JH8A 3KZ7A 1NMWA 3KAGA 2RSEA 4IQ2A 4ODOA 5GQBA 5B8IC 3GU0A 3NRKA 1PINA 1TCOC 3KAIA 1RD6A 2DPEA 1EYMA 5HW8A 4UDMA 4DRJA 4G2PA 1Q1CA 2XP5A 3RFWA 1GOIA 1NMVA 2UZ5A 3PRDA 1Q6UA 1IX5A 5DITA 1HJWA 3ARTA 1HJXA 1FKGA 2FKEA 3AQUA 2ZR4A 2F2DA 3AS3A 1GPFA 4O2TA 4DRQA 4DZ3A 3WD2A 2WK2A 4WKFA 4ODKA 3ARQA 5HBFA 3PRAA 1F40A 2WM0A 4JYSA 3IK8A 1OGGA 3NI6A 3WD3A 1SR0A 2MLZA 2PI6A 4NZCA 4LAYA 3LUOA 1FKTA 1HKKA 3PRBA 3VAWA 4N19A 5HKGA 4ITZA 3ARVA 5DIUA 2XPAA 4DRNA 2M1IA 2XP4A 3KAFA 3CHFA 3KADA 1EIBA 1ZBCA 2A3AA 3RGCA 3UF8A 1LL6A 3CGMA 5HW6A 1E6NA 2KGJA 4KR0B 2PV2A 4DRIA 1K9TA 4W9OA 3WL0A 2YBTA 3O5QA 1D6OA 2G8ZA 3O5FA 4DIPA 3JXVA 3W4RA 2LJ4A 3I6CA 1YATA 4QZVB 4W5UA 1FFQA 4HBEA 2ZQVA 2DT1A 4KQZA 1ROTA 5I98A 4AY1A 1SYTA 3B7XA 1OGBA 4BF8A 4Z2LA 2XP9A 2F23A 1NWUA 1O6IA 3UI4A 1KT1A 4URIA 2DSWA 4MNMA 2DG9A 4MNKA 1FKRA 4Z2JA 1B6CA 4NSBA 1KT0A 3AROA 1ZCNA 4JFMA 3RM8A 2FAPA 1D7IA 3WKZA 1FJDA 1ZL1A 1Y0OA 2F4EA 2G41A 1FKHA 3ARYA 3UQIA 4WIWA 4ODLA 3OOBA 1W26A 2Q5AA 3B9EA 3ARSA 3O5GA 2ESCA 4DROA 1NSGA 4P8XA 2PV1A 3CZ8A 3PA7A 3ARXA 1QZ2A 2YBUA 3O5MA 2RUDA 1JNSA 4MAVA 4HARA 2XP6A 5HWCA 1HJVA 3ARRA 1ZBKA 1VF8A 3CGNA 5HWBA 5HUAA 5DO2A 1EDQA 1JNEA 1HKJA 2DG4A 1PBKA 3ARPA 2A3EA 1ZBWA 2B5UB 1ZU8A 4IPXA 1H0GA 4ZS6A 4WKHA 4QT2A 1GRJA 4S3JA 4ODQA 1NWTA 2XP7A 2O9OA 2B31A 4C02B 5GPRA 4J4OA 1LL4A 3AS2A 4ODRA 3KACA 3UI6A 3O5OA 1JVWA 4W9PA 1UR8A 2DT0A 2JZVA 1E6ZA 1NWRA 3ALFA 1ZK6A 1W1YA 1E44A 4LAVA 5DIVA 1WAWA 4Q22A 1EQ3A 4WKAA 3FY1A 1P5QA 3AS0A 3G6MA 4LAWA 3RM4A 1A7XA 4FAPA 4ZPWR 3B9AA 3QOKA 4P8UA 1U79A 4TNSA 4W9QA 5D75A 1ZB5A 2QF8A 4PTMA 4NNRA 4R0XA 1X6LA 3CHEA 2KR7A 2ZQTA 1J4HA 1FKJA 2DSUA 3O5PA 2KFWA 2KO7A 3O5JA 1YW5A 1LL7A 2ZR5A 1L1PA 4MTVA 1W9UA 4FN2A 4Z2IA 4TW7A 2DSZA 4U84A 3GPKA 2WLYA 2MLYA 2IUZA 1E6RA 2Y78A 1FKLA 3UQAA 1OWQA 2IF4A 4Q7NA 3UI5A 4GIVA 2AOSA 4IT4A 4DH0A 4LGXA 4MGVA 4U86A 2LPVA 3O5RA 1ZBVA 2XP3A 2PV3A 1D2KA 3WL1A 4WJXA 2PPPA 2P4VA 1E6PA 1HKIA 3KABA 3G6LA 3WD4A 1W1TA 4WK9A 4ZPVR 1D7JA 4ML4A 1JNTA 2M08A 4JFJA 3ALGA 1WB0A 1LJYA 2D9FA 2VN1A 4S3KA 2RUCA 3PR9A 1FKBA 5J6EA 2ETNA 3WIJA 1EHNA 1D7HA 4TYOA 2RQSA 2O92A 3IKGA 1JNDA 2K8IA 4TW6A 1FFRA 1Q6HA 1GUVA 2MNTA 3EIPA 3ARWA 4HBOA 2L2SA 1UR9A 3KCEA 1CTNA 4Z2GA 2AWGA 3B8SA 2KI3A 2EULA 4GGQA 2ZR6A 2RURA 4JFKA 3GTYX 1QPFA 4XAKA 2PPOA 5DEZA 1W9PA 3MDYB 1BL4A 1M5YA 1LQ0A 4DZ2A 3KAHA 3BMBA 3O5EA 3CHCA 1FKFA 1J4IA 5GPGA 2PPNA 3RM9A 3FAPA 1C9HA 1FKDA 3CHDA 1HXVA 2M2AA 1ITXA 2RUQA 4DRKA 4IT6A 3NTPA 4MPKA 2MLXA 4G50A 3IHZA 1FKIA 2DT3A 2ITKA 4QIBA 2DG3A 5HTGA 1T11A 1WNOA 1NH6A 3CH9A 3B9DA 1F8AB 3ARUA 1HKMA 1NWSA 1JCHB 1N1AA 1W1VA 1TFVA 2ZQSA 3FXYA 4TW8A 3IKDA 3TDBA 1E15A 3TCZA 4JFIA 4U85A 5DF0A 2MPHA 3H9RB 4P8WA 3O5DA 4LAXA 2OLHA
chains in the Genus database with same CATH topology
2OFNA 2LGOA 3JYJA 3RMEA 1FKSA 4DWSA 2VCDA 1W1PA 4L3NA 4J4NA 3WD1A 2LKNA 4DT4A 4DWSB 1H0IA 2PBCA 4JFLA 3AS1A 4P8VA 5HT1A 4TX0A 3TC5A 3UQBA 1E9LA 4DWSD 1FD9A 3JYMA 4ODPA 4QT3A 3O5KA 4IQCA 3EY6A 3WD0A 1Q6IA 4Z2KA 1XHGA 1BKFA 2A3CA 2F21A 2WLZA 4L72B 2DSVA 3ARZA 2XP8A 2A3BA 3WH0A 1R9HA 4MNLA 5HW7A 2XPBA 2N87A 3BXWA 1QPLA 3O5IA 1LG2A 2DT2A 1LG1A 3WQWA 1J4RA 4DRHA 1X6NA 4ODNA 1FKKA 4DRMA 2MF9A 4ZPTR 1XRVA 3ODKA 4MSPA 1W9VA 4Z2HA 4DWSC 2FDMA 4ODMA 3WQVA 4MNJA 1J6YA 3O5LA 1FAPA 1KFWA 3OA5A 2ZQUA 4R5EA 5BXJA 4DRPA 2KE0A 1ROUA 5JH8A 3KZ7A 1NMWA 3KAGA 2RSEA 4IQ2A 4ODOA 5GQBA 5B8IC 3NRKA 1PINA 1TCOC 3KAIA 1RD6A 2DPEA 1EYMA 5HW8A 4DRJA 4G2PA 1Q1CA 2XP5A 3RFWA 1GOIA 1NMVA 2UZ5A 3PRDA 1Q6UA 1IX5A 5DITA 1HJWA 3ARTA 1HJXA 1FKGA 2FKEA 3AQUA 2ZR4A 2F2DA 3AS3A 1GPFA 4O2TA 4DRQA 4DZ3A 3WD2A 2WK2A 4WKFA 4ODKA 3ARQA 5HBFA 3PRAA 1F40A 2WM0A 4JYSA 3IK8A 1OGGA 3NI6A 3WD3A 1SR0A 2MLZA 2PI6A 4NZCA 4LAYA 3LUOA 1FKTA 1HKKA 3PRBA 3VAWA 4N19A 5HKGA 4ITZA 3ARVA 5DIUA 2XPAA 4DRNA 2M1IA 2XP4A 3KAFA 3CHFA 3KADA 1EIBA 1ZBCA 2A3AA 3RGCA 3UF8A 1LL6A 3CGMA 5HW6A 1E6NA 2KGJA 4KR0B 2PV2A 4DRIA 1K9TA 4W9OA 3WL0A 2YBTA 3O5QA 1D6OA 2G8ZA 3O5FA 4DIPA 3JXVA 3W4RA 2LJ4A 3I6CA 1YATA 4QZVB 4W5UA 1FFQA 4HBEA 2ZQVA 2DT1A 4KQZA 1ROTA 5I98A 4AY1A 1SYTA 3B7XA 1OGBA 4BF8A 4Z2LA 2XP9A 1NWUA 1O6IA 3UI4A 1KT1A 4URIA 2DSWA 4MNMA 2DG9A 4MNKA 1FKRA 4Z2JA 1B6CA 4NSBA 1KT0A 3AROA 1ZCNA 4JFMA 3RM8A 2FAPA 1D7IA 3WKZA 1FJDA 1ZL1A 1Y0OA 2F4EA 2G41A 1FKHA 3ARYA 3UQIA 4WIWA 4ODLA 3OOBA 1W26A 2Q5AA 3B9EA 3ARSA 3O5GA 2ESCA 4DROA 1NSGA 4P8XA 2PV1A 3CZ8A 3PA7A 3ARXA 1QZ2A 2YBUA 3O5MA 2RUDA 1JNSA 4MAVA 4HARA 2XP6A 5HWCA 1HJVA 3ARRA 1ZBKA 1VF8A 3CGNA 5HWBA 5HUAA 5DO2A 1EDQA 1JNEA 1HKJA 2DG4A 1PBKA 3ARPA 2A3EA 1ZBWA 1ZU8A 4IPXA 1H0GA 4ZS6A 4WKHA 4QT2A 4S3JA 4ODQA 1NWTA 2XP7A 2O9OA 2B31A 4C02B 5GPRA 4J4OA 1LL4A 3AS2A 4ODRA 3KACA 3UI6A 3O5OA 1JVWA 4W9PA 1UR8A 2DT0A 2JZVA 1E6ZA 1NWRA 3ALFA 1ZK6A 1W1YA 4LAVA 5DIVA 1WAWA 4Q22A 1EQ3A 4WKAA 3FY1A 1P5QA 3AS0A 3G6MA 4LAWA 3RM4A 1A7XA 4FAPA 4ZPWR 3B9AA 3QOKA 4P8UA 1U79A 4TNSA 4W9QA 5D75A 1ZB5A 2QF8A 4PTMA 4NNRA 4R0XA 1X6LA 3CHEA 2KR7A 2ZQTA 1J4HA 1FKJA 2DSUA 3O5PA 2KFWA 2KO7A 3O5JA 1YW5A 1LL7A 2ZR5A 1L1PA 4MTVA 1W9UA 4FN2A 4Z2IA 4TW7A 2DSZA 4U84A 3GPKA 2WLYA 2MLYA 2IUZA 1E6RA 2Y78A 1FKLA 3UQAA 1OWQA 2IF4A 4Q7NA 3UI5A 4GIVA 2AOSA 4IT4A 4DH0A 4LGXA 4MGVA 4U86A 2LPVA 3O5RA 1ZBVA 2XP3A 2PV3A 1D2KA 3WL1A 4WJXA 2PPPA 1E6PA 1HKIA 3KABA 3G6LA 3WD4A 1W1TA 4WK9A 4ZPVR 1D7JA 4ML4A 1JNTA 2M08A 4JFJA 3ALGA 1WB0A 1LJYA 2D9FA 2VN1A 4S3KA 2RUCA 3PR9A 1FKBA 5J6EA 3WIJA 1EHNA 1D7HA 4TYOA 2RQSA 2O92A 3IKGA 1JNDA 2K8IA 4TW6A 1FFRA 1Q6HA 1GUVA 2MNTA 3ARWA 4HBOA 2L2SA 1UR9A 3KCEA 1CTNA 4Z2GA 2AWGA 3B8SA 2KI3A 4GGQA 2ZR6A 2RURA 4JFKA 1QPFA 4XAKA 2PPOA 5DEZA 1W9PA 3MDYB 1BL4A 1M5YA 1LQ0A 4DZ2A 3KAHA 3O5EA 3CHCA 1FKFA 1J4IA 5GPGA 2PPNA 3RM9A 3FAPA 1C9HA 1FKDA 3CHDA 1HXVA 2M2AA 1ITXA 2RUQA 4DRKA 4IT6A 3NTPA 4MPKA 2MLXA 4G50A 3IHZA 1FKIA 2DT3A 2ITKA 4QIBA 2DG3A 5HTGA 1T11A 1WNOA 1NH6A 3CH9A 3B9DA 1F8AB 3ARUA 1HKMA 1NWSA 1N1AA 1W1VA 1TFVA 2ZQSA 3FXYA 4TW8A 3IKDA 3TDBA 1E15A 3TCZA 4JFIA 4U85A 5DF0A 2MPHA 3H9RB 4P8WA 3O5DA 4LAXA 2OLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  2M08 A;  4LAY A;  2OFN A;  1FKT A;  2LGO A;  3JYJ A;  3LUO A;  3O5M A;  2RUD A;  1FKS A;  3PRB A;  4JFJ A;  2VCD A;  1JNS A;  3VAW A;  4J4N A;  4N19 A;  2LKN A;  4DT4 A;  2XP6 A;  2PBC A;  2D9F A;  4ITZ A;  4JFL A;  2VN1 A;  4TX0 A;  5DIU A;  2XPA A;  5HT1 A;  3TC5 A;  4DRN A;  5HWC A;  3UQB A;  2RUC A;  5HKG A;  2M1I A;  3CGN A;  5HWB A;  2XP4 A;  5HUA A;  5J6E A;  1D7H A;  4TYO A;  3KAF A;  2DG4 A;  1PBK A;  3KAD A;  1FD9 A;  2RQS A;  3JYM A;  4IPX A;  4ODP A;  4QT3 A;  3IKG A;  3RGC A;  3UF8 A;  3O5K A;  4IQC A;  2K8I A;  4QT2 A;  3EY6 A;  3CGM A;  4TW6 A;  1Q6I A;  1Q6H A;  3PA7 A;  4ODQ A;  2XP7 A;  5HW6 A;  2MNT A;  4C02 B;  1BKF A;  2KGJ A;  2F21 A;  4J4O A;  2L2S A;  2PV2 A;  4DRI A;  4ODR A;  2XP8 A;  3KAC A;  3UI6 A;  3KCE A;  3O5O A;  3O5D A;  1JVW A;  1R9H A;  4W9P A;  4W9O A;  3WH0 A;  5HW7 A;  2XPB A;  2AWG A;  2N87 A;  1QPL A;  2KI3 A;  3O5I A;  3O5Q A;  1D6O A;  4GGQ A;  3O5F A;  4DRH A;  1J4R A;  4ODN A;  4DIP A;  2JZV A;  2ZR6 A;  1FKK A;  4DRM A;  2MF9 A;  2RUR A;  4JFK A;  3JXV A;  1QPF A;  1ZK6 A;  4LAV A;  3ODK A;  2LJ4 A;  3I6C A;  2PPO A;  1YAT A;  4MSP A;  5DIV A;  2ZQV A;  3MDY B;  1BL4 A;  4ODM A;  1EQ3 A;  1M5Y A;  1J6Y A;  4DZ2 A;  1ROT A;  1P5Q A;  3O5L A;  5I98 A;  1FAP A;  4LAW A;  3B7X A;  3KAH A;  3O5E A;  1FKF A;  2ZQU A;  4BF8 A;  5BXJ A;  1J4I A;  1A7X A;  4DRP A;  2KE0 A;  5GPG A;  2XP9 A;  1ROU A;  4FAP A;  2PPN A;  1U79 A;  3UI4 A;  4TNS A;  4W9Q A;  5D75 A;  1KT1 A;  3KZ7 A;  3FAP A;  4NNR A;  1C9H A;  1NMW A;  4R0X A;  2KR7 A;  2RSE A;  2ZQT A;  3KAG A;  4IQ2 A;  1J4H A;  1FKD A;  1FKJ A;  3NRK A;  4ODO A;  5B8I C;  1HXV A;  2M2A A;  2DG9 A;  2RUQ A;  1PIN A;  3O5P A;  4DRK A;  2KFW A;  2KO7 A;  1FKR A;  3NTP A;  1B6C A;  3O5J A;  1TCO C;  1YW5 A;  2MLX A;  3KAI A;  2ZR5 A;  4G50 A;  1L1P A;  4FN2 A;  1EYM A;  1KT0 A;  3IHZ A;  1FKI A;  1ZCN A;  4JFM A;  2ITK A;  2FAP A;  4QIB A;  4TW7 A;  5HW8 A;  1D7I A;  4U84 A;  2DG3 A;  4DRJ A;  4G2P A;  1Q1C A;  3GPK A;  1T11 A;  2XP5 A;  3RFW A;  5HTG A;  1FJD A;  2MLY A;  1Y0O A;  2Y78 A;  1NMV A;  2F4E A;  1F8A B;  1FKH A;  1FKL A;  2UZ5 A;  3PRD A;  3UQI A;  1Q6U A;  3UQA A;  4ODL A;  2IF4 A;  5DIT A;  3UI5 A;  4GIV A;  4DH0 A;  4MGV A;  1FKG A;  2FKE A;  1N1A A;  4O2T A;  2ZR4 A;  2F2D A;  4U86 A;  2LPV A;  2ZQS A;  3O5R A;  4DRQ A;  2XP3 A;  1W26 A;  2Q5A A;  3OOB A;  4TW8 A;  2PV3 A;  3IKD A;  3O5G A;  3TDB A;  4DZ3 A;  4DRO A;  2PPP A;  1NSG A;  3TCZ A;  4ODK A;  2PV1 A;  3KAB A;  4JFI A;  1F40 A;  4U85 A;  4JYS A;  3IK8 A;  1D7J A;  3NI6 A;  2MPH A;  3H9R B;  1JNT A;  4LAX A;  2MLZ A;  1FKB A; 
#chains in the Genus database with same CATH topology
 2OFN A;  2LGO A;  3JYJ A;  3RME A;  1FKS A;  4DWS A;  2VCD A;  1W1P A;  4L3N A;  4J4N A;  3WD1 A;  2LKN A;  4DT4 A;  4DWS B;  1H0I A;  2PBC A;  4JFL A;  3AS1 A;  4P8V A;  5HT1 A;  4TX0 A;  3TC5 A;  3UQB A;  1E9L A;  4DWS D;  1FD9 A;  3JYM A;  4ODP A;  4QT3 A;  3O5K A;  4IQC A;  3EY6 A;  3WD0 A;  1Q6I A;  4Z2K A;  1XHG A;  1BKF A;  2A3C A;  2F21 A;  2WLZ A;  4L72 B;  2DSV A;  3ARZ A;  2XP8 A;  2A3B A;  3WH0 A;  1R9H A;  4MNL A;  5HW7 A;  2XPB A;  2N87 A;  3BXW A;  1QPL A;  3O5I A;  1LG2 A;  2DT2 A;  1LG1 A;  3WQW A;  1J4R A;  4DRH A;  1X6N A;  4ODN A;  1FKK A;  4DRM A;  2MF9 A;  4ZPT R;  1XRV A;  2PN0 A;  3ODK A;  4MSP A;  1W9V A;  4Z2H A;  4DWS C;  2FDM A;  4ODM A;  3WQV A;  4MNJ A;  1J6Y A;  3O5L A;  1FAP A;  1KFW A;  3OA5 A;  2ZQU A;  4R5E A;  5BXJ A;  4DRP A;  2KE0 A;  1ROU A;  5JH8 A;  3KZ7 A;  1NMW A;  3KAG A;  2RSE A;  4IQ2 A;  4ODO A;  5GQB A;  5B8I C;  3GU0 A;  3NRK A;  1PIN A;  1TCO C;  3KAI A;  1RD6 A;  2DPE A;  1EYM A;  5HW8 A;  4UDM A;  4DRJ A;  4G2P A;  1Q1C A;  2XP5 A;  3RFW A;  1GOI A;  1NMV A;  2UZ5 A;  3PRD A;  1Q6U A;  1IX5 A;  5DIT A;  1HJW A;  3ART A;  1HJX A;  1FKG A;  2FKE A;  3AQU A;  2ZR4 A;  2F2D A;  3AS3 A;  1GPF A;  4O2T A;  4DRQ A;  4DZ3 A;  3WD2 A;  2WK2 A;  4WKF A;  4ODK A;  3ARQ A;  5HBF A;  3PRA A;  1F40 A;  2WM0 A;  4JYS A;  3IK8 A;  1OGG A;  3NI6 A;  3WD3 A;  1SR0 A;  2MLZ A;  2PI6 A;  4NZC A;  4LAY A;  3LUO A;  1FKT A;  1HKK A;  3PRB A;  3VAW A;  4N19 A;  5HKG A;  4ITZ A;  3ARV A;  5DIU A;  2XPA A;  4DRN A;  2M1I A;  2XP4 A;  3KAF A;  3CHF A;  3KAD A;  1EIB A;  1ZBC A;  2A3A A;  3RGC A;  3UF8 A;  1LL6 A;  3CGM A;  5HW6 A;  1E6N A;  2KGJ A;  4KR0 B;  2PV2 A;  4DRI A;  1K9T A;  4W9O A;  3WL0 A;  2YBT A;  3O5Q A;  1D6O A;  2G8Z A;  3O5F A;  4DIP A;  3JXV A;  3W4R A;  2LJ4 A;  3I6C A;  1YAT A;  4QZV B;  4W5U A;  1FFQ A;  4HBE A;  2ZQV A;  2DT1 A;  4KQZ A;  1ROT A;  5I98 A;  4AY1 A;  1SYT A;  3B7X A;  1OGB A;  4BF8 A;  4Z2L A;  2XP9 A;  2F23 A;  1NWU A;  1O6I A;  3UI4 A;  1KT1 A;  4URI A;  2DSW A;  4MNM A;  2DG9 A;  4MNK A;  1FKR A;  4Z2J A;  1B6C A;  4NSB A;  1KT0 A;  3ARO A;  1ZCN A;  4JFM A;  3RM8 A;  2FAP A;  1D7I A;  3WKZ A;  1FJD A;  1ZL1 A;  1Y0O A;  2F4E A;  2G41 A;  1FKH A;  3ARY A;  3UQI A;  4WIW A;  4ODL A;  3OOB A;  1W26 A;  2Q5A A;  3B9E A;  3ARS A;  3O5G A;  2ESC A;  4DRO A;  1NSG A;  4P8X A;  2PV1 A;  3CZ8 A;  3PA7 A;  3ARX A;  1QZ2 A;  2YBU A;  3O5M A;  2RUD A;  1JNS A;  4MAV A;  4HAR A;  2XP6 A;  5HWC A;  1HJV A;  3ARR A;  1ZBK A;  1VF8 A;  3CGN A;  5HWB A;  5HUA A;  5DO2 A;  1EDQ A;  1JNE A;  1HKJ A;  2DG4 A;  1PBK A;  3ARP A;  2A3E A;  1ZBW A;  2B5U B;  1ZU8 A;  4IPX A;  1H0G A;  4ZS6 A;  4WKH A;  4QT2 A;  1GRJ A;  4S3J A;  4ODQ A;  1NWT A;  2XP7 A;  2O9O A;  2B31 A;  4C02 B;  5GPR A;  4J4O A;  1LL4 A;  3AS2 A;  4ODR A;  3KAC A;  3UI6 A;  3O5O A;  1JVW A;  4W9P A;  1UR8 A;  2DT0 A;  2JZV A;  1E6Z A;  1NWR A;  3ALF A;  1ZK6 A;  1W1Y A;  1E44 A;  4LAV A;  5DIV A;  1WAW A;  4Q22 A;  1EQ3 A;  4WKA A;  3FY1 A;  1P5Q A;  3AS0 A;  3G6M A;  4LAW A;  3RM4 A;  1A7X A;  4FAP A;  4ZPW R;  3B9A A;  3QOK A;  4P8U A;  1U79 A;  4TNS A;  4W9Q A;  5D75 A;  1ZB5 A;  2QF8 A;  4PTM A;  4NNR A;  4R0X A;  1X6L A;  3CHE A;  2KR7 A;  2ZQT A;  1J4H A;  1FKJ A;  2DSU A;  3O5P A;  2KFW A;  2KO7 A;  3O5J A;  1YW5 A;  1LL7 A;  2ZR5 A;  1L1P A;  4MTV A;  1W9U A;  4FN2 A;  4Z2I A;  4TW7 A;  2DSZ A;  4U84 A;  3GPK A;  2WLY A;  2MLY A;  2IUZ A;  1E6R A;  2Y78 A;  1FKL A;  3UQA A;  1OWQ A;  2IF4 A;  4Q7N A;  3UI5 A;  4GIV A;  2AOS A;  4IT4 A;  4DH0 A;  4LGX A;  4MGV A;  4U86 A;  2LPV A;  3O5R A;  1ZBV A;  2XP3 A;  2PV3 A;  1D2K A;  3WL1 A;  4WJX A;  2PPP A;  2P4V A;  1E6P A;  1HKI A;  3KAB A;  3G6L A;  3WD4 A;  1W1T A;  4WK9 A;  4ZPV R;  1D7J A;  4ML4 A;  1JNT A;  2M08 A;  4JFJ A;  3ALG A;  1WB0 A;  1LJY A;  2D9F A;  2VN1 A;  4S3K A;  2RUC A;  3PR9 A;  1FKB A;  5J6E A;  2ETN A;  3WIJ A;  1EHN A;  1D7H A;  4TYO A;  2RQS A;  2O92 A;  3IKG A;  1JND A;  2K8I A;  4TW6 A;  1FFR A;  1Q6H A;  1GUV A;  2MNT A;  3EIP A;  3ARW A;  4HBO A;  2L2S A;  1UR9 A;  3KCE A;  1CTN A;  4Z2G A;  2AWG A;  3B8S A;  2KI3 A;  2EUL A;  4GGQ A;  2ZR6 A;  2RUR A;  4JFK A;  3GTY X;  1QPF A;  4XAK A;  2PPO A;  5DEZ A;  1W9P A;  3MDY B;  1BL4 A;  1M5Y A;  1LQ0 A;  4DZ2 A;  3KAH A;  3BMB A;  3O5E A;  3CHC A;  1FKF A;  1J4I A;  5GPG A;  2PPN A;  3RM9 A;  3FAP A;  1C9H A;  1FKD A;  3CHD A;  1HXV A;  2M2A A;  1ITX A;  2RUQ A;  4DRK A;  4IT6 A;  3NTP A;  4MPK A;  2MLX A;  4G50 A;  3IHZ A;  1FKI A;  2DT3 A;  2ITK A;  4QIB A;  2DG3 A;  5HTG A;  1T11 A;  1WNO A;  1NH6 A;  3CH9 A;  3B9D A;  1F8A B;  3ARU A;  1HKM A;  1NWS A;  1JCH B;  1N1A A;  1W1V A;  1TFV A;  2ZQS A;  3FXY A;  4TW8 A;  3IKD A;  3TDB A;  1E15 A;  3TCZ A;  4JFI A;  4U85 A;  5DF0 A;  2MPH A;  3H9R B;  4P8W A;  3O5D A;  4LAX A;  2OLH A; 
#chains in the Genus database with same CATH homology
 2OFN A;  2LGO A;  3JYJ A;  3RME A;  1FKS A;  4DWS A;  2VCD A;  1W1P A;  4L3N A;  4J4N A;  3WD1 A;  2LKN A;  4DT4 A;  4DWS B;  1H0I A;  2PBC A;  4JFL A;  3AS1 A;  4P8V A;  5HT1 A;  4TX0 A;  3TC5 A;  3UQB A;  1E9L A;  4DWS D;  1FD9 A;  3JYM A;  4ODP A;  4QT3 A;  3O5K A;  4IQC A;  3EY6 A;  3WD0 A;  1Q6I A;  4Z2K A;  1XHG A;  1BKF A;  2A3C A;  2F21 A;  2WLZ A;  4L72 B;  2DSV A;  3ARZ A;  2XP8 A;  2A3B A;  3WH0 A;  1R9H A;  4MNL A;  5HW7 A;  2XPB A;  2N87 A;  3BXW A;  1QPL A;  3O5I A;  1LG2 A;  2DT2 A;  1LG1 A;  3WQW A;  1J4R A;  4DRH A;  1X6N A;  4ODN A;  1FKK A;  4DRM A;  2MF9 A;  4ZPT R;  1XRV A;  3ODK A;  4MSP A;  1W9V A;  4Z2H A;  4DWS C;  2FDM A;  4ODM A;  3WQV A;  4MNJ A;  1J6Y A;  3O5L A;  1FAP A;  1KFW A;  3OA5 A;  2ZQU A;  4R5E A;  5BXJ A;  4DRP A;  2KE0 A;  1ROU A;  5JH8 A;  3KZ7 A;  1NMW A;  3KAG A;  2RSE A;  4IQ2 A;  4ODO A;  5GQB A;  5B8I C;  3NRK A;  1PIN A;  1TCO C;  3KAI A;  1RD6 A;  2DPE A;  1EYM A;  5HW8 A;  4DRJ A;  4G2P A;  1Q1C A;  2XP5 A;  3RFW A;  1GOI A;  1NMV A;  2UZ5 A;  3PRD A;  1Q6U A;  1IX5 A;  5DIT A;  1HJW A;  3ART A;  1HJX A;  1FKG A;  2FKE A;  3AQU A;  2ZR4 A;  2F2D A;  3AS3 A;  1GPF A;  4O2T A;  4DRQ A;  4DZ3 A;  3WD2 A;  2WK2 A;  4WKF A;  4ODK A;  3ARQ A;  5HBF A;  3PRA A;  1F40 A;  2WM0 A;  4JYS A;  3IK8 A;  1OGG A;  3NI6 A;  3WD3 A;  1SR0 A;  2MLZ A;  2PI6 A;  4NZC A;  4LAY A;  3LUO A;  1FKT A;  1HKK A;  3PRB A;  3VAW A;  4N19 A;  5HKG A;  4ITZ A;  3ARV A;  5DIU A;  2XPA A;  4DRN A;  2M1I A;  2XP4 A;  3KAF A;  3CHF A;  3KAD A;  1EIB A;  1ZBC A;  2A3A A;  3RGC A;  3UF8 A;  1LL6 A;  3CGM A;  5HW6 A;  1E6N A;  2KGJ A;  4KR0 B;  2PV2 A;  4DRI A;  1K9T A;  4W9O A;  3WL0 A;  2YBT A;  3O5Q A;  1D6O A;  2G8Z A;  3O5F A;  4DIP A;  3JXV A;  3W4R A;  2LJ4 A;  3I6C A;  1YAT A;  4QZV B;  4W5U A;  1FFQ A;  4HBE A;  2ZQV A;  2DT1 A;  4KQZ A;  1ROT A;  5I98 A;  4AY1 A;  1SYT A;  3B7X A;  1OGB A;  4BF8 A;  4Z2L A;  2XP9 A;  1NWU A;  1O6I A;  3UI4 A;  1KT1 A;  4URI A;  2DSW A;  4MNM A;  2DG9 A;  4MNK A;  1FKR A;  4Z2J A;  1B6C A;  4NSB A;  1KT0 A;  3ARO A;  1ZCN A;  4JFM A;  3RM8 A;  2FAP A;  1D7I A;  3WKZ A;  1FJD A;  1ZL1 A;  1Y0O A;  2F4E A;  2G41 A;  1FKH A;  3ARY A;  3UQI A;  4WIW A;  4ODL A;  3OOB A;  1W26 A;  2Q5A A;  3B9E A;  3ARS A;  3O5G A;  2ESC A;  4DRO A;  1NSG A;  4P8X A;  2PV1 A;  3CZ8 A;  3PA7 A;  3ARX A;  1QZ2 A;  2YBU A;  3O5M A;  2RUD A;  1JNS A;  4MAV A;  4HAR A;  2XP6 A;  5HWC A;  1HJV A;  3ARR A;  1ZBK A;  1VF8 A;  3CGN A;  5HWB A;  5HUA A;  5DO2 A;  1EDQ A;  1JNE A;  1HKJ A;  2DG4 A;  1PBK A;  3ARP A;  2A3E A;  1ZBW A;  1ZU8 A;  4IPX A;  1H0G A;  4ZS6 A;  4WKH A;  4QT2 A;  4S3J A;  4ODQ A;  1NWT A;  2XP7 A;  2O9O A;  2B31 A;  4C02 B;  5GPR A;  4J4O A;  1LL4 A;  3AS2 A;  4ODR A;  3KAC A;  3UI6 A;  3O5O A;  1JVW A;  4W9P A;  1UR8 A;  2DT0 A;  2JZV A;  1E6Z A;  1NWR A;  3ALF A;  1ZK6 A;  1W1Y A;  4LAV A;  5DIV A;  1WAW A;  4Q22 A;  1EQ3 A;  4WKA A;  3FY1 A;  1P5Q A;  3AS0 A;  3G6M A;  4LAW A;  3RM4 A;  1A7X A;  4FAP A;  4ZPW R;  3B9A A;  3QOK A;  4P8U A;  1U79 A;  4TNS A;  4W9Q A;  5D75 A;  1ZB5 A;  2QF8 A;  4PTM A;  4NNR A;  4R0X A;  1X6L A;  3CHE A;  2KR7 A;  2ZQT A;  1J4H A;  1FKJ A;  2DSU A;  3O5P A;  2KFW A;  2KO7 A;  3O5J A;  1YW5 A;  1LL7 A;  2ZR5 A;  1L1P A;  4MTV A;  1W9U A;  4FN2 A;  4Z2I A;  4TW7 A;  2DSZ A;  4U84 A;  3GPK A;  2WLY A;  2MLY A;  2IUZ A;  1E6R A;  2Y78 A;  1FKL A;  3UQA A;  1OWQ A;  2IF4 A;  4Q7N A;  3UI5 A;  4GIV A;  2AOS A;  4IT4 A;  4DH0 A;  4LGX A;  4MGV A;  4U86 A;  2LPV A;  3O5R A;  1ZBV A;  2XP3 A;  2PV3 A;  1D2K A;  3WL1 A;  4WJX A;  2PPP A;  1E6P A;  1HKI A;  3KAB A;  3G6L A;  3WD4 A;  1W1T A;  4WK9 A;  4ZPV R;  1D7J A;  4ML4 A;  1JNT A;  2M08 A;  4JFJ A;  3ALG A;  1WB0 A;  1LJY A;  2D9F A;  2VN1 A;  4S3K A;  2RUC A;  3PR9 A;  1FKB A;  5J6E A;  3WIJ A;  1EHN A;  1D7H A;  4TYO A;  2RQS A;  2O92 A;  3IKG A;  1JND A;  2K8I A;  4TW6 A;  1FFR A;  1Q6H A;  1GUV A;  2MNT A;  3ARW A;  4HBO A;  2L2S A;  1UR9 A;  3KCE A;  1CTN A;  4Z2G A;  2AWG A;  3B8S A;  2KI3 A;  4GGQ A;  2ZR6 A;  2RUR A;  4JFK A;  1QPF A;  4XAK A;  2PPO A;  5DEZ A;  1W9P A;  3MDY B;  1BL4 A;  1M5Y A;  1LQ0 A;  4DZ2 A;  3KAH A;  3O5E A;  3CHC A;  1FKF A;  1J4I A;  5GPG A;  2PPN A;  3RM9 A;  3FAP A;  1C9H A;  1FKD A;  3CHD A;  1HXV A;  2M2A A;  1ITX A;  2RUQ A;  4DRK A;  4IT6 A;  3NTP A;  4MPK A;  2MLX A;  4G50 A;  3IHZ A;  1FKI A;  2DT3 A;  2ITK A;  4QIB A;  2DG3 A;  5HTG A;  1T11 A;  1WNO A;  1NH6 A;  3CH9 A;  3B9D A;  1F8A B;  3ARU A;  1HKM A;  1NWS A;  1N1A A;  1W1V A;  1TFV A;  2ZQS A;  3FXY A;  4TW8 A;  3IKD A;  3TDB A;  1E15 A;  3TCZ A;  4JFI A;  4U85 A;  5DF0 A;  2MPH A;  3H9R B;  4P8W A;  3O5D A;  4LAX A;  2OLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...