2LKNA

Solution structure of the ppiase domain of human aryl-hydrocarbon receptor-interacting protein (aip)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AH receptor-interacting protein
publication title The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lknA00
1J4RA 2IF4A 1Q6HA 1U79A 3O5IA 5D75A 2XP8A 1J4IA 4NNRA 4JYSA 2XP5A 4W9PA 1FKIA 3KCEA 4DRIA 5B8IC 4ODKA 3O5KA 1F40A 2AWGA 2PBCA 4IQ2A 4ITZA 5HW7A 2RUDA 1J6YA 1D7HA 1ROUA 4QT3A 2ZQTA 4R0XA 4TNSA 3TDBA 3UI4A 2F2DA 1JNSA 2F4EA 4DH0A 2Y78A 2KE0A 1JVWA 2ZQSA 4BF8A 5DIVA 1Q6UA 1N1AA 4N19A 5HWCA 5HW8A 5HT1A 1J4HA 4DRHA 1W26A 4G2PA 3FAPA 3UQBA 3NI6A 1HXVA 2MLYA 2KFWA 5HKGA 2Q5AA 3O5EA 4QT2A 1C9HA 1FAPA 4DRMA 1BKFA 3KABA 2MLXA 4GGQA 1FJDA 3KZ7A 2VCDA 4JFJA 4ODQA 4QIBA 5HTGA 2XP3A 2KGJA 4TYOA 1P5QA 1Q6IA 4ODPA 3KADA 3NTPA 4DRNA 4ODMA 2PV1A 2KO7A 2RURA 2LKNA 3B7XA 4DRKA 4DZ3A 2DG3A 1NMWA 2F21A 3O5FA 2LJ4A 3O5RA 4ODRA 2M08A 1R9HA 1Q1CA 2ITKA 2XP4A 2XPBA 3IKDA 3RFWA 2VN1A 1ROTA 3UI5A 5I98A 2K8IA 3WH0A 4IQCA 3KAIA 3CGMA 4ODOA 1EQ3A 1D6OA 1FKBA 3KAGA 2XP7A 2KR7A 3UF8A 2L2SA 4GIVA 4O2TA 2XP6A 2RUCA 1Y0OA 4DIPA 4DRJA 1FKRA 1KT1A 2MPHA 2PPNA 1D7JA 2XP9A 4LAWA 4G50A 4JFKA 3KACA 2PPOA 1PINA 5GPGA 3IHZA 1FKDA 2MF9A 3UI6A 1B6CA 1ZCNA 2XPAA 3CGNA 3IKGA 4DROA 1T11A 4JFMA 1FKLA 4IPXA 4DRPA 3PRDA 3ODKA 4TW8A 4J4NA 4LAYA 3O5OA 4ODNA 2M2AA 4TX0A 3MDYB 2PV3A 1D7IA 2ZR4A 4MGVA 4TW7A 4DRQA 3OOBA 2ZR5A 2N87A 3JXVA 4TW6A 3O5QA 5DITA 1YW5A 3NRKA 4FAPA 4U86A 3H9RB 1A7XA 4DT4A 1QZ2A 3O5LA 1YATA 2RUQA 3JYJA 1FKGA 3I6CA 3O5JA 4JFIA 4LAXA 1QPLA 2ZQUA 2D9FA 1KT0A 1FKJA 2UZ5A 3VAWA 4FN2A 1ZK6A 2M1IA 2ZR6A 3KAHA 1FD9A 1FKSA 2DG4A 2JZVA 1F8AB 3O5DA 1FKHA 1BL4A 1FKFA 3TC5A 5HUAA 4J4OA 2LGOA 2MLZA 1FKTA 3EY6A 4MSPA 2PPPA 3GPKA 3O5GA 3PA7A 5DIUA 1TCOC 3O5PA 5HWBA 2FAPA 4W9QA 1QPFA 3JYMA 5BXJA 1FKKA 3UQAA 4LAVA 2FKEA 5J6EA 1PBKA 3PRBA 2RSEA 4JFLA 3LUOA 1JNTA 2PV2A 3O5MA 2OFNA 2MNTA 2RQSA 1EYMA 4W9OA 3UQIA 1NSGA 2KI3A 2LPVA 1L1PA 4U84A 4U85A 4DZ2A 1M5YA 2ZQVA 3IK8A 5HW6A 2DG9A 3RGCA 3TCZA 4C02B 1NMVA 3KAFA 4ODLA
chains in the Genus database with same CATH superfamily
3CHEA 1Q6HA 1UR8A 1J4IA 4NNRA 4JYSA 1HKMA 2XP5A 4ODKA 3O5KA 2AWGA 4ITZA 1ROUA 4QT3A 4R0XA 3UI4A 5DF0A 4MNMA 4DH0A 3AQUA 4BF8A 1OWQA 5HWCA 5HW8A 4MNJA 1J4HA 5DO2A 5HT1A 1JNEA 3AROA 4UDMA 3UQBA 3NI6A 2MLYA 3ARQA 4GGQA 1ZB5A 3CHDA 4JFJA 1X6LA 1P5QA 3KADA 4ODMA 2DG3A 2DT3A 2F21A 4KQZA 2LJ4A 4ODRA 1R9HA 2XPBA 3UI5A 3IKDA 3RFWA 2K8IA 2PN0A 3CGMA 4ODOA 2F23A 2XP7A 4XAKA 4GIVA 5JH8A 1Y0OA 4DRJA 2WK2A 2MPHA 3W4RA 2XP9A 4G50A 1SYTA 1LL6A 1KFWA 1FFQA 2OLHA 3AS3A 1FKLA 3WL0A 4DWSD 3O5OA 3QOKA 1D7IA 1HJXA 2ZR4A 3ARSA 3ARYA 3FXYA 3ARWA 3JXVA 3CH9A 4TW6A 1NWRA 3O5QA 1LG2A 5GPRA 4DT4A 4HARA 1NWTA 1YATA 2RUQA 3JYJA 1QPLA 1KT0A 2UZ5A 3VAWA 2M1IA 3ARUA 1TFVA 4ZPVR 4MAVA 5HUAA 3WL1A 3WD3A 1X6NA 3EY6A 4P8VA 2QF8A 2YBUA 3O5PA 2O92A 3B9AA 3JYMA 1FKKA 3UQAA 3BMBA 1JNTA 4IT4A 3FY1A 4W9OA 2DT2A 2KI3A 1W1PA 4U84A 1LL4A 2DPEA 4WJXA 5HW6A 2WLYA 3TCZA 2WM0A 1J6YA 1NMVA 1LG1A 1J4RA 2A3AA 2IF4A 3ARVA 2XP8A 2A3EA 3AS0A 1FKIA 5B8IC 3WD4A 4IQ2A 2ZQTA 3TDBA 1OGBA 1E6ZA 2IUZA 2F4EA 1D2KA 1JVWA 1ZBWA 1HKJA 1N1AA 4N19A 2AOSA 2FDMA 4G2PA 3RM8A 1GRJA 4PTMA 2KFWA 5HKGA 1ITXA 2Q5AA 4LGXA 1WB0A 3KABA 1FJDA 2B5UB 2VCDA 1JNDA 4NSBA 4QIBA 5HTGA 2KGJA 4ODPA 3NTPA 4DRNA 2RURA 2LKNA 3B7XA 4DRKA 4P8UA 1W1TA 3O5FA 1LL7A 3WQWA 4ML4A 1Q1CA 5I98A 2VN1A 3KAIA 2DT0A 1EQ3A 2A3CA 1FKBA 2A3BA 2L2SA 4W5UA 1W9VA 4IT6A 4DIPA 1KT1A 1PINA 3IHZA 1FKDA 3CGNA 3IKGA 1T11A 4JFMA 4IPXA 4DRPA 1UR9A 3PRDA 1ZU8A 2M2AA 3MDYB 2PV3A 1E6RA 4Z2IA 3ARPA 1GOIA 4U86A 1QZ2A 3O5LA 1HJVA 4JFIA 4LAXA 2ZQUA 1FKJA 2ZR6A 3KAHA 2DG4A 1FKFA 3TC5A 1LQ0A 4MSPA 5HWBA 2FAPA 5HBFA 1QPFA 5BXJA 5DEZA 2FKEA 1PBKA 2DSZA 3PRBA 4S3KA 2RQSA 2MNTA 1L1PA 4MPKA 3UQIA 1NSGA 4U85A 4DZ2A 1E9LA 2DG9A 3RGCA 1FAPA 3KAFA 4ZS6A 4Z2GA 2O9OA 1U79A 3O5IA 1HKIA 5D75A 3B8SA 5HW7A 1ZBCA 1D7HA 3ARTA 1JNSA 2ETNA 2ZQSA 5DIVA 4DRHA 1W26A 3FAPA 3B9DA 1CTNA 4DRMA 2DSVA 1BKFA 4S3JA 4WKHA 3GU0A 4HBOA 2DSWA 1NMWA 2DT1A 1XHGA 2ITKA 1ROTA 4DWSC 3WH0A 4IQCA 1FFRA 1D6OA 2B31A 3KAGA 3UF8A 4NZCA 3PR9A 1ZBVA 2XP6A 1FKRA 4KR0B 1D7JA 4LAWA 4DWSA 4JFKA 4AY1A 4MNLA 2PI6A 2XPAA 1GPFA 3CZ8A 3ODKA 4TW8A 4J4NA 4LAYA 4ODNA 1E6NA 4TW7A 4DRQA 3OOBA 4Q22A 5DITA 1YW5A 4MTVA 1A7XA 4Q7NA 3I6CA 4Z2KA 2D9FA 3B9EA 4R5EA 2P4VA 1FKSA 1FKHA 1GUVA 1BL4A 3EIPA 2LGOA 3OA5A 4ZPTR 1FKTA 2ESCA 4URIA 1W9PA 3PA7A 4W9QA 3ALGA 3G6MA 4WK9A 2RSEA 3LUOA 3O5MA 3ALFA 3AS2A 1E15A 3WQVA 2ZQVA 4C02B 3ARZA 1HJWA 4Z2HA 4W9PA 3KCEA 4DRIA 1F40A 1ZBKA 2PBCA 2RUDA 4HBEA 4TNSA 2F2DA 3ARXA 3CHFA 2Y78A 2KE0A 1O6IA 3AS1A 4MNKA 3GTYX 1Q6UA 1W9UA 2YBTA 1EIBA 3RM4A 1W1VA 1OGGA 4ZPWR 3RMEA 3WKZA 4P8XA 1HXVA 1XRVA 4WIWA 1NH6A 3O5EA 4QT2A 1C9HA 2MLXA 1E44A 3KZ7A 4ODQA 1ZL1A 2XP3A 1JCHB 4TYOA 1Q6IA 3WIJA 2PV1A 2KO7A 3WD0A 4DZ3A 1HKKA 1WAWA 3O5RA 2M08A 2XP4A 3ARRA 3CHCA 3WD2A 4P8WA 3BXWA 1IX5A 2KR7A 4Z2JA 1SR0A 4O2TA 2RUCA 1NWUA 3G6LA 2PPNA 4WKFA 3KACA 2PPOA 1EHNA 5GPGA 2MF9A 3UI6A 1B6CA 1ZCNA 1H0GA 4DROA 2G8ZA 4DWSB 3RM9A 1H0IA 4TX0A 4MGVA 2G41A 2ZR5A 4L3NA 2N87A 4L72B 1E6PA 4Z2LA 1VF8A 5GQBA 4FAPA 3NRKA 3H9RB 1EDQA 1W1YA 1FKGA 3O5JA 2WLZA 4FN2A 1ZK6A 1FD9A 3O5DA 2JZVA 1F8AB 1NWSA 4J4OA 2MLZA 1WNOA 2PPPA 3GPKA 3O5GA 5DIUA 1TCOC 4QZVB 1K9TA 4LAVA 5J6EA 3WD1A 4JFLA 1RD6A 2PV2A 2OFNA 3PRAA 1EYMA 2LPVA 4WKAA 1M5YA 3IK8A 2DSUA 1LJYA 4ODLA 2EULA
chains in the Genus database with same CATH topology
3CHEA 1Q6HA 1UR8A 1J4IA 4NNRA 4JYSA 1HKMA 2XP5A 4ODKA 3O5KA 2AWGA 4ITZA 1ROUA 4QT3A 4R0XA 3UI4A 5DF0A 4MNMA 4DH0A 3AQUA 4BF8A 1OWQA 5HWCA 5HW8A 4MNJA 1J4HA 5DO2A 5HT1A 1JNEA 3AROA 3UQBA 3NI6A 2MLYA 3ARQA 4GGQA 1ZB5A 3CHDA 4JFJA 1X6LA 1P5QA 3KADA 4ODMA 2DG3A 2DT3A 2F21A 4KQZA 2LJ4A 4ODRA 1R9HA 2XPBA 3UI5A 3IKDA 3RFWA 2K8IA 3CGMA 4ODOA 2XP7A 4XAKA 4GIVA 5JH8A 1Y0OA 4DRJA 2WK2A 2MPHA 3W4RA 2XP9A 4G50A 1SYTA 1LL6A 1KFWA 1FFQA 2OLHA 3AS3A 1FKLA 3WL0A 4DWSD 3O5OA 3QOKA 1D7IA 1HJXA 2ZR4A 3ARSA 3ARYA 3FXYA 3ARWA 3JXVA 3CH9A 4TW6A 1NWRA 3O5QA 1LG2A 5GPRA 4DT4A 4HARA 1NWTA 1YATA 2RUQA 3JYJA 1QPLA 1KT0A 2UZ5A 3VAWA 2M1IA 3ARUA 1TFVA 4ZPVR 4MAVA 5HUAA 3WL1A 3WD3A 1X6NA 3EY6A 4P8VA 2QF8A 2YBUA 3O5PA 2O92A 3B9AA 3JYMA 1FKKA 3UQAA 1JNTA 4IT4A 3FY1A 4W9OA 2DT2A 2KI3A 1W1PA 4U84A 1LL4A 2DPEA 4WJXA 5HW6A 2WLYA 3TCZA 2WM0A 1J6YA 1NMVA 1LG1A 1J4RA 2A3AA 2IF4A 3ARVA 2XP8A 2A3EA 3AS0A 1FKIA 5B8IC 3WD4A 4IQ2A 2ZQTA 3TDBA 1OGBA 1E6ZA 2IUZA 2F4EA 1D2KA 1JVWA 1ZBWA 1HKJA 1N1AA 4N19A 2AOSA 2FDMA 4G2PA 3RM8A 4PTMA 2KFWA 5HKGA 1ITXA 2Q5AA 4LGXA 1WB0A 3KABA 1FJDA 2VCDA 1JNDA 4NSBA 4QIBA 5HTGA 2KGJA 4ODPA 3NTPA 4DRNA 2RURA 2LKNA 3B7XA 4DRKA 4P8UA 1W1TA 3O5FA 1LL7A 3WQWA 4ML4A 1Q1CA 5I98A 2VN1A 3KAIA 2DT0A 1EQ3A 2A3CA 1FKBA 2A3BA 2L2SA 4W5UA 1W9VA 4IT6A 4DIPA 1KT1A 1PINA 3IHZA 1FKDA 3CGNA 3IKGA 1T11A 4JFMA 4IPXA 4DRPA 1UR9A 3PRDA 1ZU8A 2M2AA 3MDYB 2PV3A 1E6RA 4Z2IA 3ARPA 1GOIA 4U86A 1QZ2A 3O5LA 1HJVA 4JFIA 4LAXA 2ZQUA 1FKJA 2ZR6A 3KAHA 2DG4A 1FKFA 3TC5A 1LQ0A 4MSPA 5HWBA 2FAPA 5HBFA 1QPFA 5BXJA 5DEZA 2FKEA 1PBKA 2DSZA 3PRBA 4S3KA 2RQSA 2MNTA 1L1PA 4MPKA 3UQIA 1NSGA 4U85A 4DZ2A 1E9LA 2DG9A 3RGCA 1FAPA 3KAFA 4ZS6A 4Z2GA 2O9OA 1U79A 3O5IA 1HKIA 5D75A 3B8SA 5HW7A 1ZBCA 1D7HA 3ARTA 1JNSA 2ZQSA 5DIVA 4DRHA 1W26A 3FAPA 3B9DA 1CTNA 4DRMA 2DSVA 1BKFA 4S3JA 4WKHA 4HBOA 2DSWA 1NMWA 2DT1A 1XHGA 2ITKA 1ROTA 4DWSC 3WH0A 4IQCA 1FFRA 1D6OA 2B31A 3KAGA 3UF8A 4NZCA 3PR9A 1ZBVA 2XP6A 1FKRA 4KR0B 1D7JA 4LAWA 4DWSA 4JFKA 4AY1A 4MNLA 2PI6A 2XPAA 1GPFA 3CZ8A 3ODKA 4TW8A 4J4NA 4LAYA 4ODNA 1E6NA 4TW7A 4DRQA 3OOBA 4Q22A 5DITA 1YW5A 4MTVA 1A7XA 4Q7NA 3I6CA 4Z2KA 2D9FA 3B9EA 4R5EA 1FKSA 1FKHA 1GUVA 1BL4A 2LGOA 3OA5A 4ZPTR 1FKTA 2ESCA 4URIA 1W9PA 3PA7A 4W9QA 3ALGA 3G6MA 4WK9A 2RSEA 3LUOA 3O5MA 3ALFA 3AS2A 1E15A 3WQVA 2ZQVA 4C02B 3ARZA 1HJWA 4Z2HA 4W9PA 3KCEA 4DRIA 1F40A 1ZBKA 2PBCA 2RUDA 4HBEA 4TNSA 2F2DA 3ARXA 3CHFA 2Y78A 2KE0A 1O6IA 3AS1A 4MNKA 1Q6UA 1W9UA 2YBTA 1EIBA 3RM4A 1W1VA 1OGGA 4ZPWR 3RMEA 3WKZA 4P8XA 1HXVA 1XRVA 4WIWA 1NH6A 3O5EA 4QT2A 1C9HA 2MLXA 3KZ7A 4ODQA 1ZL1A 2XP3A 4TYOA 1Q6IA 3WIJA 2PV1A 2KO7A 3WD0A 4DZ3A 1HKKA 1WAWA 3O5RA 2M08A 2XP4A 3ARRA 3CHCA 3WD2A 4P8WA 3BXWA 1IX5A 2KR7A 4Z2JA 1SR0A 4O2TA 2RUCA 1NWUA 3G6LA 2PPNA 4WKFA 3KACA 2PPOA 1EHNA 5GPGA 2MF9A 3UI6A 1B6CA 1ZCNA 1H0GA 4DROA 2G8ZA 4DWSB 3RM9A 1H0IA 4TX0A 4MGVA 2G41A 2ZR5A 4L3NA 2N87A 4L72B 1E6PA 4Z2LA 1VF8A 5GQBA 4FAPA 3NRKA 3H9RB 1EDQA 1W1YA 1FKGA 3O5JA 2WLZA 4FN2A 1ZK6A 1FD9A 3O5DA 2JZVA 1F8AB 1NWSA 4J4OA 2MLZA 1WNOA 2PPPA 3GPKA 3O5GA 5DIUA 1TCOC 4QZVB 1K9TA 4LAVA 5J6EA 3WD1A 4JFLA 1RD6A 2PV2A 2OFNA 3PRAA 1EYMA 2LPVA 4WKAA 1M5YA 3IK8A 2DSUA 1LJYA 4ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4R A;  2IF4 A;  1Q6H A;  1U79 A;  3O5I A;  5D75 A;  2XP8 A;  1J4I A;  4NNR A;  4JYS A;  2XP5 A;  4W9P A;  1FKI A;  3KCE A;  4DRI A;  5B8I C;  4ODK A;  3O5K A;  1F40 A;  2AWG A;  2PBC A;  4IQ2 A;  4ITZ A;  5HW7 A;  2RUD A;  1J6Y A;  1D7H A;  1ROU A;  4QT3 A;  2ZQT A;  4R0X A;  4TNS A;  3TDB A;  3UI4 A;  2F2D A;  1JNS A;  2F4E A;  4DH0 A;  2Y78 A;  2KE0 A;  1JVW A;  2ZQS A;  4BF8 A;  5DIV A;  1Q6U A;  1N1A A;  4N19 A;  5HWC A;  5HW8 A;  5HT1 A;  1J4H A;  4DRH A;  1W26 A;  4G2P A;  3FAP A;  3UQB A;  3NI6 A;  1HXV A;  2MLY A;  2KFW A;  5HKG A;  2Q5A A;  3O5E A;  4QT2 A;  1C9H A;  1FAP A;  4DRM A;  1BKF A;  3KAB A;  2MLX A;  4GGQ A;  1FJD A;  3KZ7 A;  2VCD A;  4JFJ A;  4ODQ A;  4QIB A;  5HTG A;  2XP3 A;  2KGJ A;  4TYO A;  1P5Q A;  1Q6I A;  4ODP A;  3KAD A;  3NTP A;  4DRN A;  4ODM A;  2PV1 A;  2KO7 A;  2RUR A;  2LKN A;  3B7X A;  4DRK A;  4DZ3 A;  2DG3 A;  1NMW A;  2F21 A;  3O5F A;  2LJ4 A;  3O5R A;  4ODR A;  2M08 A;  1R9H A;  1Q1C A;  2ITK A;  2XP4 A;  2XPB A;  3IKD A;  3RFW A;  2VN1 A;  1ROT A;  3UI5 A;  5I98 A;  2K8I A;  3WH0 A;  4IQC A;  3KAI A;  3CGM A;  4ODO A;  1EQ3 A;  1D6O A;  1FKB A;  3KAG A;  2XP7 A;  2KR7 A;  3UF8 A;  2L2S A;  4GIV A;  4O2T A;  2XP6 A;  2RUC A;  1Y0O A;  4DIP A;  4DRJ A;  1FKR A;  1KT1 A;  2MPH A;  2PPN A;  1D7J A;  2XP9 A;  4LAW A;  4G50 A;  4JFK A;  3KAC A;  2PPO A;  1PIN A;  5GPG A;  3IHZ A;  1FKD A;  2MF9 A;  3UI6 A;  1B6C A;  1ZCN A;  2XPA A;  3CGN A;  3IKG A;  4DRO A;  1T11 A;  4JFM A;  1FKL A;  4IPX A;  4DRP A;  3PRD A;  3ODK A;  4TW8 A;  4J4N A;  4LAY A;  3O5O A;  4ODN A;  2M2A A;  4TX0 A;  3MDY B;  2PV3 A;  1D7I A;  2ZR4 A;  4MGV A;  4TW7 A;  4DRQ A;  3OOB A;  2ZR5 A;  2N87 A;  3JXV A;  4TW6 A;  3O5Q A;  5DIT A;  1YW5 A;  3NRK A;  4FAP A;  4U86 A;  3H9R B;  1A7X A;  4DT4 A;  1QZ2 A;  3O5L A;  1YAT A;  2RUQ A;  3JYJ A;  1FKG A;  3I6C A;  3O5J A;  4JFI A;  4LAX A;  1QPL A;  2ZQU A;  2D9F A;  1KT0 A;  1FKJ A;  2UZ5 A;  3VAW A;  4FN2 A;  1ZK6 A;  2M1I A;  2ZR6 A;  3KAH A;  1FD9 A;  1FKS A;  2DG4 A;  2JZV A;  1F8A B;  3O5D A;  1FKH A;  1BL4 A;  1FKF A;  3TC5 A;  5HUA A;  4J4O A;  2LGO A;  2MLZ A;  1FKT A;  3EY6 A;  4MSP A;  2PPP A;  3GPK A;  3O5G A;  3PA7 A;  5DIU A;  1TCO C;  3O5P A;  5HWB A;  2FAP A;  4W9Q A;  1QPF A;  3JYM A;  5BXJ A;  1FKK A;  3UQA A;  4LAV A;  2FKE A;  5J6E A;  1PBK A;  3PRB A;  2RSE A;  4JFL A;  3LUO A;  1JNT A;  2PV2 A;  3O5M A;  2OFN A;  2MNT A;  2RQS A;  1EYM A;  4W9O A;  3UQI A;  1NSG A;  2KI3 A;  2LPV A;  1L1P A;  4U84 A;  4U85 A;  4DZ2 A;  1M5Y A;  2ZQV A;  3IK8 A;  5HW6 A;  2DG9 A;  3RGC A;  3TCZ A;  4C02 B;  1NMV A;  3KAF A;  4ODL A; 
#chains in the Genus database with same CATH topology
 3CHE A;  1Q6H A;  1UR8 A;  1J4I A;  4NNR A;  4JYS A;  1HKM A;  2XP5 A;  4ODK A;  3O5K A;  2AWG A;  4ITZ A;  1ROU A;  4QT3 A;  4R0X A;  3UI4 A;  5DF0 A;  4MNM A;  4DH0 A;  3AQU A;  4BF8 A;  1OWQ A;  5HWC A;  5HW8 A;  4MNJ A;  1J4H A;  5DO2 A;  5HT1 A;  1JNE A;  3ARO A;  4UDM A;  3UQB A;  3NI6 A;  2MLY A;  3ARQ A;  4GGQ A;  1ZB5 A;  3CHD A;  4JFJ A;  1X6L A;  1P5Q A;  3KAD A;  4ODM A;  2DG3 A;  2DT3 A;  2F21 A;  4KQZ A;  2LJ4 A;  4ODR A;  1R9H A;  2XPB A;  3UI5 A;  3IKD A;  3RFW A;  2K8I A;  2PN0 A;  3CGM A;  4ODO A;  2F23 A;  2XP7 A;  4XAK A;  4GIV A;  5JH8 A;  1Y0O A;  4DRJ A;  2WK2 A;  2MPH A;  3W4R A;  2XP9 A;  4G50 A;  1SYT A;  1LL6 A;  1KFW A;  1FFQ A;  2OLH A;  3AS3 A;  1FKL A;  3WL0 A;  4DWS D;  3O5O A;  3QOK A;  1D7I A;  1HJX A;  2ZR4 A;  3ARS A;  3ARY A;  3FXY A;  3ARW A;  3JXV A;  3CH9 A;  4TW6 A;  1NWR A;  3O5Q A;  1LG2 A;  5GPR A;  4DT4 A;  4HAR A;  1NWT A;  1YAT A;  2RUQ A;  3JYJ A;  1QPL A;  1KT0 A;  2UZ5 A;  3VAW A;  2M1I A;  3ARU A;  1TFV A;  4ZPV R;  4MAV A;  5HUA A;  3WL1 A;  3WD3 A;  1X6N A;  3EY6 A;  4P8V A;  2QF8 A;  2YBU A;  3O5P A;  2O92 A;  3B9A A;  3JYM A;  1FKK A;  3UQA A;  3BMB A;  1JNT A;  4IT4 A;  3FY1 A;  4W9O A;  2DT2 A;  2KI3 A;  1W1P A;  4U84 A;  1LL4 A;  2DPE A;  4WJX A;  5HW6 A;  2WLY A;  3TCZ A;  2WM0 A;  1J6Y A;  1NMV A;  1LG1 A;  1J4R A;  2A3A A;  2IF4 A;  3ARV A;  2XP8 A;  2A3E A;  3AS0 A;  1FKI A;  5B8I C;  3WD4 A;  4IQ2 A;  2ZQT A;  3TDB A;  1OGB A;  1E6Z A;  2IUZ A;  2F4E A;  1D2K A;  1JVW A;  1ZBW A;  1HKJ A;  1N1A A;  4N19 A;  2AOS A;  2FDM A;  4G2P A;  3RM8 A;  1GRJ A;  4PTM A;  2KFW A;  5HKG A;  1ITX A;  2Q5A A;  4LGX A;  1WB0 A;  3KAB A;  1FJD A;  2B5U B;  2VCD A;  1JND A;  4NSB A;  4QIB A;  5HTG A;  2KGJ A;  4ODP A;  3NTP A;  4DRN A;  2RUR A;  2LKN A;  3B7X A;  4DRK A;  4P8U A;  1W1T A;  3O5F A;  1LL7 A;  3WQW A;  4ML4 A;  1Q1C A;  5I98 A;  2VN1 A;  3KAI A;  2DT0 A;  1EQ3 A;  2A3C A;  1FKB A;  2A3B A;  2L2S A;  4W5U A;  1W9V A;  4IT6 A;  4DIP A;  1KT1 A;  1PIN A;  3IHZ A;  1FKD A;  3CGN A;  3IKG A;  1T11 A;  4JFM A;  4IPX A;  4DRP A;  1UR9 A;  3PRD A;  1ZU8 A;  2M2A A;  3MDY B;  2PV3 A;  1E6R A;  4Z2I A;  3ARP A;  1GOI A;  4U86 A;  1QZ2 A;  3O5L A;  1HJV A;  4JFI A;  4LAX A;  2ZQU A;  1FKJ A;  2ZR6 A;  3KAH A;  2DG4 A;  1FKF A;  3TC5 A;  1LQ0 A;  4MSP A;  5HWB A;  2FAP A;  5HBF A;  1QPF A;  5BXJ A;  5DEZ A;  2FKE A;  1PBK A;  2DSZ A;  3PRB A;  4S3K A;  2RQS A;  2MNT A;  1L1P A;  4MPK A;  3UQI A;  1NSG A;  4U85 A;  4DZ2 A;  1E9L A;  2DG9 A;  3RGC A;  1FAP A;  3KAF A;  4ZS6 A;  4Z2G A;  2O9O A;  1U79 A;  3O5I A;  1HKI A;  5D75 A;  3B8S A;  5HW7 A;  1ZBC A;  1D7H A;  3ART A;  1JNS A;  2ETN A;  2ZQS A;  5DIV A;  4DRH A;  1W26 A;  3FAP A;  3B9D A;  1CTN A;  4DRM A;  2DSV A;  1BKF A;  4S3J A;  4WKH A;  3GU0 A;  4HBO A;  2DSW A;  1NMW A;  2DT1 A;  1XHG A;  2ITK A;  1ROT A;  4DWS C;  3WH0 A;  4IQC A;  1FFR A;  1D6O A;  2B31 A;  3KAG A;  3UF8 A;  4NZC A;  3PR9 A;  1ZBV A;  2XP6 A;  1FKR A;  4KR0 B;  1D7J A;  4LAW A;  4DWS A;  4JFK A;  4AY1 A;  4MNL A;  2PI6 A;  2XPA A;  1GPF A;  3CZ8 A;  3ODK A;  4TW8 A;  4J4N A;  4LAY A;  4ODN A;  1E6N A;  4TW7 A;  4DRQ A;  3OOB A;  4Q22 A;  5DIT A;  1YW5 A;  4MTV A;  1A7X A;  4Q7N A;  3I6C A;  4Z2K A;  2D9F A;  3B9E A;  4R5E A;  2P4V A;  1FKS A;  1FKH A;  1GUV A;  1BL4 A;  3EIP A;  2LGO A;  3OA5 A;  4ZPT R;  1FKT A;  2ESC A;  4URI A;  1W9P A;  3PA7 A;  4W9Q A;  3ALG A;  3G6M A;  4WK9 A;  2RSE A;  3LUO A;  3O5M A;  3ALF A;  3AS2 A;  1E15 A;  3WQV A;  2ZQV A;  4C02 B;  3ARZ A;  1HJW A;  4Z2H A;  4W9P A;  3KCE A;  4DRI A;  1F40 A;  1ZBK A;  2PBC A;  2RUD A;  4HBE A;  4TNS A;  2F2D A;  3ARX A;  3CHF A;  2Y78 A;  2KE0 A;  1O6I A;  3AS1 A;  4MNK A;  3GTY X;  1Q6U A;  1W9U A;  2YBT A;  1EIB A;  3RM4 A;  1W1V A;  1OGG A;  4ZPW R;  3RME A;  3WKZ A;  4P8X A;  1HXV A;  1XRV A;  4WIW A;  1NH6 A;  3O5E A;  4QT2 A;  1C9H A;  2MLX A;  1E44 A;  3KZ7 A;  4ODQ A;  1ZL1 A;  2XP3 A;  1JCH B;  4TYO A;  1Q6I A;  3WIJ A;  2PV1 A;  2KO7 A;  3WD0 A;  4DZ3 A;  1HKK A;  1WAW A;  3O5R A;  2M08 A;  2XP4 A;  3ARR A;  3CHC A;  3WD2 A;  4P8W A;  3BXW A;  1IX5 A;  2KR7 A;  4Z2J A;  1SR0 A;  4O2T A;  2RUC A;  1NWU A;  3G6L A;  2PPN A;  4WKF A;  3KAC A;  2PPO A;  1EHN A;  5GPG A;  2MF9 A;  3UI6 A;  1B6C A;  1ZCN A;  1H0G A;  4DRO A;  2G8Z A;  4DWS B;  3RM9 A;  1H0I A;  4TX0 A;  4MGV A;  2G41 A;  2ZR5 A;  4L3N A;  2N87 A;  4L72 B;  1E6P A;  4Z2L A;  1VF8 A;  5GQB A;  4FAP A;  3NRK A;  3H9R B;  1EDQ A;  1W1Y A;  1FKG A;  3O5J A;  2WLZ A;  4FN2 A;  1ZK6 A;  1FD9 A;  3O5D A;  2JZV A;  1F8A B;  1NWS A;  4J4O A;  2MLZ A;  1WNO A;  2PPP A;  3GPK A;  3O5G A;  5DIU A;  1TCO C;  4QZV B;  1K9T A;  4LAV A;  5J6E A;  3WD1 A;  4JFL A;  1RD6 A;  2PV2 A;  2OFN A;  3PRA A;  1EYM A;  2LPV A;  4WKA A;  1M5Y A;  3IK8 A;  2DSU A;  1LJY A;  4ODL A;  2EUL A; 
#chains in the Genus database with same CATH homology
 3CHE A;  1Q6H A;  1UR8 A;  1J4I A;  4NNR A;  4JYS A;  1HKM A;  2XP5 A;  4ODK A;  3O5K A;  2AWG A;  4ITZ A;  1ROU A;  4QT3 A;  4R0X A;  3UI4 A;  5DF0 A;  4MNM A;  4DH0 A;  3AQU A;  4BF8 A;  1OWQ A;  5HWC A;  5HW8 A;  4MNJ A;  1J4H A;  5DO2 A;  5HT1 A;  1JNE A;  3ARO A;  3UQB A;  3NI6 A;  2MLY A;  3ARQ A;  4GGQ A;  1ZB5 A;  3CHD A;  4JFJ A;  1X6L A;  1P5Q A;  3KAD A;  4ODM A;  2DG3 A;  2DT3 A;  2F21 A;  4KQZ A;  2LJ4 A;  4ODR A;  1R9H A;  2XPB A;  3UI5 A;  3IKD A;  3RFW A;  2K8I A;  3CGM A;  4ODO A;  2XP7 A;  4XAK A;  4GIV A;  5JH8 A;  1Y0O A;  4DRJ A;  2WK2 A;  2MPH A;  3W4R A;  2XP9 A;  4G50 A;  1SYT A;  1LL6 A;  1KFW A;  1FFQ A;  2OLH A;  3AS3 A;  1FKL A;  3WL0 A;  4DWS D;  3O5O A;  3QOK A;  1D7I A;  1HJX A;  2ZR4 A;  3ARS A;  3ARY A;  3FXY A;  3ARW A;  3JXV A;  3CH9 A;  4TW6 A;  1NWR A;  3O5Q A;  1LG2 A;  5GPR A;  4DT4 A;  4HAR A;  1NWT A;  1YAT A;  2RUQ A;  3JYJ A;  1QPL A;  1KT0 A;  2UZ5 A;  3VAW A;  2M1I A;  3ARU A;  1TFV A;  4ZPV R;  4MAV A;  5HUA A;  3WL1 A;  3WD3 A;  1X6N A;  3EY6 A;  4P8V A;  2QF8 A;  2YBU A;  3O5P A;  2O92 A;  3B9A A;  3JYM A;  1FKK A;  3UQA A;  1JNT A;  4IT4 A;  3FY1 A;  4W9O A;  2DT2 A;  2KI3 A;  1W1P A;  4U84 A;  1LL4 A;  2DPE A;  4WJX A;  5HW6 A;  2WLY A;  3TCZ A;  2WM0 A;  1J6Y A;  1NMV A;  1LG1 A;  1J4R A;  2A3A A;  2IF4 A;  3ARV A;  2XP8 A;  2A3E A;  3AS0 A;  1FKI A;  5B8I C;  3WD4 A;  4IQ2 A;  2ZQT A;  3TDB A;  1OGB A;  1E6Z A;  2IUZ A;  2F4E A;  1D2K A;  1JVW A;  1ZBW A;  1HKJ A;  1N1A A;  4N19 A;  2AOS A;  2FDM A;  4G2P A;  3RM8 A;  4PTM A;  2KFW A;  5HKG A;  1ITX A;  2Q5A A;  4LGX A;  1WB0 A;  3KAB A;  1FJD A;  2VCD A;  1JND A;  4NSB A;  4QIB A;  5HTG A;  2KGJ A;  4ODP A;  3NTP A;  4DRN A;  2RUR A;  2LKN A;  3B7X A;  4DRK A;  4P8U A;  1W1T A;  3O5F A;  1LL7 A;  3WQW A;  4ML4 A;  1Q1C A;  5I98 A;  2VN1 A;  3KAI A;  2DT0 A;  1EQ3 A;  2A3C A;  1FKB A;  2A3B A;  2L2S A;  4W5U A;  1W9V A;  4IT6 A;  4DIP A;  1KT1 A;  1PIN A;  3IHZ A;  1FKD A;  3CGN A;  3IKG A;  1T11 A;  4JFM A;  4IPX A;  4DRP A;  1UR9 A;  3PRD A;  1ZU8 A;  2M2A A;  3MDY B;  2PV3 A;  1E6R A;  4Z2I A;  3ARP A;  1GOI A;  4U86 A;  1QZ2 A;  3O5L A;  1HJV A;  4JFI A;  4LAX A;  2ZQU A;  1FKJ A;  2ZR6 A;  3KAH A;  2DG4 A;  1FKF A;  3TC5 A;  1LQ0 A;  4MSP A;  5HWB A;  2FAP A;  5HBF A;  1QPF A;  5BXJ A;  5DEZ A;  2FKE A;  1PBK A;  2DSZ A;  3PRB A;  4S3K A;  2RQS A;  2MNT A;  1L1P A;  4MPK A;  3UQI A;  1NSG A;  4U85 A;  4DZ2 A;  1E9L A;  2DG9 A;  3RGC A;  1FAP A;  3KAF A;  4ZS6 A;  4Z2G A;  2O9O A;  1U79 A;  3O5I A;  1HKI A;  5D75 A;  3B8S A;  5HW7 A;  1ZBC A;  1D7H A;  3ART A;  1JNS A;  2ZQS A;  5DIV A;  4DRH A;  1W26 A;  3FAP A;  3B9D A;  1CTN A;  4DRM A;  2DSV A;  1BKF A;  4S3J A;  4WKH A;  4HBO A;  2DSW A;  1NMW A;  2DT1 A;  1XHG A;  2ITK A;  1ROT A;  4DWS C;  3WH0 A;  4IQC A;  1FFR A;  1D6O A;  2B31 A;  3KAG A;  3UF8 A;  4NZC A;  3PR9 A;  1ZBV A;  2XP6 A;  1FKR A;  4KR0 B;  1D7J A;  4LAW A;  4DWS A;  4JFK A;  4AY1 A;  4MNL A;  2PI6 A;  2XPA A;  1GPF A;  3CZ8 A;  3ODK A;  4TW8 A;  4J4N A;  4LAY A;  4ODN A;  1E6N A;  4TW7 A;  4DRQ A;  3OOB A;  4Q22 A;  5DIT A;  1YW5 A;  4MTV A;  1A7X A;  4Q7N A;  3I6C A;  4Z2K A;  2D9F A;  3B9E A;  4R5E A;  1FKS A;  1FKH A;  1GUV A;  1BL4 A;  2LGO A;  3OA5 A;  4ZPT R;  1FKT A;  2ESC A;  4URI A;  1W9P A;  3PA7 A;  4W9Q A;  3ALG A;  3G6M A;  4WK9 A;  2RSE A;  3LUO A;  3O5M A;  3ALF A;  3AS2 A;  1E15 A;  3WQV A;  2ZQV A;  4C02 B;  3ARZ A;  1HJW A;  4Z2H A;  4W9P A;  3KCE A;  4DRI A;  1F40 A;  1ZBK A;  2PBC A;  2RUD A;  4HBE A;  4TNS A;  2F2D A;  3ARX A;  3CHF A;  2Y78 A;  2KE0 A;  1O6I A;  3AS1 A;  4MNK A;  1Q6U A;  1W9U A;  2YBT A;  1EIB A;  3RM4 A;  1W1V A;  1OGG A;  4ZPW R;  3RME A;  3WKZ A;  4P8X A;  1HXV A;  1XRV A;  4WIW A;  1NH6 A;  3O5E A;  4QT2 A;  1C9H A;  2MLX A;  3KZ7 A;  4ODQ A;  1ZL1 A;  2XP3 A;  4TYO A;  1Q6I A;  3WIJ A;  2PV1 A;  2KO7 A;  3WD0 A;  4DZ3 A;  1HKK A;  1WAW A;  3O5R A;  2M08 A;  2XP4 A;  3ARR A;  3CHC A;  3WD2 A;  4P8W A;  3BXW A;  1IX5 A;  2KR7 A;  4Z2J A;  1SR0 A;  4O2T A;  2RUC A;  1NWU A;  3G6L A;  2PPN A;  4WKF A;  3KAC A;  2PPO A;  1EHN A;  5GPG A;  2MF9 A;  3UI6 A;  1B6C A;  1ZCN A;  1H0G A;  4DRO A;  2G8Z A;  4DWS B;  3RM9 A;  1H0I A;  4TX0 A;  4MGV A;  2G41 A;  2ZR5 A;  4L3N A;  2N87 A;  4L72 B;  1E6P A;  4Z2L A;  1VF8 A;  5GQB A;  4FAP A;  3NRK A;  3H9R B;  1EDQ A;  1W1Y A;  1FKG A;  3O5J A;  2WLZ A;  4FN2 A;  1ZK6 A;  1FD9 A;  3O5D A;  2JZV A;  1F8A B;  1NWS A;  4J4O A;  2MLZ A;  1WNO A;  2PPP A;  3GPK A;  3O5G A;  5DIU A;  1TCO C;  4QZV B;  1K9T A;  4LAV A;  5J6E A;  3WD1 A;  4JFL A;  1RD6 A;  2PV2 A;  2OFN A;  3PRA A;  1EYM A;  2LPV A;  4WKA A;  1M5Y A;  3IK8 A;  2DSU A;  1LJY A;  4ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...