2LKNA

Solution structure of the ppiase domain of human aryl-hydrocarbon receptor-interacting protein (aip)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords AH receptor-interacting protein
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lknA00
4JFLA 4N19A 4TW7A 4ODPA 2PPPA 2KFWA 4DRQA 2DG3A 4QT2A 5HW7A 4GIVA 3PRBA 2KGJA 3H9RB 1NMVA 2M08A 2XPBA 2ZQVA 2XP3A 3KABA 4LAVA 4TYOA 1N1AA 2XP6A 4C02B 1BKFA 5HWBA 3TCZA 4GGQA 3GPKA 5I98A 3KAFA 2MLXA 3MDYB 4LAXA 4DROA 1FD9A 2VN1A 2Q5AA 1J6YA 1B6CA 1JNTA 1Y0OA 2MNTA 3CGNA 4ODKA 4TW8A 1NSGA 1PINA 2L2SA 2MLYA 4DRJA 3O5MA 2RSEA 2KR7A 1Q6HA 2PV2A 2VCDA 4U86A 2UZ5A 4J4OA 2Y78A 1YATA 4IPXA 2FKEA 4J4NA 4ODQA 3UI6A 5D75A 3UQBA 2MPHA 1ROTA 3I6CA 4DRHA 4JYSA 1J4RA 1D6OA 2LPVA 4TNSA 2XP4A 1KT1A 2PPOA 2RUDA 3O5EA 2KO7A 3TC5A 4ODMA 4DRMA 1ROUA 3VAWA 2KI3A 2N87A 4FN2A 4MSPA 4DZ2A 1D7HA 2KE0A 2M2AA 2XP8A 2LGOA 1D7JA 4BF8A 1ZCNA 4G2PA 4DRNA 3UQAA 1P5QA 4G50A 2F2DA 2PV1A 4QT3A 2JZVA 3O5IA 1FKIA 3O5JA 3PRDA 1QZ2A 2LKNA 4JFKA 3UQIA 5HUAA 5HT1A 3KZ7A 5DIUA 1F40A 3OOBA 4DT4A 3IKGA 4JFJA 4O2TA 4DIPA 1Q6IA 3O5DA 2XP7A 2ZQSA 3KACA 5J6EA 4DH0A 2DG4A 3CGMA 4DRKA 4QIBA 4W9QA 3O5PA 3NRKA 5GPGA 2PV3A 3IK8A 4NNRA 5BXJA 4JFIA 3KAGA 2MF9A 3KAIA 2MLZA 4MGVA 1HXVA 3TDBA 2XP9A 3KCEA 3O5LA 4IQ2A 4ODNA 2AWGA 1T11A 1FKHA 1JVWA 3KADA 5DITA 3UI4A 2RUQA 1QPLA 5HKGA 4LAWA 1FAPA 2RQSA 1FKRA 4JFMA 2RURA 1M5YA 4U85A 3B7XA 5HW6A 2K8IA 1EYMA 2ZQUA 1D7IA 2PPNA 3O5QA 4W9OA 4R0XA 3WH0A 2ZR6A 3IKDA 4ODOA 1R9HA 1KT0A 5HWCA 1QPFA 3RGCA 3PA7A 1FKLA 3JYMA 3JYJA 4FAPA 4TX0A 2RUCA 1PBKA 2ZR5A 3UF8A 2ITKA 5B8IC 1C9HA 4IQCA 1YW5A 2XP5A 1F8AB 2DG9A 3NI6A 1FKDA 1U79A 2F21A 1A7XA 3O5FA 2F4EA 3NTPA 4DRPA 2ZQTA 3O5OA 4ODRA 3RFWA 4ODLA 1Q6UA 3FAPA 4TW6A 4W9PA 4DRIA 5HW8A 1EQ3A 4U84A 5DIVA 3O5KA 3LUOA 3JXVA 2M1IA 1FKBA 3IHZA 1FKFA 1BL4A 3O5RA 1NMWA 2OFNA 2LJ4A 3O5GA 1FKGA 2IF4A 2ZR4A 1FJDA 1FKJA 1L1PA 1FKKA 1FKSA 1JNSA 1Q1CA 1J4HA 2PBCA 5HTGA 1TCOC 1FKTA 1W26A 3ODKA 4ITZA 3UI5A 1ZK6A 1J4IA 3EY6A 2D9FA 4LAYA 4DZ3A 2XPAA 3KAHA 2FAPA
chains in the Genus database with same CATH superfamily
4JFLA 4W5UA 4ODPA 4HBEA 4WIWA 3H9RB 1NMVA 4TYOA 2XP3A 4DWSA 1BKFA 1SYTA 5I98A 4ML4A 3ARXA 4MNLA 1B6CA 1J6YA 1Y0OA 4R5EA 2MLYA 1O6IA 1H0GA 4XAKA 1Q6HA 2VCDA 1LG1A 4NZCA 4U86A 2UZ5A 3UI6A 1YATA 3RM4A 2FKEA 4Z2JA 3G6LA 3ARPA 1E9LA 2XP4A 1HKKA 2RUDA 1HKMA 1ROUA 3VAWA 3ALFA 1EDQA 3ARVA 4MSPA 4DZ2A 3UQAA 1ZCNA 4G2PA 2F2DA 2PV1A 4QT3A 4Z2GA 3ARWA 2LKNA 3PRDA 4JFKA 5DIUA 3CHFA 4Z2HA 2DT0A 2WLYA 2ZQSA 2DSUA 1WB0A 5GPGA 1JNDA 3ARTA 3KAGA 3AS0A 4MGVA 3TDBA 4IQ2A 3O5LA 2A3CA 1T11A 1FKHA 5DITA 2A3AA 2RQSA 1M5YA 1EYMA 2YBUA 1D2KA 4MNMA 3AQUA 4DWSB 4R0XA 3WH0A 4ODOA 5HWCA 1QPFA 5JH8A 4FAPA 2PI6A 2EULA 3UF8A 5B8IC 1C9HA 1YW5A 2XP5A 3NTPA 4DRPA 1VF8A 3BMBA 3O5OA 1E44A 1W9VA 3RFWA 4ODLA 1Q6UA 3ARZA 3FAPA 1EQ3A 5DIVA 3O5KA 1FFQA 1X6NA 2G8ZA 4WKHA 1W9PA 1BL4A 1WAWA 3O5GA 3WD2A 1FKKA 1Q1CA 1HKJA 1TCOC 3ODKA 3EY6A 4LAYA 4DZ3A 1RD6A 3GTYX 5GQBA 3WL1A 2PPPA 4L72B 3EIPA 4DRQA 1E6RA 5HW7A 2B31A 2F23A 2ZQVA 1JCHB 2DT2A 5DO2A 1N1AA 4C02B 3GPKA 3KAFA 4ZPVR 3ARUA 2VN1A 3ARYA 1JNTA 1LL6A 2MNTA 3CGNA 5HBFA 1PINA 4DRJA 3ARSA 2A3EA 2RSEA 1WNOA 3OA5A 2DSVA 3BXWA 2Y78A 1HJWA 4ODQA 1HJVA 1ITXA 1J4RA 1D6OA 4WJXA 4KQZA 4AY1A 1KT1A 3AS1A 3O5EA 4P8VA 3AROA 1W1YA 1LJYA 2XP8A 4Z2KA 1XRVA 2JZVA 2O9OA 3CH9A 4DWSC 3IKGA 3PRAA 1Q6IA 2XP7A 3KACA 2ESCA 4DRKA 4W9QA 3O5PA 3NRKA 2PV3A 2ETNA 2XP9A 4P8WA 3UI4A 2O92A 5HKGA 4LAWA 3PR9A 2RURA 1OWQA 2B5UB 2PPNA 3G6MA 2ZR6A 3WIJA 1R9HA 4Q22A 4TX0A 1PBKA 2ZR5A 4P8UA 4Z2LA 2DT3A 3AS3A 1F8AB 1FKDA 2F21A 3O5FA 1JNEA 1OGBA 1GPFA 1NWRA 2G41A 4IT6A 1NH6A 3LUOA 2DT1A 2OFNA 2A3BA 2LJ4A 3WQVA 4LGXA 1FJDA 2ZR4A 1FKJA 1FKSA 1JNSA 3WD1A 4ITZA 1ZK6A 2D9FA 3WD0A 2XPAA 4URIA 4N19A 4TW7A 1X6LA 1EIBA 2KFWA 4QT2A 3FY1A 2KGJA 4LAVA 2M08A 2XPBA 1EHNA 1GUVA 3GU0A 2XP6A 3CHEA 1NWTA 1E6PA 1ZU8A 3TCZA 1H0IA 2MLXA 3MDYB 4LAXA 4DROA 2Q5AA 1W1PA 3WD4A 1NSGA 3O5MA 1NWSA 2KR7A 3CHCA 2PV2A 4J4OA 4IPXA 4J4NA 5D75A 3UQBA 3I6CA 4JYSA 4TNSA 3WQWA 2PPOA 3RM8A 3TC5A 1IX5A 4FN2A 2LGOA 1D7JA 3QOKA 3WKZA 4BF8A 3AS2A 4DRNA 4G50A 1XHGA 3B9EA 1FKIA 3O5JA 2FDMA 1W1VA 4ZS6A 3OOBA 4DT4A 1OGGA 4O2TA 3CHDA 4DIPA 2WLZA 4HARA 5J6EA 4DH0A 2DG4A 3CGMA 4P8XA 5GPRA 1W9UA 2DSWA 1HJXA 4NNRA 4L3NA 5BXJA 4JFIA 2MF9A 2MLZA 1ZBKA 1HXVA 3KADA 1JVWA 1E15A 3FXYA 1CTNA 1QPLA 1FAPA 1FKRA 1W1TA 4JFMA 4U85A 3B7XA 1D7IA 3O5QA 3IKDA 4MNJA 3RGCA 1FKLA 3JYMA 3JYJA 2RUCA 5DF0A 1SR0A 2ITKA 4WK9A 3NI6A 2DG9A 4JFJA 4DRMA 1U79A 1A7XA 2IUZA 4WKFA 2ZQTA 4ODRA 2YBTA 1ZBVA 4W9PA 4DRIA 3JXVA 2M1IA 1FKBA 3IHZA 1FKFA 1NMWA 3CZ8A 1L1PA 4QZVB 1J4HA 2PBCA 4MPKA 5HTGA 1ZL1A 3B9DA 1W26A 1J4IA 4Z2IA 2FAPA 2WM0A 4U84A 2QF8A 2DG3A 4IT4A 4GIVA 5DEZA 3PRBA 1HKIA 3KABA 3RM9A 3B9AA 3W4RA 3WD3A 4UDMA 5HWBA 4GGQA 1UR8A 1FD9A 1GRJA 4S3KA 4ODKA 4TW8A 2L2SA 4DWSD 1ZBWA 4PTMA 2MPHA 1ROTA 4DRHA 2LPVA 2DSZA 2KO7A 4ODMA 2OLHA 2PN0A 2KI3A 2N87A 1D7HA 1E6ZA 2KE0A 2M2AA 1P5QA 3UQIA 3O5IA 2DPEA 1QZ2A 5HUAA 5HT1A 3KZ7A 1E6NA 3B8SA 1F40A 3O5DA 1LL7A 4NSBA 4MNKA 1UR9A 4MAVA 4HBOA 4QIBA 1TFVA 3IK8A 1LG2A 3KAIA 3KCEA 4ODNA 2AOSA 2AWGA 1FFRA 2P4VA 1LL4A 1ZB5A 1K9TA 2RUQA 3ARQA 4Q7NA 1LQ0A 2WK2A 5HW6A 2K8IA 2ZQUA 4W9OA 1KT0A 4MTVA 3PA7A 1KFWA 1ZBCA 3WL0A 4IQCA 4KR0B 1GOIA 2F4EA 5HW8A 4TW6A 4S3JA 4ZPWR 3O5RA 1FKGA 2IF4A 3ALGA 4WKAA 3RMEA 1FKTA 4ZPTR 3UI5A 1NWUA 3ARRA 3KAHA
chains in the Genus database with same CATH topology
4JFLA 4W5UA 4ODPA 4HBEA 4WIWA 3H9RB 1NMVA 4TYOA 2XP3A 4DWSA 1BKFA 1SYTA 5I98A 4ML4A 3ARXA 4MNLA 1B6CA 1J6YA 1Y0OA 4R5EA 2MLYA 1O6IA 1H0GA 4XAKA 1Q6HA 2VCDA 1LG1A 4NZCA 4U86A 2UZ5A 3UI6A 1YATA 3RM4A 2FKEA 4Z2JA 3G6LA 3ARPA 1E9LA 2XP4A 1HKKA 2RUDA 1HKMA 1ROUA 3VAWA 3ALFA 1EDQA 3ARVA 4MSPA 4DZ2A 3UQAA 1ZCNA 4G2PA 2F2DA 2PV1A 4QT3A 4Z2GA 3ARWA 2LKNA 3PRDA 4JFKA 5DIUA 3CHFA 4Z2HA 2DT0A 2WLYA 2ZQSA 2DSUA 1WB0A 5GPGA 1JNDA 3ARTA 3KAGA 3AS0A 4MGVA 3TDBA 4IQ2A 3O5LA 2A3CA 1T11A 1FKHA 5DITA 2A3AA 2RQSA 1M5YA 1EYMA 2YBUA 1D2KA 4MNMA 3AQUA 4DWSB 4R0XA 3WH0A 4ODOA 5HWCA 1QPFA 5JH8A 4FAPA 2PI6A 3UF8A 5B8IC 1C9HA 1YW5A 2XP5A 3NTPA 4DRPA 1VF8A 3O5OA 1W9VA 3RFWA 4ODLA 1Q6UA 3ARZA 3FAPA 1EQ3A 5DIVA 3O5KA 1FFQA 1X6NA 2G8ZA 4WKHA 1W9PA 1BL4A 1WAWA 3O5GA 3WD2A 1FKKA 1Q1CA 1HKJA 1TCOC 3ODKA 3EY6A 4LAYA 4DZ3A 1RD6A 5GQBA 3WL1A 2PPPA 4L72B 4DRQA 1E6RA 5HW7A 2B31A 2ZQVA 2DT2A 5DO2A 1N1AA 4C02B 3GPKA 3KAFA 4ZPVR 3ARUA 2VN1A 3ARYA 1JNTA 1LL6A 2MNTA 3CGNA 5HBFA 1PINA 4DRJA 3ARSA 2A3EA 2RSEA 1WNOA 3OA5A 2DSVA 3BXWA 2Y78A 1HJWA 4ODQA 1HJVA 1ITXA 1J4RA 1D6OA 4WJXA 4KQZA 4AY1A 1KT1A 3AS1A 3O5EA 4P8VA 3AROA 1W1YA 1LJYA 2XP8A 4Z2KA 1XRVA 2JZVA 2O9OA 3CH9A 4DWSC 3IKGA 3PRAA 1Q6IA 2XP7A 3KACA 2ESCA 4DRKA 4W9QA 3O5PA 3NRKA 2PV3A 2XP9A 4P8WA 3UI4A 2O92A 5HKGA 4LAWA 3PR9A 2RURA 1OWQA 2PPNA 3G6MA 2ZR6A 3WIJA 1R9HA 4Q22A 4TX0A 1PBKA 2ZR5A 4P8UA 4Z2LA 2DT3A 3AS3A 1F8AB 1FKDA 2F21A 3O5FA 1JNEA 1OGBA 1GPFA 1NWRA 2G41A 4IT6A 1NH6A 3LUOA 2DT1A 2OFNA 2A3BA 2LJ4A 3WQVA 4LGXA 1FJDA 2ZR4A 1FKJA 1FKSA 1JNSA 3WD1A 4ITZA 1ZK6A 2D9FA 3WD0A 2XPAA 4URIA 4N19A 4TW7A 1X6LA 1EIBA 2KFWA 4QT2A 3FY1A 2KGJA 4LAVA 2M08A 2XPBA 1EHNA 1GUVA 2XP6A 3CHEA 1NWTA 1E6PA 1ZU8A 3TCZA 1H0IA 2MLXA 3MDYB 4LAXA 4DROA 2Q5AA 1W1PA 3WD4A 1NSGA 3O5MA 1NWSA 2KR7A 3CHCA 2PV2A 4J4OA 4IPXA 4J4NA 5D75A 3UQBA 3I6CA 4JYSA 4TNSA 3WQWA 2PPOA 3RM8A 3TC5A 1IX5A 4FN2A 2LGOA 1D7JA 3QOKA 3WKZA 4BF8A 3AS2A 4DRNA 4G50A 1XHGA 3B9EA 1FKIA 3O5JA 2FDMA 1W1VA 4ZS6A 3OOBA 4DT4A 1OGGA 4O2TA 3CHDA 4DIPA 2WLZA 4HARA 5J6EA 4DH0A 2DG4A 3CGMA 4P8XA 5GPRA 1W9UA 2DSWA 1HJXA 4NNRA 4L3NA 5BXJA 4JFIA 2MF9A 2MLZA 1ZBKA 1HXVA 3KADA 1JVWA 1E15A 3FXYA 1CTNA 1QPLA 1FAPA 1FKRA 1W1TA 4JFMA 4U85A 3B7XA 1D7IA 3O5QA 3IKDA 4MNJA 3RGCA 1FKLA 3JYMA 3JYJA 2RUCA 5DF0A 1SR0A 2ITKA 4WK9A 3NI6A 4JFJA 2DG9A 4DRMA 1U79A 1A7XA 2IUZA 4WKFA 2ZQTA 4ODRA 2YBTA 1ZBVA 4W9PA 4DRIA 3JXVA 2M1IA 1FKBA 3IHZA 1FKFA 1NMWA 3CZ8A 1L1PA 4QZVB 1J4HA 2PBCA 4MPKA 5HTGA 1ZL1A 3B9DA 1W26A 1J4IA 4Z2IA 2FAPA 2WM0A 4U84A 2QF8A 2DG3A 4IT4A 4GIVA 5DEZA 3PRBA 1HKIA 3KABA 3RM9A 3B9AA 3W4RA 3WD3A 5HWBA 4GGQA 1UR8A 1FD9A 4S3KA 4ODKA 4TW8A 2L2SA 4DWSD 1ZBWA 4PTMA 2MPHA 1ROTA 4DRHA 2LPVA 2DSZA 2KO7A 4ODMA 2OLHA 2KI3A 2N87A 1D7HA 1E6ZA 2KE0A 2M2AA 1P5QA 3UQIA 3O5IA 2DPEA 1QZ2A 5HUAA 5HT1A 3KZ7A 1E6NA 3B8SA 1F40A 3O5DA 1LL7A 4NSBA 4MNKA 1UR9A 4MAVA 4HBOA 4QIBA 1TFVA 3IK8A 1LG2A 3KAIA 3KCEA 4ODNA 2AOSA 2AWGA 1FFRA 1LL4A 1ZB5A 1K9TA 2RUQA 3ARQA 4Q7NA 1LQ0A 2WK2A 5HW6A 2K8IA 2ZQUA 4W9OA 1KT0A 4MTVA 3PA7A 1KFWA 1ZBCA 3WL0A 4IQCA 4KR0B 1GOIA 2F4EA 5HW8A 4TW6A 4S3JA 4ZPWR 3O5RA 1FKGA 2IF4A 3ALGA 4WKAA 3RMEA 1FKTA 4ZPTR 3UI5A 1NWUA 3ARRA 3KAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFL A;  4N19 A;  4TW7 A;  4ODP A;  2PPP A;  2KFW A;  4DRQ A;  2DG3 A;  4QT2 A;  5HW7 A;  4GIV A;  3PRB A;  2KGJ A;  3H9R B;  1NMV A;  2M08 A;  2XPB A;  2ZQV A;  2XP3 A;  3KAB A;  4LAV A;  4TYO A;  1N1A A;  2XP6 A;  4C02 B;  1BKF A;  5HWB A;  3TCZ A;  4GGQ A;  3GPK A;  5I98 A;  3KAF A;  2MLX A;  3MDY B;  4LAX A;  4DRO A;  1FD9 A;  2VN1 A;  2Q5A A;  1J6Y A;  1B6C A;  1JNT A;  1Y0O A;  2MNT A;  3CGN A;  4ODK A;  4TW8 A;  1NSG A;  1PIN A;  2L2S A;  2MLY A;  4DRJ A;  3O5M A;  2RSE A;  2KR7 A;  1Q6H A;  2PV2 A;  2VCD A;  4U86 A;  2UZ5 A;  4J4O A;  2Y78 A;  1YAT A;  4IPX A;  2FKE A;  4J4N A;  4ODQ A;  3UI6 A;  5D75 A;  3UQB A;  2MPH A;  1ROT A;  3I6C A;  4DRH A;  4JYS A;  1J4R A;  1D6O A;  2LPV A;  4TNS A;  2XP4 A;  1KT1 A;  2PPO A;  2RUD A;  3O5E A;  2KO7 A;  3TC5 A;  4ODM A;  4DRM A;  1ROU A;  3VAW A;  2KI3 A;  2N87 A;  4FN2 A;  4MSP A;  4DZ2 A;  1D7H A;  2KE0 A;  2M2A A;  2XP8 A;  2LGO A;  1D7J A;  4BF8 A;  1ZCN A;  4G2P A;  4DRN A;  3UQA A;  1P5Q A;  4G50 A;  2F2D A;  2PV1 A;  4QT3 A;  2JZV A;  3O5I A;  1FKI A;  3O5J A;  3PRD A;  1QZ2 A;  2LKN A;  4JFK A;  3UQI A;  5HUA A;  5HT1 A;  3KZ7 A;  5DIU A;  1F40 A;  3OOB A;  4DT4 A;  3IKG A;  4JFJ A;  4O2T A;  4DIP A;  1Q6I A;  3O5D A;  2XP7 A;  2ZQS A;  3KAC A;  5J6E A;  4DH0 A;  2DG4 A;  3CGM A;  4DRK A;  4QIB A;  4W9Q A;  3O5P A;  3NRK A;  5GPG A;  2PV3 A;  3IK8 A;  4NNR A;  5BXJ A;  4JFI A;  3KAG A;  2MF9 A;  3KAI A;  2MLZ A;  4MGV A;  1HXV A;  3TDB A;  2XP9 A;  3KCE A;  3O5L A;  4IQ2 A;  4ODN A;  2AWG A;  1T11 A;  1FKH A;  1JVW A;  3KAD A;  5DIT A;  3UI4 A;  2RUQ A;  1QPL A;  5HKG A;  4LAW A;  1FAP A;  2RQS A;  1FKR A;  4JFM A;  2RUR A;  1M5Y A;  4U85 A;  3B7X A;  5HW6 A;  2K8I A;  1EYM A;  2ZQU A;  1D7I A;  2PPN A;  3O5Q A;  4W9O A;  4R0X A;  3WH0 A;  2ZR6 A;  3IKD A;  4ODO A;  1R9H A;  1KT0 A;  5HWC A;  1QPF A;  3RGC A;  3PA7 A;  1FKL A;  3JYM A;  3JYJ A;  4FAP A;  4TX0 A;  2RUC A;  1PBK A;  2ZR5 A;  3UF8 A;  2ITK A;  5B8I C;  1C9H A;  4IQC A;  1YW5 A;  2XP5 A;  1F8A B;  2DG9 A;  3NI6 A;  1FKD A;  1U79 A;  2F21 A;  1A7X A;  3O5F A;  2F4E A;  3NTP A;  4DRP A;  2ZQT A;  3O5O A;  4ODR A;  3RFW A;  4ODL A;  1Q6U A;  3FAP A;  4TW6 A;  4W9P A;  4DRI A;  5HW8 A;  1EQ3 A;  4U84 A;  5DIV A;  3O5K A;  3LUO A;  3JXV A;  2M1I A;  1FKB A;  3IHZ A;  1FKF A;  1BL4 A;  3O5R A;  1NMW A;  2OFN A;  2LJ4 A;  3O5G A;  1FKG A;  2IF4 A;  2ZR4 A;  1FJD A;  1FKJ A;  1L1P A;  1FKK A;  1FKS A;  1JNS A;  1Q1C A;  1J4H A;  2PBC A;  5HTG A;  1TCO C;  1FKT A;  1W26 A;  3ODK A;  4ITZ A;  3UI5 A;  1ZK6 A;  1J4I A;  3EY6 A;  2D9F A;  4LAY A;  4DZ3 A;  2XPA A;  3KAH A;  2FAP A; 
#chains in the Genus database with same CATH topology
 4JFL A;  4W5U A;  4ODP A;  4HBE A;  4WIW A;  3H9R B;  1NMV A;  4TYO A;  2XP3 A;  4DWS A;  1BKF A;  1SYT A;  5I98 A;  4ML4 A;  3ARX A;  4MNL A;  1B6C A;  1J6Y A;  1Y0O A;  4R5E A;  2MLY A;  1O6I A;  1H0G A;  4XAK A;  1Q6H A;  2VCD A;  1LG1 A;  4NZC A;  4U86 A;  2UZ5 A;  3UI6 A;  1YAT A;  3RM4 A;  2FKE A;  4Z2J A;  3G6L A;  3ARP A;  1E9L A;  2XP4 A;  1HKK A;  2RUD A;  1HKM A;  1ROU A;  3VAW A;  3ALF A;  1EDQ A;  3ARV A;  4MSP A;  4DZ2 A;  3UQA A;  1ZCN A;  4G2P A;  2F2D A;  2PV1 A;  4QT3 A;  4Z2G A;  3ARW A;  2LKN A;  3PRD A;  4JFK A;  5DIU A;  3CHF A;  4Z2H A;  2DT0 A;  2WLY A;  2ZQS A;  2DSU A;  1WB0 A;  5GPG A;  1JND A;  3ART A;  3KAG A;  3AS0 A;  4MGV A;  3TDB A;  4IQ2 A;  3O5L A;  2A3C A;  1T11 A;  1FKH A;  5DIT A;  2A3A A;  2RQS A;  1M5Y A;  1EYM A;  2YBU A;  1D2K A;  4MNM A;  3AQU A;  4DWS B;  4R0X A;  3WH0 A;  4ODO A;  5HWC A;  1QPF A;  5JH8 A;  4FAP A;  2PI6 A;  2EUL A;  3UF8 A;  5B8I C;  1C9H A;  1YW5 A;  2XP5 A;  3NTP A;  4DRP A;  1VF8 A;  3BMB A;  3O5O A;  1E44 A;  1W9V A;  3RFW A;  4ODL A;  1Q6U A;  3ARZ A;  3FAP A;  1EQ3 A;  5DIV A;  3O5K A;  1FFQ A;  1X6N A;  2G8Z A;  4WKH A;  1W9P A;  1BL4 A;  1WAW A;  3O5G A;  3WD2 A;  1FKK A;  1Q1C A;  1HKJ A;  1TCO C;  3ODK A;  3EY6 A;  4LAY A;  4DZ3 A;  1RD6 A;  3GTY X;  5GQB A;  3WL1 A;  2PPP A;  4L72 B;  3EIP A;  4DRQ A;  1E6R A;  5HW7 A;  2B31 A;  2F23 A;  2ZQV A;  1JCH B;  2DT2 A;  5DO2 A;  1N1A A;  4C02 B;  3GPK A;  3KAF A;  4ZPV R;  3ARU A;  2VN1 A;  3ARY A;  1JNT A;  1LL6 A;  2MNT A;  3CGN A;  5HBF A;  1PIN A;  4DRJ A;  3ARS A;  2A3E A;  2RSE A;  1WNO A;  3OA5 A;  2DSV A;  3BXW A;  2Y78 A;  1HJW A;  4ODQ A;  1HJV A;  1ITX A;  1J4R A;  1D6O A;  4WJX A;  4KQZ A;  4AY1 A;  1KT1 A;  3AS1 A;  3O5E A;  4P8V A;  3ARO A;  1W1Y A;  1LJY A;  2XP8 A;  4Z2K A;  1XRV A;  2JZV A;  2O9O A;  3CH9 A;  4DWS C;  3IKG A;  3PRA A;  1Q6I A;  2XP7 A;  3KAC A;  2ESC A;  4DRK A;  4W9Q A;  3O5P A;  3NRK A;  2PV3 A;  2ETN A;  2XP9 A;  4P8W A;  3UI4 A;  2O92 A;  5HKG A;  4LAW A;  3PR9 A;  2RUR A;  1OWQ A;  2B5U B;  2PPN A;  3G6M A;  2ZR6 A;  3WIJ A;  1R9H A;  4Q22 A;  4TX0 A;  1PBK A;  2ZR5 A;  4P8U A;  4Z2L A;  2DT3 A;  3AS3 A;  1F8A B;  1FKD A;  2F21 A;  3O5F A;  1JNE A;  1OGB A;  1GPF A;  1NWR A;  2G41 A;  4IT6 A;  1NH6 A;  3LUO A;  2DT1 A;  2OFN A;  2A3B A;  2LJ4 A;  3WQV A;  4LGX A;  1FJD A;  2ZR4 A;  1FKJ A;  1FKS A;  1JNS A;  3WD1 A;  4ITZ A;  1ZK6 A;  2D9F A;  3WD0 A;  2XPA A;  4URI A;  4N19 A;  4TW7 A;  1X6L A;  1EIB A;  2KFW A;  4QT2 A;  3FY1 A;  2KGJ A;  4LAV A;  2M08 A;  2XPB A;  1EHN A;  1GUV A;  3GU0 A;  2XP6 A;  3CHE A;  1NWT A;  1E6P A;  1ZU8 A;  3TCZ A;  1H0I A;  2MLX A;  3MDY B;  4LAX A;  4DRO A;  2Q5A A;  1W1P A;  3WD4 A;  1NSG A;  3O5M A;  1NWS A;  2KR7 A;  3CHC A;  2PV2 A;  4J4O A;  4IPX A;  4J4N A;  5D75 A;  3UQB A;  3I6C A;  4JYS A;  4TNS A;  3WQW A;  2PPO A;  3RM8 A;  3TC5 A;  1IX5 A;  4FN2 A;  2LGO A;  1D7J A;  3QOK A;  3WKZ A;  4BF8 A;  3AS2 A;  4DRN A;  4G50 A;  1XHG A;  3B9E A;  1FKI A;  3O5J A;  2FDM A;  1W1V A;  4ZS6 A;  3OOB A;  4DT4 A;  1OGG A;  4O2T A;  3CHD A;  4DIP A;  2WLZ A;  4HAR A;  5J6E A;  4DH0 A;  2DG4 A;  3CGM A;  4P8X A;  5GPR A;  1W9U A;  2DSW A;  1HJX A;  4NNR A;  4L3N A;  5BXJ A;  4JFI A;  2MF9 A;  2MLZ A;  1ZBK A;  1HXV A;  3KAD A;  1JVW A;  1E15 A;  3FXY A;  1CTN A;  1QPL A;  1FAP A;  1FKR A;  1W1T A;  4JFM A;  4U85 A;  3B7X A;  1D7I A;  3O5Q A;  3IKD A;  4MNJ A;  3RGC A;  1FKL A;  3JYM A;  3JYJ A;  2RUC A;  5DF0 A;  1SR0 A;  2ITK A;  4WK9 A;  3NI6 A;  2DG9 A;  4JFJ A;  4DRM A;  1U79 A;  1A7X A;  2IUZ A;  4WKF A;  2ZQT A;  4ODR A;  2YBT A;  1ZBV A;  4W9P A;  4DRI A;  3JXV A;  2M1I A;  1FKB A;  3IHZ A;  1FKF A;  1NMW A;  3CZ8 A;  1L1P A;  4QZV B;  1J4H A;  2PBC A;  4MPK A;  5HTG A;  1ZL1 A;  3B9D A;  1W26 A;  1J4I A;  4Z2I A;  2FAP A;  2WM0 A;  4U84 A;  2QF8 A;  2DG3 A;  4IT4 A;  4GIV A;  5DEZ A;  3PRB A;  1HKI A;  3KAB A;  3RM9 A;  3B9A A;  3W4R A;  3WD3 A;  4UDM A;  5HWB A;  4GGQ A;  1UR8 A;  1FD9 A;  1GRJ A;  4S3K A;  4ODK A;  4TW8 A;  2L2S A;  4DWS D;  1ZBW A;  4PTM A;  2MPH A;  1ROT A;  4DRH A;  2LPV A;  2DSZ A;  2KO7 A;  4ODM A;  2OLH A;  2PN0 A;  2KI3 A;  2N87 A;  1D7H A;  1E6Z A;  2KE0 A;  2M2A A;  1P5Q A;  3UQI A;  3O5I A;  2DPE A;  1QZ2 A;  5HUA A;  5HT1 A;  3KZ7 A;  1E6N A;  3B8S A;  1F40 A;  3O5D A;  1LL7 A;  4NSB A;  4MNK A;  1UR9 A;  4MAV A;  4HBO A;  4QIB A;  1TFV A;  3IK8 A;  1LG2 A;  3KAI A;  3KCE A;  4ODN A;  2AOS A;  2AWG A;  1FFR A;  2P4V A;  1LL4 A;  1ZB5 A;  1K9T A;  2RUQ A;  3ARQ A;  4Q7N A;  1LQ0 A;  2WK2 A;  5HW6 A;  2K8I A;  2ZQU A;  4W9O A;  1KT0 A;  4MTV A;  3PA7 A;  1KFW A;  1ZBC A;  3WL0 A;  4IQC A;  4KR0 B;  1GOI A;  2F4E A;  5HW8 A;  4TW6 A;  4S3J A;  4ZPW R;  3O5R A;  1FKG A;  2IF4 A;  3ALG A;  4WKA A;  3RME A;  1FKT A;  4ZPT R;  3UI5 A;  1NWU A;  3ARR A;  3KAH A; 
#chains in the Genus database with same CATH homology
 4JFL A;  4W5U A;  4ODP A;  4HBE A;  4WIW A;  3H9R B;  1NMV A;  4TYO A;  2XP3 A;  4DWS A;  1BKF A;  1SYT A;  5I98 A;  4ML4 A;  3ARX A;  4MNL A;  1B6C A;  1J6Y A;  1Y0O A;  4R5E A;  2MLY A;  1O6I A;  1H0G A;  4XAK A;  1Q6H A;  2VCD A;  1LG1 A;  4NZC A;  4U86 A;  2UZ5 A;  3UI6 A;  1YAT A;  3RM4 A;  2FKE A;  4Z2J A;  3G6L A;  3ARP A;  1E9L A;  2XP4 A;  1HKK A;  2RUD A;  1HKM A;  1ROU A;  3VAW A;  3ALF A;  1EDQ A;  3ARV A;  4MSP A;  4DZ2 A;  3UQA A;  1ZCN A;  4G2P A;  2F2D A;  2PV1 A;  4QT3 A;  4Z2G A;  3ARW A;  2LKN A;  3PRD A;  4JFK A;  5DIU A;  3CHF A;  4Z2H A;  2DT0 A;  2WLY A;  2ZQS A;  2DSU A;  1WB0 A;  5GPG A;  1JND A;  3ART A;  3KAG A;  3AS0 A;  4MGV A;  3TDB A;  4IQ2 A;  3O5L A;  2A3C A;  1T11 A;  1FKH A;  5DIT A;  2A3A A;  2RQS A;  1M5Y A;  1EYM A;  2YBU A;  1D2K A;  4MNM A;  3AQU A;  4DWS B;  4R0X A;  3WH0 A;  4ODO A;  5HWC A;  1QPF A;  5JH8 A;  4FAP A;  2PI6 A;  3UF8 A;  5B8I C;  1C9H A;  1YW5 A;  2XP5 A;  3NTP A;  4DRP A;  1VF8 A;  3O5O A;  1W9V A;  3RFW A;  4ODL A;  1Q6U A;  3ARZ A;  3FAP A;  1EQ3 A;  5DIV A;  3O5K A;  1FFQ A;  1X6N A;  2G8Z A;  4WKH A;  1W9P A;  1BL4 A;  1WAW A;  3O5G A;  3WD2 A;  1FKK A;  1Q1C A;  1HKJ A;  1TCO C;  3ODK A;  3EY6 A;  4LAY A;  4DZ3 A;  1RD6 A;  5GQB A;  3WL1 A;  2PPP A;  4L72 B;  4DRQ A;  1E6R A;  5HW7 A;  2B31 A;  2ZQV A;  2DT2 A;  5DO2 A;  1N1A A;  4C02 B;  3GPK A;  3KAF A;  4ZPV R;  3ARU A;  2VN1 A;  3ARY A;  1JNT A;  1LL6 A;  2MNT A;  3CGN A;  5HBF A;  1PIN A;  4DRJ A;  3ARS A;  2A3E A;  2RSE A;  1WNO A;  3OA5 A;  2DSV A;  3BXW A;  2Y78 A;  1HJW A;  4ODQ A;  1HJV A;  1ITX A;  1J4R A;  1D6O A;  4WJX A;  4KQZ A;  4AY1 A;  1KT1 A;  3AS1 A;  3O5E A;  4P8V A;  3ARO A;  1W1Y A;  1LJY A;  2XP8 A;  4Z2K A;  1XRV A;  2JZV A;  2O9O A;  3CH9 A;  4DWS C;  3IKG A;  3PRA A;  1Q6I A;  2XP7 A;  3KAC A;  2ESC A;  4DRK A;  4W9Q A;  3O5P A;  3NRK A;  2PV3 A;  2XP9 A;  4P8W A;  3UI4 A;  2O92 A;  5HKG A;  4LAW A;  3PR9 A;  2RUR A;  1OWQ A;  2PPN A;  3G6M A;  2ZR6 A;  3WIJ A;  1R9H A;  4Q22 A;  4TX0 A;  1PBK A;  2ZR5 A;  4P8U A;  4Z2L A;  2DT3 A;  3AS3 A;  1F8A B;  1FKD A;  2F21 A;  3O5F A;  1JNE A;  1OGB A;  1GPF A;  1NWR A;  2G41 A;  4IT6 A;  1NH6 A;  3LUO A;  2DT1 A;  2OFN A;  2A3B A;  2LJ4 A;  3WQV A;  4LGX A;  1FJD A;  2ZR4 A;  1FKJ A;  1FKS A;  1JNS A;  3WD1 A;  4ITZ A;  1ZK6 A;  2D9F A;  3WD0 A;  2XPA A;  4URI A;  4N19 A;  4TW7 A;  1X6L A;  1EIB A;  2KFW A;  4QT2 A;  3FY1 A;  2KGJ A;  4LAV A;  2M08 A;  2XPB A;  1EHN A;  1GUV A;  2XP6 A;  3CHE A;  1NWT A;  1E6P A;  1ZU8 A;  3TCZ A;  1H0I A;  2MLX A;  3MDY B;  4LAX A;  4DRO A;  2Q5A A;  1W1P A;  3WD4 A;  1NSG A;  3O5M A;  1NWS A;  2KR7 A;  3CHC A;  2PV2 A;  4J4O A;  4IPX A;  4J4N A;  5D75 A;  3UQB A;  3I6C A;  4JYS A;  4TNS A;  3WQW A;  2PPO A;  3RM8 A;  3TC5 A;  1IX5 A;  4FN2 A;  2LGO A;  1D7J A;  3QOK A;  3WKZ A;  4BF8 A;  3AS2 A;  4DRN A;  4G50 A;  1XHG A;  3B9E A;  1FKI A;  3O5J A;  2FDM A;  1W1V A;  4ZS6 A;  3OOB A;  4DT4 A;  1OGG A;  4O2T A;  3CHD A;  4DIP A;  2WLZ A;  4HAR A;  5J6E A;  4DH0 A;  2DG4 A;  3CGM A;  4P8X A;  5GPR A;  1W9U A;  2DSW A;  1HJX A;  4NNR A;  4L3N A;  5BXJ A;  4JFI A;  2MF9 A;  2MLZ A;  1ZBK A;  1HXV A;  3KAD A;  1JVW A;  1E15 A;  3FXY A;  1CTN A;  1QPL A;  1FAP A;  1FKR A;  1W1T A;  4JFM A;  4U85 A;  3B7X A;  1D7I A;  3O5Q A;  3IKD A;  4MNJ A;  3RGC A;  1FKL A;  3JYM A;  3JYJ A;  2RUC A;  5DF0 A;  1SR0 A;  2ITK A;  4WK9 A;  3NI6 A;  4JFJ A;  2DG9 A;  4DRM A;  1U79 A;  1A7X A;  2IUZ A;  4WKF A;  2ZQT A;  4ODR A;  2YBT A;  1ZBV A;  4W9P A;  4DRI A;  3JXV A;  2M1I A;  1FKB A;  3IHZ A;  1FKF A;  1NMW A;  3CZ8 A;  1L1P A;  4QZV B;  1J4H A;  2PBC A;  4MPK A;  5HTG A;  1ZL1 A;  3B9D A;  1W26 A;  1J4I A;  4Z2I A;  2FAP A;  2WM0 A;  4U84 A;  2QF8 A;  2DG3 A;  4IT4 A;  4GIV A;  5DEZ A;  3PRB A;  1HKI A;  3KAB A;  3RM9 A;  3B9A A;  3W4R A;  3WD3 A;  5HWB A;  4GGQ A;  1UR8 A;  1FD9 A;  4S3K A;  4ODK A;  4TW8 A;  2L2S A;  4DWS D;  1ZBW A;  4PTM A;  2MPH A;  1ROT A;  4DRH A;  2LPV A;  2DSZ A;  2KO7 A;  4ODM A;  2OLH A;  2KI3 A;  2N87 A;  1D7H A;  1E6Z A;  2KE0 A;  2M2A A;  1P5Q A;  3UQI A;  3O5I A;  2DPE A;  1QZ2 A;  5HUA A;  5HT1 A;  3KZ7 A;  1E6N A;  3B8S A;  1F40 A;  3O5D A;  1LL7 A;  4NSB A;  4MNK A;  1UR9 A;  4MAV A;  4HBO A;  4QIB A;  1TFV A;  3IK8 A;  1LG2 A;  3KAI A;  3KCE A;  4ODN A;  2AOS A;  2AWG A;  1FFR A;  1LL4 A;  1ZB5 A;  1K9T A;  2RUQ A;  3ARQ A;  4Q7N A;  1LQ0 A;  2WK2 A;  5HW6 A;  2K8I A;  2ZQU A;  4W9O A;  1KT0 A;  4MTV A;  3PA7 A;  1KFW A;  1ZBC A;  3WL0 A;  4IQC A;  4KR0 B;  1GOI A;  2F4E A;  5HW8 A;  4TW6 A;  4S3J A;  4ZPW R;  3O5R A;  1FKG A;  2IF4 A;  3ALG A;  4WKA A;  3RME A;  1FKT A;  4ZPT R;  3UI5 A;  1NWU A;  3ARR A;  3KAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...