2LKNA

Solution structure of the ppiase domain of human aryl-hydrocarbon receptor-interacting protein (aip)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
ADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The FKBP-Type Domain of the Human Aryl Hydrocarbon Receptor-Interacting Protein Reveals an Unusual Hsp90 Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords AH receptor-interacting protein
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lknA00
4W9QA 1YW5A 1QZ2A 2PV1A 4ODKA 4G2PA 3CGMA 2RSEA 4QT3A 1L1PA 1U79A 3KZ7A 2M1IA 3I6CA 5HWBA 1FKSA 2XP3A 4ODQA 1QPFA 2K8IA 1R9HA 2M08A 1M5YA 1BKFA 3TCZA 3KAGA 1ZCNA 2ZQTA 2XP6A 5BXJA 2MNTA 1EQ3A 2ZQSA 1N1AA 1J4IA 4DRJA 4C02B 1NMWA 3EY6A 4ODNA 5DITA 2FAPA 2ZQVA 2JZVA 3IKGA 4FN2A 1Q6UA 4ODOA 2F4EA 1ROUA 1YATA 4U84A 2MLYA 1J6YA 4LAYA 1FAPA 3ODKA 2LGOA 1FKTA 3KAHA 4JFIA 4FAPA 4IQ2A 3IK8A 2KFWA 4DRIA 2ZR4A 2PPOA 2PPNA 2RUQA 4U85A 2PV3A 5HWCA 4QIBA 1D7HA 1FKHA 1ZK6A 5HW8A 3O5FA 5GPGA 4DRKA 4MGVA 4DZ3A 1NMVA 1TCOC 1FKIA 1W26A 2MF9A 1A7XA 3O5KA 5HT1A 4DROA 3O5QA 3UQBA 4IPXA 1JNSA 4LAWA 1FD9A 1JVWA 3UF8A 1P5QA 1J4HA 1EYMA 2F21A 2XP9A 3RFWA 2DG3A 1FKKA 1BL4A 3NRKA 4TX0A 5HW7A 2F2DA 4ODMA 2RUDA 2DG9A 4ODPA 1J4RA 2PBCA 3KAFA 3RGCA 3O5EA 1KT0A 2UZ5A 1PINA 2L2SA 2LPVA 4JFMA 3VAWA 1D7JA 1C9HA 5HKGA 5DIUA 1QPLA 2D9FA 3LUOA 2PV2A 4NNRA 2XP7A 1FKFA 2KO7A 4DRQA 1HXVA 1FKDA 3PA7A 1F8AB 3IHZA 3H9RB 3UQIA 2VN1A 3PRBA 4J4OA 2Y78A 2Q5AA 3GPKA 4DRHA 3KAIA 3KCEA 3O5IA 3IKDA 2IF4A 4IQCA 3MDYB 4TW6A 3WH0A 4TW8A 3UI5A 4DRPA 4ITZA 4ODLA 3UI4A 5HUAA 1T11A 2MLXA 3FAPA 3TC5A 5HW6A 1FJDA 3KABA 4G50A 4JFLA 4DZ2A 1ROTA 4GGQA 5B8IC 1FKJA 2KR7A 3O5MA 2RURA 3NTPA 4JYSA 3B7XA 2AWGA 2FKEA 2ZQUA 3CGNA 3O5PA 4GIVA 5DIVA 5J6EA 3OOBA 2KGJA 1FKRA 4QT2A 2ZR5A 2DG4A 2KI3A 2MLZA 2XPAA 3KACA 5D75A 1FKGA 1Q1CA 1NSGA 4BF8A 2PPPA 1FKLA 2XP8A 4LAVA 2RUCA 3NI6A 4LAXA 3JYJA 4W9OA 4DIPA 2ZR6A 3KADA 3UI6A 4W9PA 3O5DA 2LJ4A 1Y0OA 2MPHA 4N19A 2VCDA 4O2TA 2ITKA 1D6OA 2XPBA 5I98A 3JYMA 3JXVA 3O5OA 1PBKA 2LKNA 4DH0A 2KE0A 2N87A 2M2AA 3PRDA 3O5LA 1D7IA 4J4NA 3O5GA 4TYOA 3TDBA 3UQAA 3O5JA 4JFKA 1B6CA 2XP4A 1F40A 4R0XA 4ODRA 2RQSA 1FKBA 4DT4A 4JFJA 4DRNA 1JNTA 4TW7A 1Q6HA 1KT1A 3O5RA 4U86A 2XP5A 2OFNA 4TNSA 1Q6IA 4DRMA 4MSPA 5HTGA
chains in the Genus database with same CATH superfamily
4QT3A 1QZ2A 3CGMA 2RSEA 1VF8A 1L1PA 3KZ7A 3GTYX 2M1IA 4ODQA 2K8IA 1R9HA 2M08A 4MPKA 2MNTA 1EQ3A 1HJWA 2ZQSA 3G6MA 3ARWA 1NMWA 3EY6A 1CTNA 2JZVA 3IKGA 1W1VA 4URIA 2WLYA 1YATA 1LL7A 2P4VA 3CHCA 1FAPA 2PN0A 2LGOA 4FAPA 1NWTA 4QIBA 4DWSA 3PR9A 4WIWA 1TCOC 1FKIA 3O5KA 1A7XA 1HKJA 3O5QA 1JNSA 1P5QA 2DG3A 4MNMA 2DG9A 3CHDA 4ODPA 1KT0A 2L2SA 1SR0A 5DIUA 1QPLA 3LUOA 2PV2A 2DPEA 1F8AB 3H9RB 1ZL1A 4J4OA 2Q5AA 3O5IA 1WNOA 3CZ8A 3MDYB 3WH0A 3WIJA 2DT1A 1LQ0A 3EIPA 4ITZA 4Q22A 5HW6A 4G50A 1ROTA 4GGQA 5B8IC 1FKJA 2DT3A 1XHGA 4WKHA 1X6LA 1EDQA 3O5PA 5DO2A 3ARSA 2KGJA 2MLZA 2XPAA 4HARA 1FKGA 3B9EA 1NSGA 2PPPA 1LG1A 1ZBVA 4LAXA 4AY1A 4PTMA 1HJVA 1PBKA 2LKNA 3AQUA 3ARTA 4Q7NA 1FKBA 4TW7A 3RM8A 1Q6HA 1KT1A 3WQWA 2ETNA 2PV1A 4G2PA 1U79A 5HWBA 1QPFA 1M5YA 3RMEA 3TCZA 1W9VA 1ZCNA 3KAGA 3FY1A 1D2KA 4DRJA 4C02B 1E44A 1LG2A 2ZQVA 4W5UA 2DSZA 4FN2A 1Q6UA 3BXWA 2F4EA 5HBFA 3AS2A 3WD3A 1JCHB 1HKIA 1JNDA 1WAWA 4Z2KA 3PRAA 3KAHA 4Z2IA 3IK8A 3WD2A 2PPOA 2RUQA 5I98A 4U85A 2PV3A 3O5FA 5GPGA 2MF9A 4DROA 4IT6A 4NSBA 3WL1A 1FD9A 3WKZA 3WL0A 2F21A 1SYTA 5GQBA 1HJXA 4L72B 4ODMA 4P8XA 3RGCA 2LPVA 4P8VA 1W1TA 1C9HA 3CH9A 2D9FA 1FKFA 1FKDA 2A3EA 2VN1A 3PRBA 2Y78A 2ESCA 1OWQA 3IKDA 4TW6A 4TW8A 4DRPA 4WKAA 1LL4A 5HUAA 2MLXA 3TC5A 4MNJA 2YBTA 4WK9A 1H0GA 1ZBWA 2RURA 3NTPA 2A3BA 3AS1A 2G41A 2AWGA 4GIVA 5DIVA 2O92A 4QT2A 3CHFA 3B9AA 2XP8A 2RUCA 2B5UB 4WJXA 2QF8A 3KADA 3UI6A 3O5DA 1Y0OA 2VCDA 2XPBA 3JYMA 3JXVA 1TFVA 2OLHA 2KE0A 2N87A 3PRDA 3O5LA 3TDBA 3UQAA 3O5JA 1F40A 1B6CA 1H0IA 4ODRA 1JNTA 1NWUA 4ZS6A 5HTGA 4W9QA 1FFQA 4NZCA 1FKSA 2XP3A 2ZQTA 2XP6A 5BXJA 4ZPVR 1ZB5A 2FAPA 4ML4A 4ODOA 1GUVA 1E6RA 3WD0A 4Z2GA 1J6YA 1XRVA 4LAYA 1E6ZA 3ODKA 1O6IA 2DT2A 4ZPTR 4IQ2A 4DRIA 2DSVA 1D7HA 1FKHA 1GPFA 4DRKA 2DSWA 1X6NA 1NMVA 3UQBA 4DWSC 1JVWA 3UF8A 1EYMA 1WB0A 1EHNA 1FKKA 3ARYA 4P8UA 2WK2A 5HW7A 3WD4A 4Z2JA 2RUDA 2PBCA 3KAFA 3O5EA 1W9UA 3AS0A 1W9PA 3VAWA 1GRJA 3QOKA 2A3CA 2XP7A 2KO7A 4DRQA 3PA7A 5JH8A 1K9TA 4DRHA 2IF4A 2PI6A 3OA5A 3UI5A 1FJDA 3ARXA 3KABA 4DZ2A 1ZBKA 2B31A 1ITXA 2KR7A 4S3JA 3O5MA 4MNKA 2ZQUA 2FKEA 3CGNA 4ZPWR 3OOBA 3W4RA 4KQZA 1JNEA 1FKRA 2KI3A 2DT0A 1ZU8A 1W1PA 1Q1CA 4BF8A 4LAVA 3RM4A 4DWSD 3WD1A 4W9PA 4N19A 2ITKA 1D6OA 5DEZA 3AS3A 4DH0A 3AROA 2M2AA 3O5GA 4LGXA 2XP4A 3ALGA 2RQSA 4DT4A 4JFJA 4DRNA 4S3KA 2A3AA 4L3NA 3O5RA 2XP5A 3GU0A 4TNSA 1UR9A 2O9OA 3ALFA 1W1YA 1YW5A 4ODKA 2IUZA 3I6CA 5DF0A 4DWSB 1BKFA 4Z2LA 3ARZA 1OGBA 1LJYA 1N1AA 1J4IA 4ODNA 5DITA 2WM0A 1ROUA 4U84A 2MLYA 1FFRA 4JFIA 1FKTA 1E6PA 4XAKA 2KFWA 2ZR4A 2PPNA 1HKKA 2F23A 4UDMA 5HW8A 5HWCA 1ZK6A 4MGVA 4DZ3A 1IX5A 1RD6A 1W26A 3ARVA 5HT1A 3B9DA 1E9LA 4IPXA 4LAWA 2YBUA 1J4HA 2XP9A 3RFWA 1UR8A 1LL6A 1BL4A 3NRKA 4MNLA 3ARRA 3CHEA 4R5EA 4TX0A 2F2DA 3RM9A 1J4RA 2UZ5A 1PINA 2AOSA 2G8ZA 4JFMA 3ARQA 1D7JA 5HKGA 1NH6A 4NNRA 1ZBCA 1HXVA 3IHZA 2WLZA 4HBEA 4Z2HA 3UQIA 3G6LA 3GPKA 3KAIA 3KCEA 1OGGA 4IQCA 3ARPA 4ODLA 3UI4A 1T11A 3FAPA 4MTVA 4JFLA 2DSUA 1HKMA 4JYSA 4MAVA 3B7XA 4KR0B 1NWRA 5J6EA 5GPRA 2EULA 2ZR5A 2DG4A 4HBOA 3KACA 4IT4A 5D75A 1EIBA 1FKLA 3NI6A 4QZVB 3JYJA 4W9OA 4DIPA 1NWSA 2ZR6A 4WKFA 3WQVA 2LJ4A 2MPHA 3FXYA 1KFWA 3ARUA 4O2TA 4P8WA 1GOIA 3BMBA 3O5OA 1D7IA 1E15A 4J4NA 4TYOA 4JFKA 4R0XA 4U86A 2OFNA 4DRMA 1Q6IA 1E6NA 2FDMA 4MSPA 3B8SA
chains in the Genus database with same CATH topology
4QT3A 1QZ2A 3CGMA 2RSEA 1VF8A 1L1PA 3KZ7A 2M1IA 4ODQA 2K8IA 1R9HA 2M08A 4MPKA 2MNTA 1EQ3A 1HJWA 2ZQSA 3G6MA 3ARWA 1NMWA 3EY6A 1CTNA 2JZVA 3IKGA 1W1VA 4URIA 2WLYA 1YATA 1LL7A 3CHCA 1FAPA 2LGOA 4FAPA 1NWTA 4QIBA 4DWSA 3PR9A 4WIWA 1TCOC 1FKIA 3O5KA 1A7XA 1HKJA 3O5QA 1JNSA 1P5QA 2DG3A 4MNMA 2DG9A 3CHDA 4ODPA 1KT0A 2L2SA 1SR0A 5DIUA 1QPLA 3LUOA 2PV2A 2DPEA 1F8AB 3H9RB 1ZL1A 4J4OA 2Q5AA 3O5IA 1WNOA 3CZ8A 3MDYB 3WH0A 3WIJA 2DT1A 1LQ0A 4ITZA 4Q22A 5HW6A 4G50A 1ROTA 4GGQA 5B8IC 1FKJA 2DT3A 1XHGA 4WKHA 1X6LA 1EDQA 3O5PA 5DO2A 3ARSA 2KGJA 2MLZA 2XPAA 4HARA 1FKGA 3B9EA 1NSGA 2PPPA 1LG1A 1ZBVA 4LAXA 4AY1A 4PTMA 1HJVA 1PBKA 2LKNA 3AQUA 3ARTA 4Q7NA 1FKBA 4TW7A 3RM8A 1Q6HA 1KT1A 3WQWA 2PV1A 4G2PA 1U79A 5HWBA 1QPFA 1M5YA 3RMEA 3TCZA 1W9VA 1ZCNA 3KAGA 3FY1A 1D2KA 4DRJA 4C02B 4W5UA 1LG2A 2ZQVA 2DSZA 4FN2A 1Q6UA 3BXWA 2F4EA 5HBFA 3AS2A 3WD3A 1HKIA 1JNDA 1WAWA 4Z2KA 3PRAA 3KAHA 4Z2IA 3IK8A 3WD2A 2PPOA 2RUQA 5I98A 4U85A 2PV3A 3O5FA 5GPGA 2MF9A 4DROA 4IT6A 4NSBA 3WL1A 1FD9A 3WKZA 3WL0A 2F21A 1SYTA 5GQBA 1HJXA 4L72B 4ODMA 4P8XA 3RGCA 2LPVA 4P8VA 1W1TA 1C9HA 3CH9A 2D9FA 1FKFA 1FKDA 2A3EA 2VN1A 3PRBA 2Y78A 2ESCA 1OWQA 3IKDA 4TW6A 4TW8A 4DRPA 4WKAA 1LL4A 5HUAA 2MLXA 3TC5A 4MNJA 2YBTA 4WK9A 1H0GA 1ZBWA 2RURA 3NTPA 2A3BA 3AS1A 2G41A 2AWGA 4GIVA 5DIVA 2O92A 4QT2A 3CHFA 3B9AA 2XP8A 2RUCA 4WJXA 2QF8A 3KADA 3UI6A 3O5DA 1Y0OA 2VCDA 2XPBA 3JYMA 3JXVA 1TFVA 2OLHA 2KE0A 2N87A 3PRDA 3O5LA 3TDBA 3UQAA 3O5JA 1F40A 1B6CA 1H0IA 4ODRA 1JNTA 1NWUA 4ZS6A 5HTGA 4W9QA 1FFQA 4NZCA 1FKSA 2XP3A 2ZQTA 2XP6A 5BXJA 4ZPVR 1ZB5A 2FAPA 4ML4A 4ODOA 1GUVA 1E6RA 3WD0A 4Z2GA 1J6YA 1XRVA 4LAYA 1E6ZA 3ODKA 1O6IA 2DT2A 4ZPTR 4IQ2A 4DRIA 2DSVA 1D7HA 1FKHA 1GPFA 4DRKA 2DSWA 1X6NA 1NMVA 3UQBA 4DWSC 1JVWA 3UF8A 1EYMA 1WB0A 1EHNA 1FKKA 3ARYA 4P8UA 2WK2A 5HW7A 3WD4A 4Z2JA 2RUDA 2PBCA 3KAFA 3O5EA 1W9UA 3AS0A 1W9PA 3VAWA 3QOKA 2A3CA 2XP7A 2KO7A 4DRQA 3PA7A 5JH8A 1K9TA 4DRHA 2IF4A 2PI6A 3OA5A 3UI5A 1FJDA 3ARXA 3KABA 4DZ2A 1ZBKA 2B31A 1ITXA 2KR7A 4S3JA 3O5MA 4MNKA 2ZQUA 2FKEA 3CGNA 4ZPWR 3OOBA 3W4RA 4KQZA 1JNEA 1FKRA 2KI3A 2DT0A 1ZU8A 1W1PA 1Q1CA 4BF8A 4LAVA 3RM4A 4DWSD 3WD1A 4W9PA 4N19A 2ITKA 1D6OA 5DEZA 3AS3A 4DH0A 3AROA 2M2AA 3O5GA 4LGXA 2XP4A 3ALGA 2RQSA 4DT4A 4JFJA 4DRNA 4S3KA 2A3AA 4L3NA 3O5RA 2XP5A 4TNSA 1UR9A 2O9OA 3ALFA 1W1YA 1YW5A 4ODKA 2IUZA 3I6CA 5DF0A 4DWSB 1BKFA 4Z2LA 3ARZA 1OGBA 1LJYA 1N1AA 1J4IA 4ODNA 5DITA 2WM0A 1ROUA 4U84A 2MLYA 1FFRA 4JFIA 1FKTA 1E6PA 4XAKA 2KFWA 2ZR4A 2PPNA 1HKKA 5HWCA 5HW8A 1ZK6A 4MGVA 4DZ3A 1IX5A 1RD6A 1W26A 3ARVA 5HT1A 3B9DA 1E9LA 4IPXA 4LAWA 2YBUA 1J4HA 2XP9A 3RFWA 1UR8A 1LL6A 1BL4A 3NRKA 4MNLA 3ARRA 3CHEA 4R5EA 4TX0A 2F2DA 3RM9A 1J4RA 2UZ5A 1PINA 2AOSA 2G8ZA 4JFMA 3ARQA 1D7JA 5HKGA 1NH6A 4NNRA 1ZBCA 1HXVA 3IHZA 2WLZA 4HBEA 4Z2HA 3UQIA 3G6LA 3GPKA 3KAIA 3KCEA 4IQCA 1OGGA 3ARPA 4ODLA 3UI4A 1T11A 3FAPA 4MTVA 4JFLA 2DSUA 1HKMA 4JYSA 4MAVA 3B7XA 4KR0B 1NWRA 5J6EA 5GPRA 2ZR5A 2DG4A 4HBOA 3KACA 4IT4A 5D75A 1EIBA 1FKLA 3NI6A 4QZVB 3JYJA 4W9OA 4DIPA 1NWSA 2ZR6A 4WKFA 3WQVA 2LJ4A 2MPHA 3FXYA 1KFWA 3ARUA 4O2TA 4P8WA 1GOIA 3O5OA 1D7IA 1E15A 4J4NA 4TYOA 4JFKA 4R0XA 4U86A 2OFNA 4DRMA 1Q6IA 1E6NA 2FDMA 4MSPA 3B8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  1YW5 A;  1QZ2 A;  2PV1 A;  4ODK A;  4G2P A;  3CGM A;  2RSE A;  4QT3 A;  1L1P A;  1U79 A;  3KZ7 A;  2M1I A;  3I6C A;  5HWB A;  1FKS A;  2XP3 A;  4ODQ A;  1QPF A;  2K8I A;  1R9H A;  2M08 A;  1M5Y A;  1BKF A;  3TCZ A;  3KAG A;  1ZCN A;  2ZQT A;  2XP6 A;  5BXJ A;  2MNT A;  1EQ3 A;  2ZQS A;  1N1A A;  1J4I A;  4DRJ A;  4C02 B;  1NMW A;  3EY6 A;  4ODN A;  5DIT A;  2FAP A;  2ZQV A;  2JZV A;  3IKG A;  4FN2 A;  1Q6U A;  4ODO A;  2F4E A;  1ROU A;  1YAT A;  4U84 A;  2MLY A;  1J6Y A;  4LAY A;  1FAP A;  3ODK A;  2LGO A;  1FKT A;  3KAH A;  4JFI A;  4FAP A;  4IQ2 A;  3IK8 A;  2KFW A;  4DRI A;  2ZR4 A;  2PPO A;  2PPN A;  2RUQ A;  4U85 A;  2PV3 A;  5HWC A;  4QIB A;  1D7H A;  1FKH A;  1ZK6 A;  5HW8 A;  3O5F A;  5GPG A;  4DRK A;  4MGV A;  4DZ3 A;  1NMV A;  1TCO C;  1FKI A;  1W26 A;  2MF9 A;  1A7X A;  3O5K A;  5HT1 A;  4DRO A;  3O5Q A;  3UQB A;  4IPX A;  1JNS A;  4LAW A;  1FD9 A;  1JVW A;  3UF8 A;  1P5Q A;  1J4H A;  1EYM A;  2F21 A;  2XP9 A;  3RFW A;  2DG3 A;  1FKK A;  1BL4 A;  3NRK A;  4TX0 A;  5HW7 A;  2F2D A;  4ODM A;  2RUD A;  2DG9 A;  4ODP A;  1J4R A;  2PBC A;  3KAF A;  3RGC A;  3O5E A;  1KT0 A;  2UZ5 A;  1PIN A;  2L2S A;  2LPV A;  4JFM A;  3VAW A;  1D7J A;  1C9H A;  5HKG A;  5DIU A;  1QPL A;  2D9F A;  3LUO A;  2PV2 A;  4NNR A;  2XP7 A;  1FKF A;  2KO7 A;  4DRQ A;  1HXV A;  1FKD A;  3PA7 A;  1F8A B;  3IHZ A;  3H9R B;  3UQI A;  2VN1 A;  3PRB A;  4J4O A;  2Y78 A;  2Q5A A;  3GPK A;  4DRH A;  3KAI A;  3KCE A;  3O5I A;  3IKD A;  2IF4 A;  4IQC A;  3MDY B;  4TW6 A;  3WH0 A;  4TW8 A;  3UI5 A;  4DRP A;  4ITZ A;  4ODL A;  3UI4 A;  5HUA A;  1T11 A;  2MLX A;  3FAP A;  3TC5 A;  5HW6 A;  1FJD A;  3KAB A;  4G50 A;  4JFL A;  4DZ2 A;  1ROT A;  4GGQ A;  5B8I C;  1FKJ A;  2KR7 A;  3O5M A;  2RUR A;  3NTP A;  4JYS A;  3B7X A;  2AWG A;  2FKE A;  2ZQU A;  3CGN A;  3O5P A;  4GIV A;  5DIV A;  5J6E A;  3OOB A;  2KGJ A;  1FKR A;  4QT2 A;  2ZR5 A;  2DG4 A;  2KI3 A;  2MLZ A;  2XPA A;  3KAC A;  5D75 A;  1FKG A;  1Q1C A;  1NSG A;  4BF8 A;  2PPP A;  1FKL A;  2XP8 A;  4LAV A;  2RUC A;  3NI6 A;  4LAX A;  3JYJ A;  4W9O A;  4DIP A;  2ZR6 A;  3KAD A;  3UI6 A;  4W9P A;  3O5D A;  2LJ4 A;  1Y0O A;  2MPH A;  4N19 A;  2VCD A;  4O2T A;  2ITK A;  1D6O A;  2XPB A;  5I98 A;  3JYM A;  3JXV A;  3O5O A;  1PBK A;  2LKN A;  4DH0 A;  2KE0 A;  2N87 A;  2M2A A;  3PRD A;  3O5L A;  1D7I A;  4J4N A;  3O5G A;  4TYO A;  3TDB A;  3UQA A;  3O5J A;  4JFK A;  1B6C A;  2XP4 A;  1F40 A;  4R0X A;  4ODR A;  2RQS A;  1FKB A;  4DT4 A;  4JFJ A;  4DRN A;  1JNT A;  4TW7 A;  1Q6H A;  1KT1 A;  3O5R A;  4U86 A;  2XP5 A;  2OFN A;  4TNS A;  1Q6I A;  4DRM A;  4MSP A;  5HTG A; 
#chains in the Genus database with same CATH topology
 4QT3 A;  1QZ2 A;  3CGM A;  2RSE A;  1VF8 A;  1L1P A;  3KZ7 A;  3GTY X;  2M1I A;  4ODQ A;  2K8I A;  1R9H A;  2M08 A;  4MPK A;  2MNT A;  1EQ3 A;  1HJW A;  2ZQS A;  3G6M A;  3ARW A;  1NMW A;  3EY6 A;  1CTN A;  2JZV A;  3IKG A;  1W1V A;  4URI A;  2WLY A;  1YAT A;  1LL7 A;  2P4V A;  3CHC A;  1FAP A;  2PN0 A;  2LGO A;  4FAP A;  1NWT A;  4QIB A;  4DWS A;  3PR9 A;  4WIW A;  1TCO C;  1FKI A;  3O5K A;  1A7X A;  1HKJ A;  3O5Q A;  1JNS A;  1P5Q A;  2DG3 A;  4MNM A;  2DG9 A;  3CHD A;  4ODP A;  1KT0 A;  2L2S A;  1SR0 A;  5DIU A;  1QPL A;  3LUO A;  2PV2 A;  2DPE A;  1F8A B;  3H9R B;  1ZL1 A;  4J4O A;  2Q5A A;  3O5I A;  1WNO A;  3CZ8 A;  3MDY B;  3WH0 A;  3WIJ A;  2DT1 A;  1LQ0 A;  3EIP A;  4ITZ A;  4Q22 A;  5HW6 A;  4G50 A;  1ROT A;  4GGQ A;  5B8I C;  1FKJ A;  2DT3 A;  1XHG A;  4WKH A;  1X6L A;  1EDQ A;  3O5P A;  5DO2 A;  3ARS A;  2KGJ A;  2MLZ A;  2XPA A;  4HAR A;  1FKG A;  3B9E A;  1NSG A;  2PPP A;  1LG1 A;  1ZBV A;  4LAX A;  4AY1 A;  4PTM A;  1HJV A;  1PBK A;  2LKN A;  3AQU A;  3ART A;  4Q7N A;  1FKB A;  4TW7 A;  3RM8 A;  1Q6H A;  1KT1 A;  3WQW A;  2ETN A;  2PV1 A;  4G2P A;  1U79 A;  5HWB A;  1QPF A;  1M5Y A;  3RME A;  3TCZ A;  1W9V A;  1ZCN A;  3KAG A;  3FY1 A;  1D2K A;  4DRJ A;  4C02 B;  1E44 A;  1LG2 A;  2ZQV A;  4W5U A;  2DSZ A;  4FN2 A;  1Q6U A;  3BXW A;  2F4E A;  5HBF A;  3AS2 A;  3WD3 A;  1JCH B;  1HKI A;  1JND A;  1WAW A;  4Z2K A;  3PRA A;  3KAH A;  4Z2I A;  3IK8 A;  3WD2 A;  2PPO A;  2RUQ A;  5I98 A;  4U85 A;  2PV3 A;  3O5F A;  5GPG A;  2MF9 A;  4DRO A;  4IT6 A;  4NSB A;  3WL1 A;  1FD9 A;  3WKZ A;  3WL0 A;  2F21 A;  1SYT A;  5GQB A;  1HJX A;  4L72 B;  4ODM A;  4P8X A;  3RGC A;  2LPV A;  4P8V A;  1W1T A;  1C9H A;  3CH9 A;  2D9F A;  1FKF A;  1FKD A;  2A3E A;  2VN1 A;  3PRB A;  2Y78 A;  2ESC A;  1OWQ A;  3IKD A;  4TW6 A;  4TW8 A;  4DRP A;  4WKA A;  1LL4 A;  5HUA A;  2MLX A;  3TC5 A;  4MNJ A;  2YBT A;  4WK9 A;  1H0G A;  1ZBW A;  2RUR A;  3NTP A;  2A3B A;  3AS1 A;  2G41 A;  2AWG A;  4GIV A;  5DIV A;  2O92 A;  4QT2 A;  3CHF A;  3B9A A;  2XP8 A;  2RUC A;  2B5U B;  4WJX A;  2QF8 A;  3KAD A;  3UI6 A;  3O5D A;  1Y0O A;  2VCD A;  2XPB A;  3JYM A;  3JXV A;  1TFV A;  2OLH A;  2KE0 A;  2N87 A;  3PRD A;  3O5L A;  3TDB A;  3UQA A;  3O5J A;  1F40 A;  1B6C A;  1H0I A;  4ODR A;  1JNT A;  1NWU A;  4ZS6 A;  5HTG A;  4W9Q A;  1FFQ A;  4NZC A;  1FKS A;  2XP3 A;  2ZQT A;  2XP6 A;  5BXJ A;  4ZPV R;  1ZB5 A;  2FAP A;  4ML4 A;  4ODO A;  1GUV A;  1E6R A;  3WD0 A;  4Z2G A;  1J6Y A;  1XRV A;  4LAY A;  1E6Z A;  3ODK A;  1O6I A;  2DT2 A;  4ZPT R;  4IQ2 A;  4DRI A;  2DSV A;  1D7H A;  1FKH A;  1GPF A;  4DRK A;  2DSW A;  1X6N A;  1NMV A;  3UQB A;  4DWS C;  1JVW A;  3UF8 A;  1EYM A;  1WB0 A;  1EHN A;  1FKK A;  3ARY A;  4P8U A;  2WK2 A;  5HW7 A;  3WD4 A;  4Z2J A;  2RUD A;  2PBC A;  3KAF A;  3O5E A;  1W9U A;  3AS0 A;  1W9P A;  3VAW A;  1GRJ A;  3QOK A;  2A3C A;  2XP7 A;  2KO7 A;  4DRQ A;  3PA7 A;  5JH8 A;  1K9T A;  4DRH A;  2IF4 A;  2PI6 A;  3OA5 A;  3UI5 A;  1FJD A;  3ARX A;  3KAB A;  4DZ2 A;  1ZBK A;  2B31 A;  1ITX A;  2KR7 A;  4S3J A;  3O5M A;  4MNK A;  2ZQU A;  2FKE A;  3CGN A;  4ZPW R;  3OOB A;  3W4R A;  4KQZ A;  1JNE A;  1FKR A;  2KI3 A;  2DT0 A;  1ZU8 A;  1W1P A;  1Q1C A;  4BF8 A;  4LAV A;  3RM4 A;  4DWS D;  3WD1 A;  4W9P A;  4N19 A;  2ITK A;  1D6O A;  5DEZ A;  3AS3 A;  4DH0 A;  3ARO A;  2M2A A;  3O5G A;  4LGX A;  2XP4 A;  3ALG A;  2RQS A;  4DT4 A;  4JFJ A;  4DRN A;  4S3K A;  2A3A A;  4L3N A;  3O5R A;  2XP5 A;  3GU0 A;  4TNS A;  1UR9 A;  2O9O A;  3ALF A;  1W1Y A;  1YW5 A;  4ODK A;  2IUZ A;  3I6C A;  5DF0 A;  4DWS B;  1BKF A;  4Z2L A;  3ARZ A;  1OGB A;  1LJY A;  1N1A A;  1J4I A;  4ODN A;  5DIT A;  2WM0 A;  1ROU A;  4U84 A;  2MLY A;  1FFR A;  4JFI A;  1FKT A;  1E6P A;  4XAK A;  2KFW A;  2ZR4 A;  2PPN A;  1HKK A;  2F23 A;  4UDM A;  5HW8 A;  5HWC A;  1ZK6 A;  4MGV A;  4DZ3 A;  1IX5 A;  1RD6 A;  1W26 A;  3ARV A;  5HT1 A;  3B9D A;  1E9L A;  4IPX A;  4LAW A;  2YBU A;  1J4H A;  2XP9 A;  3RFW A;  1UR8 A;  1LL6 A;  1BL4 A;  3NRK A;  4MNL A;  3ARR A;  3CHE A;  4R5E A;  4TX0 A;  2F2D A;  3RM9 A;  1J4R A;  2UZ5 A;  1PIN A;  2AOS A;  2G8Z A;  4JFM A;  3ARQ A;  1D7J A;  5HKG A;  1NH6 A;  4NNR A;  1ZBC A;  1HXV A;  3IHZ A;  2WLZ A;  4HBE A;  4Z2H A;  3UQI A;  3G6L A;  3GPK A;  3KAI A;  3KCE A;  1OGG A;  4IQC A;  3ARP A;  4ODL A;  3UI4 A;  1T11 A;  3FAP A;  4MTV A;  4JFL A;  2DSU A;  1HKM A;  4JYS A;  4MAV A;  3B7X A;  4KR0 B;  1NWR A;  5J6E A;  5GPR A;  2EUL A;  2ZR5 A;  2DG4 A;  4HBO A;  3KAC A;  4IT4 A;  5D75 A;  1EIB A;  1FKL A;  3NI6 A;  4QZV B;  3JYJ A;  4W9O A;  4DIP A;  1NWS A;  2ZR6 A;  4WKF A;  3WQV A;  2LJ4 A;  2MPH A;  3FXY A;  1KFW A;  3ARU A;  4O2T A;  4P8W A;  1GOI A;  3BMB A;  3O5O A;  1D7I A;  1E15 A;  4J4N A;  4TYO A;  4JFK A;  4R0X A;  4U86 A;  2OFN A;  4DRM A;  1Q6I A;  1E6N A;  2FDM A;  4MSP A;  3B8S A; 
#chains in the Genus database with same CATH homology
 4QT3 A;  1QZ2 A;  3CGM A;  2RSE A;  1VF8 A;  1L1P A;  3KZ7 A;  2M1I A;  4ODQ A;  2K8I A;  1R9H A;  2M08 A;  4MPK A;  2MNT A;  1EQ3 A;  1HJW A;  2ZQS A;  3G6M A;  3ARW A;  1NMW A;  3EY6 A;  1CTN A;  2JZV A;  3IKG A;  1W1V A;  4URI A;  2WLY A;  1YAT A;  1LL7 A;  3CHC A;  1FAP A;  2LGO A;  4FAP A;  1NWT A;  4QIB A;  4DWS A;  3PR9 A;  4WIW A;  1TCO C;  1FKI A;  3O5K A;  1A7X A;  1HKJ A;  3O5Q A;  1JNS A;  1P5Q A;  2DG3 A;  4MNM A;  2DG9 A;  3CHD A;  4ODP A;  1KT0 A;  2L2S A;  1SR0 A;  5DIU A;  1QPL A;  3LUO A;  2PV2 A;  2DPE A;  1F8A B;  3H9R B;  1ZL1 A;  4J4O A;  2Q5A A;  3O5I A;  1WNO A;  3CZ8 A;  3MDY B;  3WH0 A;  3WIJ A;  2DT1 A;  1LQ0 A;  4ITZ A;  4Q22 A;  5HW6 A;  4G50 A;  1ROT A;  4GGQ A;  5B8I C;  1FKJ A;  2DT3 A;  1XHG A;  4WKH A;  1X6L A;  1EDQ A;  3O5P A;  5DO2 A;  3ARS A;  2KGJ A;  2MLZ A;  2XPA A;  4HAR A;  1FKG A;  3B9E A;  1NSG A;  2PPP A;  1LG1 A;  1ZBV A;  4LAX A;  4AY1 A;  4PTM A;  1HJV A;  1PBK A;  2LKN A;  3AQU A;  3ART A;  4Q7N A;  1FKB A;  4TW7 A;  3RM8 A;  1Q6H A;  1KT1 A;  3WQW A;  2PV1 A;  4G2P A;  1U79 A;  5HWB A;  1QPF A;  1M5Y A;  3RME A;  3TCZ A;  1W9V A;  1ZCN A;  3KAG A;  3FY1 A;  1D2K A;  4DRJ A;  4C02 B;  4W5U A;  1LG2 A;  2ZQV A;  2DSZ A;  4FN2 A;  1Q6U A;  3BXW A;  2F4E A;  5HBF A;  3AS2 A;  3WD3 A;  1HKI A;  1JND A;  1WAW A;  4Z2K A;  3PRA A;  3KAH A;  4Z2I A;  3IK8 A;  3WD2 A;  2PPO A;  2RUQ A;  5I98 A;  4U85 A;  2PV3 A;  3O5F A;  5GPG A;  2MF9 A;  4DRO A;  4IT6 A;  4NSB A;  3WL1 A;  1FD9 A;  3WKZ A;  3WL0 A;  2F21 A;  1SYT A;  5GQB A;  1HJX A;  4L72 B;  4ODM A;  4P8X A;  3RGC A;  2LPV A;  4P8V A;  1W1T A;  1C9H A;  3CH9 A;  2D9F A;  1FKF A;  1FKD A;  2A3E A;  2VN1 A;  3PRB A;  2Y78 A;  2ESC A;  1OWQ A;  3IKD A;  4TW6 A;  4TW8 A;  4DRP A;  4WKA A;  1LL4 A;  5HUA A;  2MLX A;  3TC5 A;  4MNJ A;  2YBT A;  4WK9 A;  1H0G A;  1ZBW A;  2RUR A;  3NTP A;  2A3B A;  3AS1 A;  2G41 A;  2AWG A;  4GIV A;  5DIV A;  2O92 A;  4QT2 A;  3CHF A;  3B9A A;  2XP8 A;  2RUC A;  4WJX A;  2QF8 A;  3KAD A;  3UI6 A;  3O5D A;  1Y0O A;  2VCD A;  2XPB A;  3JYM A;  3JXV A;  1TFV A;  2OLH A;  2KE0 A;  2N87 A;  3PRD A;  3O5L A;  3TDB A;  3UQA A;  3O5J A;  1F40 A;  1B6C A;  1H0I A;  4ODR A;  1JNT A;  1NWU A;  4ZS6 A;  5HTG A;  4W9Q A;  1FFQ A;  4NZC A;  1FKS A;  2XP3 A;  2ZQT A;  2XP6 A;  5BXJ A;  4ZPV R;  1ZB5 A;  2FAP A;  4ML4 A;  4ODO A;  1GUV A;  1E6R A;  3WD0 A;  4Z2G A;  1J6Y A;  1XRV A;  4LAY A;  1E6Z A;  3ODK A;  1O6I A;  2DT2 A;  4ZPT R;  4IQ2 A;  4DRI A;  2DSV A;  1D7H A;  1FKH A;  1GPF A;  4DRK A;  2DSW A;  1X6N A;  1NMV A;  3UQB A;  4DWS C;  1JVW A;  3UF8 A;  1EYM A;  1WB0 A;  1EHN A;  1FKK A;  3ARY A;  4P8U A;  2WK2 A;  5HW7 A;  3WD4 A;  4Z2J A;  2RUD A;  2PBC A;  3KAF A;  3O5E A;  1W9U A;  3AS0 A;  1W9P A;  3VAW A;  3QOK A;  2A3C A;  2XP7 A;  2KO7 A;  4DRQ A;  3PA7 A;  5JH8 A;  1K9T A;  4DRH A;  2IF4 A;  2PI6 A;  3OA5 A;  3UI5 A;  1FJD A;  3ARX A;  3KAB A;  4DZ2 A;  1ZBK A;  2B31 A;  1ITX A;  2KR7 A;  4S3J A;  3O5M A;  4MNK A;  2ZQU A;  2FKE A;  3CGN A;  4ZPW R;  3OOB A;  3W4R A;  4KQZ A;  1JNE A;  1FKR A;  2KI3 A;  2DT0 A;  1ZU8 A;  1W1P A;  1Q1C A;  4BF8 A;  4LAV A;  3RM4 A;  4DWS D;  3WD1 A;  4W9P A;  4N19 A;  2ITK A;  1D6O A;  5DEZ A;  3AS3 A;  4DH0 A;  3ARO A;  2M2A A;  3O5G A;  4LGX A;  2XP4 A;  3ALG A;  2RQS A;  4DT4 A;  4JFJ A;  4DRN A;  4S3K A;  2A3A A;  4L3N A;  3O5R A;  2XP5 A;  4TNS A;  1UR9 A;  2O9O A;  3ALF A;  1W1Y A;  1YW5 A;  4ODK A;  2IUZ A;  3I6C A;  5DF0 A;  4DWS B;  1BKF A;  4Z2L A;  3ARZ A;  1OGB A;  1LJY A;  1N1A A;  1J4I A;  4ODN A;  5DIT A;  2WM0 A;  1ROU A;  4U84 A;  2MLY A;  1FFR A;  4JFI A;  1FKT A;  1E6P A;  4XAK A;  2KFW A;  2ZR4 A;  2PPN A;  1HKK A;  5HWC A;  5HW8 A;  1ZK6 A;  4MGV A;  4DZ3 A;  1IX5 A;  1RD6 A;  1W26 A;  3ARV A;  5HT1 A;  3B9D A;  1E9L A;  4IPX A;  4LAW A;  2YBU A;  1J4H A;  2XP9 A;  3RFW A;  1UR8 A;  1LL6 A;  1BL4 A;  3NRK A;  4MNL A;  3ARR A;  3CHE A;  4R5E A;  4TX0 A;  2F2D A;  3RM9 A;  1J4R A;  2UZ5 A;  1PIN A;  2AOS A;  2G8Z A;  4JFM A;  3ARQ A;  1D7J A;  5HKG A;  1NH6 A;  4NNR A;  1ZBC A;  1HXV A;  3IHZ A;  2WLZ A;  4HBE A;  4Z2H A;  3UQI A;  3G6L A;  3GPK A;  3KAI A;  3KCE A;  4IQC A;  1OGG A;  3ARP A;  4ODL A;  3UI4 A;  1T11 A;  3FAP A;  4MTV A;  4JFL A;  2DSU A;  1HKM A;  4JYS A;  4MAV A;  3B7X A;  4KR0 B;  1NWR A;  5J6E A;  5GPR A;  2ZR5 A;  2DG4 A;  4HBO A;  3KAC A;  4IT4 A;  5D75 A;  1EIB A;  1FKL A;  3NI6 A;  4QZV B;  3JYJ A;  4W9O A;  4DIP A;  1NWS A;  2ZR6 A;  4WKF A;  3WQV A;  2LJ4 A;  2MPH A;  3FXY A;  1KFW A;  3ARU A;  4O2T A;  4P8W A;  1GOI A;  3O5O A;  1D7I A;  1E15 A;  4J4N A;  4TYO A;  4JFK A;  4R0X A;  4U86 A;  2OFN A;  4DRM A;  1Q6I A;  1E6N A;  2FDM A;  4MSP A;  3B8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...