2LKUA

Solution structure of reduced poplar apo grxs14
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
MALTPALKTTLDKVVTSHKVVLFMKGTKDFPQCGFSQTVVQILKSLNAPFESVNILENELLRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQEQVEKAMCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GrxS14
publication title Solution structure of reduced poplar apo GrxS14
rcsb
source organism Populus trichocarpa
molecule tags Electron transport
total genus 32
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lkuA01
3LORA 4WXTA 3LEFA 5G31A 4I2TA 3K8NA 2FWHA 3APSA 4NAXA 4KNDA 3TRXA 1SL0B 1AAZA 2KHPA 1XOBA 4KW6A 1G7OA 3UIWA 2LNTA 5B6NA 4HU9A 5DCHA 4L0UA 1KNGA 1YEXA 3KM6A 4K7IA 3F6DA 6GSXA 2H73A 1SJIA 4EE0A 4J57E 4KH7A 4EF0A 1OC9A 5COHA 2YOIA 3VWXA 2DJJA 1ZGNA 5B8AA 4KGIA 2H0GA 3CRTA 4XRDA 3P7XA 3UBLA 1EP7A 1VF4A 1AQVA 4XS6A 1AQXA 1EGRA 5DQYA 3HVXA 1TW9A 4OD7A 3MNGA 1YKAA 4GSSA 4ML1A 1SJ6A 2KUCA 5LNKe 1RW1A 5IM9A 4O32A 2WGRA 3UMAA 4YAVA 2K18A 3QFAC 2GVPA 4HEA2 2LJKA 1ERTA 1BQ7A 3KH7A 1DUGA 3GX0A 4G10A 2M46A 4J2FA 2VL3A 3O3TA 3SBCA 3CTGA 2IWTA 4EC0A 2JZRA 5ECKB 1EEJA 4F82A 5J9BA 3M3MA 4KDXA 3M1GA 14GSA 3D22A 3Q19A 4HU7A 3RDWA 5D9VA 5ECNB 2FD3A 1AQWA 2FA8A 3EMPA 1Z9HA 2K6VA 3KMNA 4TN8A 3H1NA 5F06A 2GTUA 5JCUA 4WR4A 4KE3A 2LNSA 5IMVA 2ON5A 5ECQB 2IL3A 1G7EA 1Z7PA 1XOAA 3KGKA 1O8XA 2NPBA 1YDKA 3ERFA 3CSHA 5IPHA 2YWMA 5AIXA 6GSTA 3JCML 2WJUA 1XWGA 3A2WA 2L57A 3F3QA 5JWOB 3C1SA 1AIUA 1S3DA 4AJ6A 1XW9A 2VIMA 3DEXA 2CVDA 3GKKA 1ERVA 5IOXA 2OA7A 2YP6A 3KTLA 1K0DA 4G2EA 3FR9A 2OKAA 2P5RA 2H1BA 4NMUA 4TOPA 4EL1A 3C71A 2I81A 1F6MC 2RM5A 1ML6A 1TU7A 2NBSA 2FY6A 3L4NA 1A24A 2GGTA 3I43A 4JRRA 2IN3A 1GLQA 2LEGA 2PMTA 3IAS2 2ES7A 2HSHA 4V1Ap 1THXA 2CA8A 1MTCA 2C8UA 1OKTA 5D9TA 4MPGA 3P90A 3UOMA 2BJXA 3LWAA 4YAPA 3L9UA 2FWGA 2H0IA 2VLVA 3HKRA 4MMMA 2DLXA 4N10A 4OFTA 4JR6A 3C1RA 1ACVA 3EU3A 3EMXA 2GT6A 3GA4A 4IJ3A 5DQSA 3FZ5A 2VAFA 3TB2A 3EWLA 4ID0A 1GUKA 2P5QA 3ZYWA 4MJEA 2YCDA 4JU5A 5DJMA 1LBKA 1YF1A 4Q5NA 1MDJA 4D73B 2RIIA 3F4RA 4ML6A 5DAKB 1M2BA 1GH2A 2YJ7A 1FOVA 4Q5QA 1TK5B 3GX8A 1RK4A 2BMXA 3TJFA 2JZTA 2PERA 3IK7A 2H8LA 4WR5A 3DMLA 4ACSA 4GLTA 4JBBA 3QR6A 2PVQA 1GSEA 1ZMAA 4ECBA 2H76A 2X99A 1CQGA 2A2RA 2EIRA 3KD0A 2LQOA 5H5SA 1TXXA 4OCFA 3GH9A 3QMXA 2H70A 3A5WA 3GKNA 2R4VA 1GSQA 2B1LA 3QAVA 1K0NA 2CVKA 3EYTA 3GTUB 1PGTA 1XWBA 3FYGA 2QC7A 1TRSA 1O81A 4MH2A 2IMFA 3F63A 5CRHA 1IYHA 3VURA 3BOAA 4JR4A 4DSRA 1WE0A 2GSQA 1XZOA 2O7KA 3G7JA 4LMVA 5IMFA 2YV7A 3RAZA 2X8HA 2PPTA 3ZIJA 3M0FA 4D73A 3GUSA 4OFNA 4IS0A 2H71A 2VCTA 2H19A 1BYEA 3ME8A 5DAKA 4JZQA 4DVCA 4GQFA 1EEMA 1A2MA 1FB0A 3IDVA 4O5RA 5J41A 4GCIA 1EV9A 1TKDB 5G5EA 2A4VA 3RPPA 2RUFA 4K9ZA 13GSA 3WGXA 2X64A 2VM1A 4GWRA 3GURA 1GSYA 1WRYA 1URMA 2FLSA 3TKRA 1SK2A 1YQ1A 4PQIA 1LU4A 1GTBA 1QK8A 1QUWA 2WCIA 1V58A 1W4VA 1TRWA 3H8QA 5DALA 2X8CA 3ZREA 1UA5A 4Z7XA 2AAWA 5E4WA 5EL8A 2LQQA 5JWQB 3HJMA 4PNFA 3KP9A 4GQCA 4X0XA 2MMAA 5D9XA 4EDYA 5F0GA 5IIZA 3GH6A 4XRAA 2REMA 1TTZA 3GTUA 1N2AA 2DC5A 4H86A 4IN0A 4TRXA 4ECIA 3Q18A 4XS4B 4K6XA 4TR0A 3UBKA 1OC8A 4XTSA 1T1VA 3WYWA 4ECJA 2B6MA 1DE2A 2L6CA 2I4AA 4ZB9A 5J3RA 1TK8B 4EO3A 1A23A 1RQMA 2FHEA 5IMZA 8GSSA 3DVXA 2DIYA 3HD5A 4AJ8A 1B48A 2LRCA 4POLA 1Q4JA 1K0OA 5CP1A 5A4VA 1MDIA 2GLRA 4OO5A 4NWYA 1Z3EA 3O76A 5D93A 2VCXA 3UJ1A 2OADA 1J0FA 3FZ4A 1XW6A 2ON7A 3EC3A 1SK0A 1TDIA 5D96A 1PSQA 1R4WA 1YKCA 4JE1A 1OC9B 4LL1B 3TKSE 1DBYA 2GS3A 1DE1A 2IMEA 1GNEA 2HRFA 3FZAA 1MD3A 3IHQA 1SKRB 1SL1B 2J9HA 6GSWA 4BPYA 4MF6A 4MK3A 5DVBA 2DJ2A 4NV5A 1U87A 5DBQA 4K1FA 2O87A 5B8BA 1OE8A 1PX7A 2C3QA 2CZ3A 4O92A 5JCWA 3F4SA 2L4CA 1A8YA 1K3LA 2VUPA 3EVIA 2O89A 2H72A 2FCHA 2VO4A 5F07A 5IO0A 4XS4A 4KSMA 1JZRA 1DSBA 5CREA 3LXTA 5GZZB 4AJ7A 1GUHA 4E8EA 1F9MA 3BCKA 3HYPA 3VI5A 3GL3A 5CAXA 1M9BA 3HJOA 3D4MA 2MZCA 5AGYA 3LGCA 2E2GA 2PN8A 4HOJA 1PMTA 4WF5A 2DIZA 2FWFA 2DJ0A 4TW5A 1PN9A 2L5OA 3DGQA 2KP2A 1QMVA 2NTOA 2TRXA 5KN3A 4XCSA 3VWVA 3G9BA 2CVBA 2GSTA 5ELAA 4GSNA 6GSUA 2VCWA 2GSRA 1GTIA 3I69A 1E2YA 4CW9A 3VFIA 1WPIA 1GSDA 2B5XA 2RUEA 3RPNA 4YH2A 3GV1A 3LQ7A 3HJPA 1XPVA 2E7PA 5ECSA 3DVWA 1LJRA 1B4QA 2VCQA 5JCGA 1X0RA 1JZWA 5GAND 4PQHA 1XVWA 4XHMA 1FO5A 5G5FA 5HR1A 5EVOA 1PD21 1JZDA 1X5CA 3HXSA 1HNAA 3WGEA 2H30A 1GUMA 1GWCA 3WT1A 2L5LA 3TKSA 2WDUA 4NHWA 4V2LA 2LV3A 3ME7A 1ZYEA 1ILOA 4G9HA 4TXVA 4N11A 1TK0B 2LSTA 1GTUA 2C1YA 1KBNA 5ABRA 2DMLA 4P3YB 2F8AA 1R7HA 5IMAA 4OFMA 5ECMB 1K3YA 2X8GA 5H5QA 3ZVJD 4HJMA 3D0ZA 1HNCA 3ZMLA 5HR2A 4RQXA 1E6BA 3E9JB 3APQA 1AXDA 1U3AA 4XS1A 4F03A 2V1MA 1MD4A 2E2MA 2OBKA 2ZUPA 3KJYA 3VK9A 2YJHA 2C0EA 2E0QA 3UVTA 4MZCA 1BEDA 16GSA 3QAGA 1S3AA 22GSA 1NW2A 4QL9A 3NIVA 1F37A 3KTBA 1AW9A 1XWAA 1R5PA 2V6KA 3ZVJA 1I5GA 4RI7A 1FHEA 1GSFA 2H1AA 2TRCP 3UARA 4HZ2A 4MJCA 2Z9SA 4K7OA 1ST9A 1R5AA 1M0UA 4I2UA 3RHBA 3GRXA 2K8SA 4KCAA 4BL7A 4KB3A 1OVNA 4MPFA 2EIQA 4ZL8A 1AC1A 4YQMA 3EE2A 1SL2B 1J08A 3M8NA 2I9HA 3GFKA 3H93A 1J9BA 2H75A 3KEBA 3WD6A 1B4PA 4EDZA 1A0RP 1XWCA 4RQRA 2PUKC 2AB6A 4ISDA 4N0ZA 3APOA 2EIOA 5KN0A 3TCOA 2WS2A 4QQ7A 3HVVA 3VWWA 5D73A 1K3OA 3FHKA 1ABAA 4X1UA 5DJLA 2XBIA 4KDYA 3J7Yb 4HI7A 1TRUA 3KP8A 2LJAA 4ZB8A 3TOTA 4K8MA 3HHVA 3HZ4A 5ECLB 4JEDA 4DSQA 3E0UA 4ZXGA 2HXKA 3EINA 2R3XA 2F8FA 4X43A 1PRXA 1SYRA 2JSZA 5JWRB 1OC3A 4FO5A 2QSIA 3F6FA 1G6YA 3W6GA 5ID2B 3KCMA 3L78A 1ZYQB 4WETA 1WP0A 2YWOA 4HJ2A 1F3BA 3PGTA 2H6XA 1X9SB 4IP6A 2C0DA 2HT9A 3F0IA 4BWQA 4MF5A 3HCZA 1V40A 2H6YA 18GSA 5INYA 5EPFA 1PQNA 2H0HA 3FZ9A 1PKWA 4L5OA 4MLYA 5DALB 1WMJA 2WFCA 4NV2A 4V1Ag 3W8JA 4PQ1A 4MF7A 1W89A 4KA0A 3QFBC 4TR3A 2DMMA 6GSYA 3IE3A 2G0FA 1SU9A 1B9YC 3TJBA 3PH9A 1YZXA 3S9FA 4DSSB 1OKDA 1GSUA 3VLNA 1XWKA 2OE3A 1Q98A 4LLRA 2PVOC 2LTKA 3UL3A 4GRFA 3CXGA 2HE3A 3I6AA 2FUG2 4AGSA 2LKUA 1O73A 3DRNA 2KOKA 1HQOA 5GAPD 5IPGA 4WF4A 2R6KA 4YQUA 4G19A 1HD2A 1Y6EA 3C7MA 3TJKA 1H4OA 4ZILA 1BAYA 4ZB6A 3WGDA 5ID2A 3TRPA 3BD2A 1QGVA 3LJRA 3L9VA 3C73A 2AV4A 3C8EA 2FNOA 2XPEA 3F8UA 2D2ZA 1BJXA 3AY8A 5ELGA 5L71A 1XVQA 2CX3A 3MAKA 1T7PB 4IP1A 4I6XA 2DSAA 1FVKA 5IOWA 4IVFA 4I97A 2VCVA 3F4TA 2K8VA 2YWIA 2H01A 3TKSC 3QAWA 3VI7A 5HR3A 3M9KA 5J9CA 2P0GA 1BX9A 1Z6MA 3LYPA 2OBIA 4DSSA 3Q74A 3L9SA 4CDOA 1ERWA 3BJ5A 3U5RE 2JSYA 5LD0A 3GMFA 3IC4A 2R5GA 1M2AA 3DIEA 2K9FA 4KCEA 1M7TA 3GN3A 3ZFLA 1TJDA 1G6WA 1VF1A 3H79A 1EOGA 4MJBA 1GL8A 1QFNA 1Z6NA 3FK8A 2IFQB 3VWUA 2M72A 2ZNMA 2ZCTA 1R26A 4MZWA 1OYJA 1X5DA 3ZFBA 1ON4A 5FWGA 3TRQA 1I9DA 3FRCA 3TGZA 4LL4B 2OE1A 1XIYA 5F8BA 1Y25A 2IMKA 4MA9A 2C80A 3GYKA 5ECRB 5CNWA 5HQPA 5D8IA 2NVLA 1U88A 1XFLA 2C3TA 2FA4A 2N5FA 4TR1B 4FIWA 3TKPA 2DJKA 4ZL7A 3HDCA 4KX4A 1TOFA 2I3YA 2NDOA 1ZL9A 4PUFC 2V2GA 2TIRA 1SK1A 3IAM2 5DDLA 1Z5YE 3KH9A 3ERGA 5H5RA 4V2MA 2VOCA 5B6MA 3LSZA 3EU4A 4DEJA 2HZFA 2V32A 2CX4A 5HFGA 3GIXA 4OCEA 2HFDA 2V41A 5G1KA 4MJAA 1WIKA 3P8WA 4MDCA 2GZYA 2F3MA 3DD3A 4TXOB 5ECIB 5KEJA 4IQ1A 4K2DA 1PX6A 4HDEA 2B1KA 2GT5A 1HNBA 2IFQA 3DWVA 3FW2A 1NM3A 2HRNA 2GQLA 3IXRA 2EC4A 5KN2A 4BA7A 2LS5A 2RLIA 2ALBA 4N30A 2B5YA 2WRTA 3HY2A 3QCPA 4HZ4A 4ULXA 5B7CA 3GNJA 5C04A 3LG6A 4IHUA 4PXOA 2HSYA 9GSSA 2JZSA 4POBA 1EWXA 3N5OA 4XIHA 3DXBA 2QGVA 4TR1A 4KUNA 3QPMA 2N5BA 2F51A 5G30A 2YANA 2MBSA 3ZL5A 1UN2A 4IJIA 3F9UA 2B7KA 3VPTA 1NHYA 1AUCA 3H4KA 1V98A 1SD9A 3TOUA 1XXUA 1SJZA 2RM6A 1TP9A 5CRWA 3NZNA 1GSSA 3TKQA 4LMWA 3KZQA 5J4UA 1KTEA 4J56E 3US3A 4WEYA 1H75A 3J7Yk 2R37A 1YF0A 1SKSB 3CRUA 4ECCA 2C0GA 2L6DA 4POMA 4HQZA 4MP4A 1V9WA 2HNLA 2CQ9A 3RHCA 4TXOA 2HLSA 2VM2A 5HFKA 2CZ2A 2MMNA 2WB9A 3ZRDA 1JFUA 3R2QA 3KMOA 2OE0A 4PURA 3A3TA 3CYNA 3KXOA 1TI1A 4I5QA 10GSA 3MWHA 3G7IA 1VGLA 1CQHA 2DBCA 3ERWA 3CBUA 5IO2A 2DJ1A 2HZEB 3TJGA 1B9XC 5J5NA 1IYIA 4L0WA 4FYUA 4FYBA 3ZMKA 4WBJA 5HR0A 2WULA 4IQAA 4EXJA 3GL5A 3FKFA 4F0CA 5G1LA 4IELA 5LCZA 1F3AA 1BG5A 4NXIA 2LUSA 2YZHA 1X9WB 1PL1A 3IK9A 1EZKA 5A4UA 1FB6A 3A2VA 1UVZA 3IRAA 4ZBDA 3CSIA 5GSTA 1ERUA 2PU9C 2A2SA 5ECPB 2VL2A 4GF0A 2CAIA 2B3SA 4BVXA 3HA9A 2VLUA 2L59A 4MZBA 6GSSA 1FW1A 2C0FA 3I9V2 5ECOB 2IPAA 3U6VA 2MMZA 1YY7A 1M2DA 3MDKA 3QDNA 2MMOA 1ZCPA 4KDUA 1ZOFA 1SKWB 1EOHA 2JL4A 1U6TA 1GP1A 1GULA 2BTOT 5AISA 4TVEA 3ISOA 3IR4A 5FHIA 5EY6A 3D4TA 3IPZA 2N5AA 3DYRA 3FR6A 2H66A 2LRTA 2VD0A 2FWEA 1JHBA 1M99A 5ENUA 3ZZXA 1K0CA 5A5KA 2HZEA 4HS1A 4N0VA 4MABA 4PGTA 1X5EA 2PGTA 1O7UA 2H6ZA 3G7YA 2C3NA 1V2AA 2P31A 2IIYA 1OE7A 1NSWA 2KP1A 4EKZA 4PNGA 4WKWA 4F2IA 4E8HA 1X9MB 3V1WA 3KIJA 1N8JA 1A2LA 3W8SA 3IA1A 1B8XA 3QOUA 4V2NA 4ZIJA 3IV4A 1S3CA 1JZOA 3RBTA 2WZ9A 5F05A 4IKHA 3ZITA 3TJJA 5A4WA 2XHFA 1T3BA 2VLTA 7GSSA 1XCCA 5KN1A 3MSZA 5D9WA 1WOUA 1GRXA 1GTAA 3N9JA 11GSA 1EV4A 2JADA 4GSTA 3QD9A 1GNWA 1JLVA 2GQKA 1K0AA 2JACA 3GKXA 2AUVA 2AYTA 3IBHA 2XC2A 2OJLA 1T00A 1USBA 4KSOA 4EVMA 4ZL9A 1M9AA 3CTFA 2B5EA 1XW5A 3UEMA 3PINA 3O6TA 1FVJA 2C4JA 3IOSA 4CHSA 1FG4A 3SWLA 1FAAA 1O8WA 1YJ6A 2KLXA 5FT3A 5IMDA 5AIVA 12GSA 2MYGA 5C00A 2L4QA 1VRSD 1T4ZA 4IBPA 4QL7A 1TRVA 20GSA 2H1GA 3LXZA 17GSA 1SD8A 4AF2A 1K0BA 4Q5RA 2YNXA 3M9JA 1VF3A 4WBRD 1XBSA 2YWNA 1QQ2A 1ZZYA 1PL2A 2XBQA 4HQSA 2PBJA 4HUAA 2O85A 3BBYA 1EGOA 1C72A 5DCGA 4POKA 2GDRA 3A2XA 4EUYA 5IQYA 1TU8A 6GSVA 2VCZA 5IMCA 4NPBA 4MH3A 4ILFA 5AN1A 3LYKA 1PA3A 4NHZA 5GSSA 2GZZA 2O8VB 3LFLA 4K7NA 3E3EA 2M80A 1O6JA 1V57A 2CT6A 4GTUA 2YPMA 3FEUA 4LA1A 2YV9A 3VPQA 2LJRA 3UAPA 3D5JA 3L0HA 3WT2A 1WWJA 2B7JA 2QKEA 3FR3A 5ECHB 2H74A 2F9SA 2IMDA 2CV4A 1A8LA 1PKZA 5E59A 4KAEA 1HYUA 4ZBAA 1Z7RA 3ED3A 4FH8A 3GSSA 3FY7A 4I8BA 4O7HA 3Q6OA 1SYXA 2H1DA 3HVSA 3D21A 1YEPA 4OMVA 4L8EA 4ZBBA 2AJQB 2AHEA 3DKSA 3OR5A 4OO4A 2DJ3A 4BWSA 1O85A 3F3RA 4OWYA 3ZIVA 2G2QA 4FYCA 2GQMA 2YZUA 2VD1A 3CSJA 4K0GA 4PX1A 2PWJA 1OAZA 5HFIA 1VF2A 2I1UA 1U3IA 1A0FA 1F2EA 4F0BA 4IW9A 5CYYA 4IGJA 1G0TA 4TR4A 2YN1A 2VL2C 1TI3A 5CRGA 1JLWA 4F9ZA 3TDGA 2IJYA 2JU5A 2XPDA 4K0NA 4MCUA 3PR8A 4GXZA 2OACA 2HYXA 2R2JA 3HZ8A 2VL9A 3EURA 2LRNA 3ZLPA 3NOFA 1GLPA 3GSTA 4Q5FA 2GZPA 5CO3A 3D6IA 2V6OA 1THOA 3TUEA 1T4YA 4PUAA 3ZTLA 1QXHA 2J23A 4TKYA 1UC7A 2HI7A 3GKMA 2FGXA 3UVHA 3BCIA 2CAQA 4YQVA 4RI6A 1K0MA 2GSSA 1MDKA 2IMIA 3P2AA 1SENA 5G2ZA 1NHOA 4L5LA 1WJKA 4BVYA 5CRDA 1T8EB 4RUVA 19GSA 2MBTA 3GHAA 1MEKA 3CMIA 1KEBA 1EP8A 1A2JA
chains in the Genus database with same CATH superfamily
3LORA 4WXTA 3LEFA 5G31A 4I2TA 3K8NA 2FWHA 3APSA 4NAXA 4KNDA 3TRXA 1SL0B 1AAZA 2KHPA 1XOBA 4KW6A 1G7OA 3UIWA 2LNTA 5B6NA 4HU9A 5DCHA 4L0UA 1KNGA 1YEXA 3KM6A 4K7IA 3F6DA 6GSXA 2H73A 1SJIA 4EE0A 4J57E 4KH7A 4EF0A 1OC9A 5COHA 2YOIA 3VWXA 2DJJA 1ZGNA 1M3IA 5B8AA 4KGIA 2H0GA 3CRTA 4XRDA 3P7XA 3UBLA 1EP7A 1VF4A 1AQVA 4XS6A 1AQXA 1EGRA 5DQYA 3HVXA 1TW9A 4OD7A 3MNGA 1YKAA 4GSSA 4ML1A 1SJ6A 2KUCA 5LNKe 1RW1A 5IM9A 4O32A 2WGRA 3UMAA 4YAVA 2K18A 3QFAC 2GVPA 4HEA2 2LJKA 1ERTA 1BQ7A 3KH7A 1DUGA 3GX0A 4G10A 2M46A 4J2FA 2VL3A 3O3TA 3SBCA 3CTGA 2IWTA 4EC0A 2JZRA 5ECKB 5KOXA 1EEJA 4F82A 5J9BA 4CY6A 3M3MA 4KDXA 3M1GA 14GSA 3D22A 3Q19A 4HU7A 3RDWA 5D9VA 5ECNB 2FD3A 1AQWA 2FA8A 3EMPA 1Z9HA 2K6VA 3KMNA 4TN8A 3H1NA 5F06A 2GTUA 5JCUA 4WR4A 4KE3A 2LNSA 5IMVA 2ON5A 5ECQB 2IL3A 1G7EA 1Z7PA 1XOAA 3KGKA 1O8XA 2NPBA 1YDKA 3ERFA 3CSHA 5IPHA 2YWMA 5AIXA 6GSTA 3JCML 2WJUA 1XWGA 3A2WA 2L57A 3F3QA 5JWOB 3C1SA 1AIUA 1S3DA 4AJ6A 1XW9A 2VIMA 2HRAA 3DEXA 2CVDA 3GKKA 1ERVA 5IOXA 2OA7A 2YP6A 3KTLA 1K0DA 4G2EA 3FR9A 4HSCX 2OKAA 2P5RA 2H1BA 4NMUA 4TOPA 4EL1A 3C71A 2I81A 1F6MC 2RM5A 1ML6A 1TU7A 2NBSA 2FY6A 3L4NA 1A24A 2GGTA 3I43A 4JRRA 2IN3A 1GLQA 2LEGA 2PMTA 3IAS2 2ES7A 2HSHA 4V1Ap 1THXA 2CA8A 1MTCA 2C8UA 1OKTA 5D9TA 4MPGA 3P90A 3UOMA 2BJXA 3LWAA 4YAPA 3L9UA 2FWGA 2H0IA 2VLVA 3HKRA 4MMMA 2DLXA 4N10A 4OFTA 4JR6A 3C1RA 1ACVA 3EU3A 3EMXA 2GT6A 3HVNA 1PN0A 3GA4A 4IJ3A 5DQSA 3FZ5A 2VAFA 3TB2A 3EWLA 4ID0A 1GUKA 2P5QA 3ZYWA 4MJEA 2YCDA 4JU5A 5DJMA 1LBKA 1YF1A 4Q5NA 4Z2TA 1MDJA 4D73B 2RIIA 3F4RA 4ML6A 5DAKB 1M2BA 1GH2A 2YJ7A 1FOVA 1ZYNA 4Q5QA 1TK5B 3GX8A 1RK4A 2BMXA 3TJFA 2JZTA 2PERA 3IK7A 2H8LA 4WR5A 3DMLA 4ACSA 4EIPA 4GLTA 4JBBA 3QR6A 2PVQA 1GSEA 1ZMAA 4ECBA 2H76A 2X99A 1CQGA 2A2RA 2EIRA 3KD0A 2LQOA 5H5SA 1TXXA 4OCFA 3GH9A 3QMXA 2H70A 2HSMA 3A5WA 3GKNA 2R4VA 1GSQA 2B1LA 4G0LA 3QAVA 1K0NA 2CVKA 4EIQA 3EYTA 3GTUB 1PGTA 1XWBA 3FYGA 2QC7A 1TRSA 1O81A 4MH2A 2IMFA 3F63A 5CRHA 1IYHA 3VURA 3BOAA 4JR4A 4DSRA 1WE0A 2GSQA 1XZOA 2O7KA 3G7JA 4LMVA 5IMFA 2YV7A 3RAZA 2X8HA 2PPTA 3ZIJA 3M0FA 4D73A 3GUSA 4OFNA 4IS0A 2H71A 2VCTA 2H19A 1BYEA 3ME8A 5DAKA 4JZQA 4DVCA 4GQFA 1EEMA 1A2MA 1FB0A 3IDVA 4O5RA 3CQFA 5J41A 4GCIA 1EV9A 1TKDB 5G5EA 2A4VA 3RPPA 2RUFA 4K9ZA 13GSA 3WGXA 2X64A 2VM1A 4GWRA 3GURA 1GSYA 1WRYA 1URMA 2FLSA 3TKRA 1SK2A 1YQ1A 4PQIA 1LU4A 1GTBA 1QK8A 1QUWA 2WCIA 1V58A 1W4VA 1TRWA 3H8QA 5DALA 2X8CA 3ZREA 1UA5A 4Z7XA 2AAWA 5E4WA 5EL8A 2LQQA 5JWQB 3HJMA 4PNFA 3KP9A 4GQCA 4X0XA 2MMAA 5D9XA 4EDYA 2QA1A 5F0GA 5IIZA 3GH6A 4XRAA 4KF9A 2REMA 1TTZA 3GTUA 1N2AA 2DC5A 4H86A 4IN0A 4TRXA 4ECIA 3Q18A 4XS4B 4K6XA 4TR0A 3UBKA 1OC8A 4XTSA 2DKIA 1T1VA 3WYWA 4ECJA 2B6MA 1DE2A 2L6CA 2I4AA 4ZB9A 5J3RA 1TK8B 4EO3A 1A23A 1RQMA 2FHEA 5IMZA 8GSSA 3DVXA 2DIYA 3HD5A 4AJ8A 1B48A 2LRCA 4POLA 1Q4JA 1K0OA 5CP1A 5A4VA 1MDIA 2GLRA 4OO5A 4NWYA 3EPTA 1Z3EA 3O76A 5D93A 2VCXA 3UJ1A 2OADA 1J0FA 3FZ4A 1XW6A 2ON7A 3EC3A 1SK0A 3PPUA 2X49A 1TDIA 5D96A 1PSQA 1R4WA 1YKCA 4JE1A 1OC9B 4LL1B 3TKSE 1DBYA 2GS3A 1DE1A 2IMEA 1GNEA 2HRFA 4FQUA 3FZAA 1MD3A 3IHQA 1SKRB 1SL1B 2J9HA 4G0IA 6GSWA 4BPYA 4MF6A 4MK3A 5DVBA 2DJ2A 4NV5A 1U87A 5DBQA 4K1FA 2O87A 5B8BA 1OE8A 1PX7A 2C3QA 2CZ3A 4O92A 5JCWA 3F4SA 2L4CA 1A8YA 5BRTA 1K3LA 2VUPA 3EVIA 2O89A 2H72A 2FCHA 2VO4A 4O5UA 5F07A 5IO0A 4XS4A 4KSMA 3R3EA 1JZRA 1DSBA 5CREA 3LXTA 5GZZB 4AJ7A 1GUHA 4E8EA 1F9MA 3BCKA 3HYPA 3VI5A 3GL3A 5CAXA 1M9BA 3HJOA 3D4MA 2MZCA 5AGYA 3LGCA 2E2GA 2PN8A 4HOJA 1PMTA 4WF5A 2DIZA 2FWFA 2DJ0A 4TW5A 1PN9A 2L5OA 3DGQA 2KP2A 1QMVA 1XG8A 2NTOA 2TRXA 5KN3A 4XCSA 3VWVA 3G9BA 4Z2RA 2CVBA 2A4HA 2QA2A 2GSTA 5ELAA 4GSNA 6GSUA 2VCWA 2GSRA 1GTIA 3I69A 1E2YA 4CW9A 3VFIA 1WPIA 1GSDA 2B5XA 2RUEA 3RPNA 3LQ7A 3GV1A 4YH2A 3HJPA 1XPVA 2E7PA 5ECSA 3DVWA 1LJRA 1B4QA 2VCQA 5JCGA 1X0RA 1JZWA 5GAND 4PQHA 1XVWA 4XHMA 1FO5A 5G5FA 5HR1A 5EVOA 1PD21 1JZDA 1X5CA 3HXSA 1HNAA 3WGEA 2H30A 4BL7B 1GUMA 1GWCA 3WT1A 2L5LA 2R0CA 3TKSA 2WDUA 4NHWA 4V2LA 2LV3A 3ME7A 1ZYEA 1ILOA 4G9HA 4TXVA 4N11A 1TK0B 2LSTA 1GTUA 2C1YA 1KBNA 5ABRA 2DMLA 4P3YB 2F8AA 1R7HA 5IMAA 4OFMA 5ECMB 1K3YA 2X8GA 4ICYA 5H5QA 3ZVJD 4HJMA 3D0ZA 1HNCA 3ZMLA 5HR2A 3FMWA 4RQXA 1E6BA 3E9JB 3APQA 1AXDA 1U3AA 4XS1A 4F03A 2V1MA 1MD4A 2E2MA 2OBKA 2ZUPA 3KJYA 3VK9A 2YJHA 2C0EA 2E0QA 3UVTA 4MZCA 1BEDA 16GSA 4G0KA 3QAGA 1S3AA 22GSA 1NW2A 4QL9A 3NIVA 1F37A 3KTBA 1AW9A 1XWAA 1R5PA 2V6KA 3ZVJA 1I5GA 4RI7A 1FHEA 1GSFA 4K2XA 2H1AA 2TRCP 3UARA 4HZ2A 4MJCA 2Z9SA 4K7OA 1ST9A 1R5AA 1M0UA 4I2UA 3RHBA 3GRXA 2K8SA 4KCAA 4BL7A 4KB3A 1OVNA 4MPFA 2EIQA 4ZL8A 1AC1A 4YQMA 3EE2A 1SL2B 1J08A 3M8NA 2I9HA 3GFKA 3H93A 1J9BA 2H75A 3KEBA 3WD6A 1B4PA 4EDZA 1A0RP 1XWCA 4RQRA 2PUKC 2AB6A 4ISDA 4N0ZA 3APOA 2EIOA 5KN0A 3TCOA 2WS2A 4QQ7A 3HVVA 3VWWA 5D73A 1K3OA 3FHKA 1ABAA 4X1UA 5DJLA 2XBIA 4KDYA 3J7Yb 4HI7A 1TRUA 3KP8A 2LJAA 4ZB8A 3TOTA 4K8MA 3HHVA 3HZ4A 5ECLB 4JEDA 4DSQA 3E0UA 4ZXGA 2HXKA 3EINA 2R3XA 2F8FA 4X43A 1PRXA 1SYRA 2JSZA 5JWRB 1OC3A 4FO5A 2QSIA 3F6FA 1G6YA 3W6GA 5ID2B 3KCMA 3L78A 1ZYQB 4WETA 1WP0A 2YWOA 4HJ2A 1F3BA 3PGTA 2H6XA 1PFOA 1X9SB 4IP6A 2C0DA 2HT9A 3F0IA 4BWQA 4MF5A 3HCZA 1V40A 2H6YA 18GSA 5INYA 5EPFA 1PQNA 2H0HA 3FZ9A 1PKWA 4L5OA 4MLYA 5DALB 1WMJA 2WFCA 4NV2A 4V1Ag 3W8JA 4PQ1A 4MF7A 1W89A 4KA0A 3QFBC 4TR3A 2DMMA 6GSYA 3IE3A 2G0FA 1SU9A 1B9YC 3TJBA 3PH9A 1YZXA 3S9FA 4DSSB 1OKDA 1GSUA 3VLNA 1XWKA 2OE3A 1Q98A 4LLRA 2PVOC 2LTKA 3UL3A 4GRFA 3CXGA 2HE3A 3I6AA 2FUG2 4AGSA 2LKUA 1O73A 3DRNA 4X4JA 2KOKA 1HQOA 5GAPD 5IPGA 4WF4A 2R6KA 4YQUA 4G19A 1HD2A 1Y6EA 3C7MA 3TJKA 1H4OA 4ZILA 1BAYA 1S3RA 4ZB6A 3WGDA 5ID2A 3TRPA 3BD2A 1QGVA 3LJRA 3L9VA 3C73A 2AV4A 3C8EA 2FNOA 2XPEA 3F8UA 2D2ZA 1BJXA 3AY8A 5ELGA 5L71A 1XVQA 4YKFA 2CX3A 3MAKA 1T7PB 4IP1A 2DKHA 4I6XA 2DSAA 1FVKA 5IOWA 4IVFA 4I97A 2VCVA 3F4TA 2K8VA 2YWIA 2H01A 3TKSC 3QAWA 3VI7A 5HR3A 3M9KA 5J9CA 2P0GA 1BX9A 1Z6MA 3LYPA 2OBIA 4DSSA 3Q74A 3L9SA 4CDOA 1ERWA 3BJ5A 3U5RE 2JSYA 5LD0A 3GMFA 3IC4A 2R5GA 1M2AA 3DIEA 2K9FA 4K5RA 4KCEA 1M7TA 3GN3A 3ZFLA 1TJDA 1G6WA 1VF1A 3H79A 1EOGA 4MJBA 1GL8A 1QFNA 1Z6NA 3FK8A 2IFQB 3VWUA 2M72A 2ZNMA 2ZCTA 1R26A 4MZWA 1OYJA 1X5DA 3ZFBA 1ON4A 5FWGA 3TRQA 1I9DA 3FRCA 3TGZA 4LL4B 2OE1A 1XIYA 5F8BA 1Y25A 2IMKA 4MA9A 2C80A 3GYKA 2R0GA 5ECRB 5CNWA 5HQPA 5D8IA 2NVLA 1U88A 1XFLA 2C3TA 2FA4A 2N5FA 4TR1B 4FIWA 3TKPA 2DJKA 4ZL7A 3HDCA 4KX4A 1TOFA 2I3YA 3IC8A 2NDOA 1ZL9A 4PUFC 2V2GA 2TIRA 1SK1A 3IAM2 5DDLA 1Z5YE 4Z2UA 3KH9A 3ERGA 5H5RA 4V2MA 2VOCA 5B6MA 3LSZA 3EU4A 4DEJA 2HZFA 2V32A 2CX4A 5HFGA 3GIXA 4OCEA 2HFDA 2V41A 5G1KA 4MJAA 1WIKA 3P8WA 4MDCA 2GZYA 2F3MA 3DD3A 4TXOB 5ECIB 5KEJA 4MNNA 4IQ1A 4K2DA 1PX6A 4HDEA 2B1KA 2UZ8A 2GT5A 1HNBA 2IFQA 3DWVA 4PTSA 3FW2A 3A5IA 1NM3A 2HRNA 2GQLA 3IXRA 2EC4A 5KN2A 4BA7A 1FOHA 2LS5A 2RLIA 2ALBA 4N30A 2B5YA 2WRTA 3HY2A 3QCPA 4HZ4A 4ULXA 5B7CA 3GNJA 5C04A 3LG6A 4IHUA 4PXOA 2HSYA 9GSSA 2JZSA 4POBA 1EWXA 3N5OA 4XIHA 3DXBA 2QGVA 4TR1A 4KUNA 3QPMA 2N5BA 2F51A 5G30A 2YANA 2MBSA 3ZL5A 1UN2A 4IJIA 3F9UA 2B7KA 3VPTA 1NHYA 1AUCA 4BVXB 3H4KA 1V98A 1SD9A 3TOUA 1XXUA 1SJZA 2RM6A 1TP9A 5CRWA 3NZNA 1GSSA 3TKQA 4LMWA 3KZQA 5J4UA 1KTEA 4J56E 3US3A 4WEYA 1H75A 3J7Yk 2R37A 1YF0A 1SKSB 3CRUA 4ECCA 2C0GA 2L6DA 4POMA 4HQZA 4MP4A 1V9WA 2HNLA 2CQ9A 3RHCA 4TXOA 2HLSA 2VM2A 5HFKA 2CZ2A 2MMNA 2WB9A 3ZRDA 1JFUA 3R2QA 3KMOA 2OE0A 4PURA 3A3TA 3CYNA 3KXOA 1TI1A 4I5QA 10GSA 3LW9A 3MWHA 3G7IA 1VGLA 1CQHA 2DBCA 3ERWA 3CBUA 5IO2A 2HRKA 2DJ1A 2HZEB 3TJGA 1B9XC 5J5NA 1IYIA 4L0WA 4FYUA 4FYBA 3ZMKA 4WBJA 5HR0A 2WULA 4IQAA 4EXJA 3GL5A 3FKFA 4F0CA 5G1LA 4IELA 5LCZA 1F3AA 1BG5A 4NXIA 2LUSA 2YZHA 1X9WB 4USSA 1PL1A 3IK9A 1EZKA 5A4UA 1FB6A 3A2VA 1UVZA 3IRAA 4ZBDA 3CSIA 5GSTA 1ERUA 2PU9C 2A2SA 5ECPB 2VL2A 4GF0A 2CAIA 2B3SA 4BVXA 3HA9A 2VLUA 2L59A 4MZBA 6GSSA 1FW1A 2C0FA 3I9V2 5ECOB 2IPAA 3U6VA 2MMZA 1YY7A 1M2DA 3MDKA 3QDNA 2MMOA 1ZCPA 4KDUA 1ZOFA 1SKWB 1EOHA 2JL4A 1U6TA 1GP1A 1GULA 2BTOT 5AISA 4TVEA 3ISOA 3IR4A 5FHIA 5EY6A 3D4TA 3IPZA 4BIKA 2N5AA 3DYRA 3FR6A 2H66A 2LRTA 2VD0A 2FWEA 1JHBA 1M99A 5ENUA 3ZZXA 1K0CA 3IHGA 5A5KA 2HZEA 4HS1A 4N0VA 4MABA 4PGTA 1X5EA 2PGTA 1O7UA 2H6ZA 3G7YA 2C3NA 1V2AA 2P31A 2IIYA 1OE7A 1NSWA 2KP1A 4EKZA 4PNGA 4WKWA 4F2IA 4E8HA 1X9MB 3V1WA 3KIJA 1N8JA 1A2LA 3W8SA 3IA1A 1B8XA 3QOUA 4V2NA 4ZIJA 3IV4A 1S3CA 1JZOA 3RBTA 2WZ9A 1M3JA 5F05A 4IKHA 3ZITA 3TJJA 5A4WA 2XHFA 1T3BA 2VLTA 7GSSA 1XCCA 5KN1A 3MSZA 5D9WA 1WOUA 1GRXA 1GTAA 3N9JA 11GSA 1EV4A 2JADA 4GSTA 3QD9A 1GNWA 1JLVA 3MYDA 2GQKA 1K0AA 2JACA 2A2PA 3GKXA 2AUVA 2AYTA 3IBHA 2XC2A 2OJLA 1T00A 1USBA 4KSOA 4EVMA 2X4AA 4ZL9A 1M9AA 4CY8A 3CTFA 2B5EA 1XW5A 3UEMA 3PINA 3O6TA 1FVJA 2C4JA 3IOSA 4CHSA 1FG4A 3SWLA 1FAAA 1O8WA 1YJ6A 2KLXA 5FT3A 5IMDA 5AIVA 12GSA 2MYGA 5C00A 2L4QA 4K5SA 1VRSD 1T4ZA 4IBPA 4QL7A 1TRVA 20GSA 2H1GA 3LXZA 17GSA 1SD8A 4AF2A 1K0BA 4Q5RA 2YNXA 3M9JA 1VF3A 4WBRD 1XBSA 2YWNA 1QQ2A 1ZZYA 1PL2A 2XBQA 4HQSA 2PBJA 4HUAA 2O85A 3BBYA 1EGOA 1C72A 5DCGA 4POKA 2GDRA 3A2XA 4EUYA 5IQYA 1TU8A 6GSVA 2VCZA 5IMCA 4NPBA 4MH3A 4ILFA 5AN1A 3LYKA 1PA3A 4NHZA 5GSSA 2GZZA 2O8VB 3LFLA 4K7NA 3E3EA 2M80A 1O6JA 1V57A 4O5QA 2CT6A 4GTUA 2YPMA 3FEUA 4LA1A 2YV9A 3VPQA 2LJRA 3UAPA 4A5PA 3D5JA 3L0HA 3WT2A 3MIXA 1WWJA 2B7JA 2QKEA 3FR3A 5ECHB 2H74A 2F9SA 2IMDA 2CV4A 1A8LA 1PKZA 5E59A 4KAEA 1HYUA 4ZBAA 1Z7RA 3ED3A 4FH8A 4YKGA 3GSSA 3FY7A 4I8BA 4O7HA 3Q6OA 1SYXA 2H1DA 3HVSA 3D21A 1YEPA 4OMVA 4L8EA 4ZBBA 2AJQB 2AHEA 3DKSA 3OR5A 4BVYB 4OO4A 2DJ3A 4BWSA 1O85A 3F3RA 4OWYA 3ZIVA 2G2QA 4FYCA 2GQMA 2YZUA 2VD1A 3CSJA 4K0GA 1ZYPA 4PX1A 2PWJA 1OAZA 5KOWA 5HFIA 1VF2A 2I1UA 1U3IA 1A0FA 1F2EA 4F0BA 4IW9A 5CYYA 4IGJA 1G0TA 4TR4A 2YN1A 2VL2C 1TI3A 5CRGA 1JLWA 4F9ZA 3TDGA 2IJYA 2JU5A 2XPDA 4K0NA 4MCUA 3PR8A 4GXZA 2OACA 2HYXA 2R2JA 3HZ8A 2VL9A 3EURA 2LRNA 3ZLPA 3NOFA 1GLPA 3GSTA 4Q5FA 2GZPA 5CO3A 3D6IA 2V6OA 1THOA 3TUEA 1T4YA 4PUAA 3ZTLA 1QXHA 2J23A 4TKYA 1UC7A 2HI7A 3GKMA 2FGXA 3UVHA 3BCIA 2CAQA 4YQVA 4RI6A 1K0MA 2GSSA 1MDKA 2IMIA 3P2AA 1SENA 5G2ZA 2R0PA 1NHOA 5BMUA 4L5LA 1WJKA 4BVYA 5CRDA 1T8EB 4RUVA 19GSA 2MBTA 3GHAA 1MEKA 3CMIA 1KEBA 1EP8A 1A2JA
chains in the Genus database with same CATH topology
3LORA 4WXTA 3LEFA 5G31A 4I2TA 3K8NA 2FWHA 3APSA 4NAXA 4KNDA 3TRXA 1SL0B 1AAZA 2KHPA 1XOBA 4KW6A 1G7OA 3UIWA 2LNTA 5B6NA 4HU9A 5DCHA 4L0UA 1KNGA 1YEXA 3KM6A 4K7IA 3F6DA 6GSXA 2H73A 1SJIA 4EE0A 4J57E 4KH7A 4EF0A 1OC9A 5COHA 2YOIA 3VWXA 2DJJA 1ZGNA 5B8AA 4KGIA 2H0GA 3CRTA 4XRDA 3P7XA 3UBLA 1EP7A 1VF4A 1AQVA 4XS6A 1AQXA 1EGRA 5DQYA 3HVXA 1TW9A 4OD7A 3MNGA 1YKAA 4GSSA 4ML1A 1SJ6A 2KUCA 5LNKe 1RW1A 5IM9A 4O32A 2WGRA 3UMAA 4YAVA 2K18A 3QFAC 2GVPA 4HEA2 2LJKA 1ERTA 1BQ7A 3KH7A 1DUGA 3GX0A 4G10A 2M46A 4J2FA 2VL3A 3O3TA 3SBCA 3CTGA 2IWTA 4EC0A 2JZRA 5ECKB 5KOXA 1EEJA 4F82A 5J9BA 4CY6A 3M3MA 4KDXA 3M1GA 14GSA 3D22A 3Q19A 4HU7A 3RDWA 5D9VA 5ECNB 2FD3A 1AQWA 2FA8A 3EMPA 1Z9HA 2K6VA 3KMNA 4TN8A 3H1NA 5F06A 2GTUA 5JCUA 4WR4A 4KE3A 2LNSA 5IMVA 2ON5A 5ECQB 2IL3A 1G7EA 1Z7PA 1XOAA 3KGKA 1O8XA 2NPBA 1YDKA 3ERFA 3CSHA 5IPHA 2YWMA 5AIXA 6GSTA 3JCML 2WJUA 1XWGA 3A2WA 2L57A 3F3QA 5JWOB 3C1SA 1AIUA 1S3DA 4AJ6A 1XW9A 2VIMA 2HRAA 3DEXA 2CVDA 3GKKA 1ERVA 5IOXA 2OA7A 2YP6A 3KTLA 1K0DA 4G2EA 3FR9A 2OKAA 2P5RA 2H1BA 4NMUA 4TOPA 4EL1A 3C71A 2I81A 1F6MC 2RM5A 1ML6A 1TU7A 2NBSA 2FY6A 3L4NA 1A24A 2GGTA 3I43A 4JRRA 2IN3A 1GLQA 2LEGA 2PMTA 3IAS2 2ES7A 2HSHA 4V1Ap 1THXA 2CA8A 1MTCA 2C8UA 1OKTA 5D9TA 4MPGA 3P90A 3UOMA 2BJXA 3LWAA 4YAPA 3L9UA 2FWGA 2H0IA 2VLVA 3HKRA 4MMMA 2DLXA 4N10A 4OFTA 4JR6A 3C1RA 1ACVA 3EU3A 3EMXA 2GT6A 1PN0A 3GA4A 4IJ3A 5DQSA 3FZ5A 2VAFA 3TB2A 3EWLA 4ID0A 1GUKA 2P5QA 3ZYWA 4MJEA 2YCDA 4JU5A 5DJMA 1LBKA 1YF1A 4Q5NA 4Z2TA 1MDJA 4D73B 2RIIA 3F4RA 4ML6A 5DAKB 1M2BA 1GH2A 2YJ7A 1FOVA 1ZYNA 4Q5QA 1TK5B 3GX8A 1RK4A 2BMXA 3TJFA 2JZTA 2PERA 3IK7A 2H8LA 4WR5A 3DMLA 4ACSA 4EIPA 4GLTA 4JBBA 3QR6A 2PVQA 1GSEA 1ZMAA 4ECBA 2H76A 2X99A 1CQGA 2A2RA 2EIRA 3KD0A 2LQOA 5H5SA 1TXXA 4OCFA 3GH9A 3QMXA 2H70A 2HSMA 3A5WA 3GKNA 2R4VA 1GSQA 2B1LA 4G0LA 3QAVA 1K0NA 2CVKA 4EIQA 3EYTA 3GTUB 1PGTA 1XWBA 3FYGA 2QC7A 1TRSA 1O81A 4MH2A 2IMFA 3F63A 5CRHA 1IYHA 3VURA 3BOAA 4JR4A 4DSRA 1WE0A 2GSQA 1XZOA 2O7KA 3G7JA 4LMVA 5IMFA 2YV7A 3RAZA 2X8HA 2PPTA 3ZIJA 3M0FA 4D73A 3GUSA 4OFNA 4IS0A 2H71A 2VCTA 2H19A 1BYEA 3ME8A 5DAKA 4JZQA 4DVCA 4GQFA 1EEMA 1A2MA 1FB0A 3IDVA 4O5RA 5J41A 4GCIA 1EV9A 1TKDB 5G5EA 2A4VA 3RPPA 2RUFA 4K9ZA 13GSA 3WGXA 2X64A 2VM1A 4GWRA 3GURA 1GSYA 1WRYA 1URMA 2FLSA 3TKRA 1SK2A 1YQ1A 4PQIA 1LU4A 1GTBA 1QK8A 1QUWA 2WCIA 1V58A 1W4VA 1TRWA 3H8QA 5DALA 2X8CA 3ZREA 1UA5A 4Z7XA 2AAWA 5E4WA 5EL8A 2LQQA 5JWQB 3HJMA 4PNFA 3KP9A 4GQCA 4X0XA 2MMAA 5D9XA 4EDYA 2QA1A 5F0GA 5IIZA 3GH6A 4XRAA 4KF9A 2REMA 1TTZA 3GTUA 1N2AA 2DC5A 4H86A 4IN0A 4TRXA 4ECIA 3Q18A 4XS4B 4K6XA 4TR0A 3UBKA 1OC8A 4XTSA 2DKIA 1T1VA 3WYWA 4ECJA 2B6MA 1DE2A 2L6CA 2I4AA 4ZB9A 5J3RA 1TK8B 4EO3A 1A23A 1RQMA 2FHEA 5IMZA 8GSSA 3DVXA 2DIYA 3HD5A 4AJ8A 1B48A 2LRCA 4POLA 1Q4JA 1K0OA 5CP1A 5A4VA 1MDIA 2GLRA 4OO5A 4NWYA 3EPTA 1Z3EA 3O76A 5D93A 2VCXA 3UJ1A 2OADA 1J0FA 3FZ4A 1XW6A 2ON7A 3EC3A 1SK0A 3PPUA 2X49A 1TDIA 5D96A 1PSQA 1R4WA 1YKCA 4JE1A 1OC9B 4LL1B 3TKSE 1DBYA 2GS3A 1DE1A 2IMEA 1GNEA 2HRFA 4FQUA 3FZAA 1MD3A 3IHQA 1SKRB 1SL1B 2J9HA 4G0IA 6GSWA 4BPYA 4MF6A 4MK3A 5DVBA 2DJ2A 4NV5A 1U87A 5DBQA 4K1FA 2O87A 5B8BA 1OE8A 1PX7A 2C3QA 2CZ3A 4O92A 5JCWA 3F4SA 2L4CA 1A8YA 5BRTA 1K3LA 2VUPA 3EVIA 2O89A 2H72A 2FCHA 2VO4A 4O5UA 5F07A 5IO0A 4XS4A 4KSMA 3R3EA 1JZRA 1DSBA 5CREA 3LXTA 5GZZB 4AJ7A 1GUHA 4E8EA 1F9MA 3BCKA 3HYPA 3VI5A 3GL3A 5CAXA 1M9BA 3HJOA 3D4MA 2MZCA 5AGYA 3LGCA 2E2GA 2PN8A 4HOJA 1PMTA 4WF5A 2DIZA 2FWFA 2DJ0A 4TW5A 1PN9A 2L5OA 3DGQA 2KP2A 1QMVA 2NTOA 2TRXA 5KN3A 4XCSA 3VWVA 3G9BA 4Z2RA 2CVBA 2A4HA 2QA2A 2GSTA 5ELAA 4GSNA 6GSUA 2VCWA 2GSRA 1GTIA 3I69A 1E2YA 4CW9A 3VFIA 1WPIA 1GSDA 2B5XA 2RUEA 3RPNA 3LQ7A 3GV1A 4YH2A 3HJPA 1XPVA 2E7PA 5ECSA 3DVWA 1LJRA 1B4QA 2VCQA 5JCGA 1X0RA 1JZWA 5GAND 4PQHA 1XVWA 4XHMA 1FO5A 5G5FA 5HR1A 5EVOA 1PD21 1JZDA 1X5CA 3HXSA 1HNAA 3WGEA 2H30A 4BL7B 1GUMA 1GWCA 3WT1A 2L5LA 2R0CA 3TKSA 2WDUA 4NHWA 4V2LA 2LV3A 3ME7A 1ZYEA 1ILOA 4G9HA 4TXVA 4N11A 1TK0B 2LSTA 1GTUA 2C1YA 1KBNA 5ABRA 2DMLA 4P3YB 2F8AA 1R7HA 5IMAA 4OFMA 5ECMB 1K3YA 2X8GA 4ICYA 5H5QA 3ZVJD 4HJMA 3D0ZA 1HNCA 3ZMLA 5HR2A 3FMWA 4RQXA 1E6BA 3E9JB 3APQA 1AXDA 1U3AA 4XS1A 4F03A 2V1MA 1MD4A 2E2MA 2OBKA 2ZUPA 3KJYA 3VK9A 2YJHA 2C0EA 2E0QA 3UVTA 4MZCA 1BEDA 16GSA 4G0KA 3QAGA 1S3AA 22GSA 1NW2A 4QL9A 3NIVA 1F37A 3KTBA 1AW9A 1XWAA 1R5PA 2V6KA 3ZVJA 1I5GA 4RI7A 1FHEA 1GSFA 4K2XA 2H1AA 2TRCP 3UARA 4HZ2A 4MJCA 2Z9SA 4K7OA 1ST9A 1R5AA 1M0UA 4I2UA 3RHBA 3GRXA 2K8SA 4KCAA 4BL7A 4KB3A 1OVNA 4MPFA 2EIQA 4ZL8A 1AC1A 4YQMA 3EE2A 1SL2B 1J08A 3M8NA 2I9HA 3GFKA 3H93A 1J9BA 2H75A 3KEBA 3WD6A 1B4PA 4EDZA 1A0RP 1XWCA 4RQRA 2PUKC 2AB6A 4ISDA 4N0ZA 3APOA 2EIOA 5KN0A 3TCOA 2WS2A 4QQ7A 3HVVA 3VWWA 5D73A 1K3OA 3FHKA 1ABAA 4X1UA 5DJLA 2XBIA 4KDYA 3J7Yb 4HI7A 1TRUA 3KP8A 2LJAA 4ZB8A 3TOTA 4K8MA 3HHVA 3HZ4A 5ECLB 4JEDA 4DSQA 3E0UA 4ZXGA 2HXKA 3EINA 2R3XA 2F8FA 4X43A 1PRXA 1SYRA 2JSZA 5JWRB 1OC3A 4FO5A 2QSIA 3F6FA 1G6YA 3W6GA 5ID2B 3KCMA 3L78A 1ZYQB 4WETA 1WP0A 2YWOA 4HJ2A 1F3BA 3PGTA 2H6XA 1X9SB 4IP6A 2C0DA 2HT9A 3F0IA 4BWQA 4MF5A 3HCZA 1V40A 2H6YA 18GSA 5INYA 5EPFA 1PQNA 2H0HA 3FZ9A 1PKWA 4L5OA 4MLYA 5DALB 1WMJA 2WFCA 4NV2A 4V1Ag 3W8JA 4PQ1A 4MF7A 1W89A 4KA0A 3QFBC 4TR3A 2DMMA 6GSYA 3IE3A 2G0FA 1SU9A 1B9YC 3TJBA 3PH9A 1YZXA 3S9FA 4DSSB 1OKDA 1GSUA 3VLNA 1XWKA 2OE3A 1Q98A 4LLRA 2PVOC 2LTKA 3UL3A 4GRFA 3CXGA 2HE3A 3I6AA 2FUG2 4AGSA 2LKUA 1O73A 3DRNA 4X4JA 2KOKA 1HQOA 5GAPD 5IPGA 4WF4A 2R6KA 4YQUA 4G19A 1HD2A 1Y6EA 3C7MA 3TJKA 1H4OA 4ZILA 1BAYA 4ZB6A 3WGDA 5ID2A 3TRPA 3BD2A 1QGVA 3LJRA 3L9VA 3C73A 2AV4A 3C8EA 2FNOA 2XPEA 3F8UA 2D2ZA 1BJXA 3AY8A 5ELGA 5L71A 1XVQA 4YKFA 2CX3A 3MAKA 1T7PB 4IP1A 2DKHA 4I6XA 2DSAA 1FVKA 5IOWA 4IVFA 4I97A 2VCVA 3F4TA 2K8VA 2YWIA 2H01A 3TKSC 3QAWA 3VI7A 5HR3A 3M9KA 5J9CA 2P0GA 1BX9A 1Z6MA 3LYPA 2OBIA 4DSSA 3Q74A 3L9SA 4CDOA 1ERWA 3BJ5A 3U5RE 2JSYA 5LD0A 3GMFA 3IC4A 2R5GA 1M2AA 3DIEA 2K9FA 4K5RA 4KCEA 1M7TA 3GN3A 3ZFLA 1TJDA 1G6WA 1VF1A 3H79A 1EOGA 4MJBA 1GL8A 1QFNA 1Z6NA 3FK8A 2IFQB 3VWUA 2M72A 2ZNMA 2ZCTA 1R26A 4MZWA 1OYJA 1X5DA 3ZFBA 1ON4A 5FWGA 3TRQA 1I9DA 3FRCA 3TGZA 4LL4B 2OE1A 1XIYA 5F8BA 1Y25A 2IMKA 4MA9A 2C80A 3GYKA 2R0GA 5ECRB 5CNWA 5HQPA 5D8IA 2NVLA 1U88A 1XFLA 2C3TA 2FA4A 2N5FA 4TR1B 4FIWA 3TKPA 2DJKA 4ZL7A 3HDCA 4KX4A 1TOFA 2I3YA 3IC8A 2NDOA 1ZL9A 4PUFC 2V2GA 2TIRA 1SK1A 3IAM2 5DDLA 1Z5YE 4Z2UA 3KH9A 3ERGA 5H5RA 4V2MA 2VOCA 5B6MA 3LSZA 3EU4A 4DEJA 2HZFA 2V32A 2CX4A 5HFGA 3GIXA 4OCEA 2HFDA 2V41A 5G1KA 4MJAA 1WIKA 3P8WA 4MDCA 2GZYA 2F3MA 3DD3A 4TXOB 5ECIB 5KEJA 4MNNA 4IQ1A 4K2DA 1PX6A 4HDEA 2B1KA 2UZ8A 2GT5A 1HNBA 2IFQA 3DWVA 4PTSA 3FW2A 3A5IA 1NM3A 2HRNA 2GQLA 3IXRA 2EC4A 5KN2A 4BA7A 1FOHA 2LS5A 2RLIA 2ALBA 4N30A 2B5YA 2WRTA 3HY2A 3QCPA 4HZ4A 4ULXA 5B7CA 3GNJA 5C04A 3LG6A 4IHUA 4PXOA 2HSYA 9GSSA 2JZSA 4POBA 1EWXA 3N5OA 4XIHA 3DXBA 2QGVA 4TR1A 4KUNA 3QPMA 2N5BA 2F51A 5G30A 2YANA 2MBSA 3ZL5A 1UN2A 4IJIA 3F9UA 2B7KA 3VPTA 1NHYA 1AUCA 4BVXB 3H4KA 1V98A 1SD9A 3TOUA 1XXUA 1SJZA 2RM6A 1TP9A 5CRWA 3NZNA 1GSSA 3TKQA 4LMWA 3KZQA 5J4UA 1KTEA 4J56E 3US3A 4WEYA 1H75A 3J7Yk 2R37A 1YF0A 1SKSB 3CRUA 4ECCA 2C0GA 2L6DA 4POMA 4HQZA 4MP4A 1V9WA 2HNLA 2CQ9A 3RHCA 4TXOA 2HLSA 2VM2A 5HFKA 2CZ2A 2MMNA 2WB9A 3ZRDA 1JFUA 3R2QA 3KMOA 2OE0A 4PURA 3A3TA 3CYNA 3KXOA 1TI1A 4I5QA 10GSA 3LW9A 3MWHA 3G7IA 1VGLA 1CQHA 2DBCA 3ERWA 3CBUA 5IO2A 2HRKA 2DJ1A 2HZEB 3TJGA 1B9XC 5J5NA 1IYIA 4L0WA 4FYUA 4FYBA 3ZMKA 4WBJA 5HR0A 2WULA 4IQAA 4EXJA 3GL5A 3FKFA 4F0CA 5G1LA 4IELA 5LCZA 1F3AA 1BG5A 4NXIA 2LUSA 2YZHA 1X9WB 4USSA 1PL1A 3IK9A 1EZKA 5A4UA 1FB6A 3A2VA 1UVZA 3IRAA 4ZBDA 3CSIA 5GSTA 1ERUA 2PU9C 2A2SA 5ECPB 2VL2A 4GF0A 2CAIA 2B3SA 4BVXA 3HA9A 2VLUA 2L59A 4MZBA 6GSSA 1FW1A 2C0FA 3I9V2 5ECOB 2IPAA 3U6VA 2MMZA 1YY7A 1M2DA 3MDKA 3QDNA 2MMOA 1ZCPA 4KDUA 1ZOFA 1SKWB 1EOHA 2JL4A 1U6TA 1GP1A 1GULA 2BTOT 5AISA 4TVEA 3ISOA 3IR4A 5FHIA 5EY6A 3D4TA 3IPZA 2N5AA 3DYRA 3FR6A 2H66A 2LRTA 2VD0A 2FWEA 1JHBA 1M99A 5ENUA 3ZZXA 1K0CA 3IHGA 5A5KA 2HZEA 4HS1A 4N0VA 4MABA 4PGTA 1X5EA 2PGTA 1O7UA 2H6ZA 3G7YA 2C3NA 1V2AA 2P31A 2IIYA 1OE7A 1NSWA 2KP1A 4EKZA 4PNGA 4WKWA 4F2IA 4E8HA 1X9MB 3V1WA 3KIJA 1N8JA 1A2LA 3W8SA 3IA1A 1B8XA 3QOUA 4V2NA 4ZIJA 3IV4A 1S3CA 1JZOA 3RBTA 2WZ9A 5F05A 4IKHA 3ZITA 3TJJA 5A4WA 2XHFA 1T3BA 2VLTA 7GSSA 1XCCA 5KN1A 3MSZA 5D9WA 1WOUA 1GRXA 1GTAA 3N9JA 11GSA 1EV4A 2JADA 4GSTA 3QD9A 1GNWA 1JLVA 3MYDA 2GQKA 1K0AA 2JACA 2A2PA 3GKXA 2AUVA 2AYTA 3IBHA 2XC2A 2OJLA 1T00A 1USBA 4KSOA 4EVMA 2X4AA 4ZL9A 1M9AA 4CY8A 3CTFA 2B5EA 1XW5A 3UEMA 3PINA 3O6TA 1FVJA 2C4JA 3IOSA 4CHSA 1FG4A 3SWLA 1FAAA 1O8WA 1YJ6A 2KLXA 5FT3A 5IMDA 5AIVA 12GSA 2MYGA 5C00A 2L4QA 4K5SA 1VRSD 1T4ZA 4IBPA 4QL7A 1TRVA 20GSA 2H1GA 3LXZA 17GSA 1SD8A 4AF2A 1K0BA 4Q5RA 2YNXA 3M9JA 1VF3A 4WBRD 1XBSA 2YWNA 1QQ2A 1ZZYA 1PL2A 2XBQA 4HQSA 2PBJA 4HUAA 2O85A 3BBYA 1EGOA 1C72A 5DCGA 4POKA 2GDRA 3A2XA 4EUYA 5IQYA 1TU8A 6GSVA 2VCZA 5IMCA 4NPBA 4MH3A 4ILFA 5AN1A 3LYKA 1PA3A 4NHZA 5GSSA 2GZZA 2O8VB 3LFLA 4K7NA 3E3EA 2M80A 1O6JA 1V57A 4O5QA 2CT6A 4GTUA 2YPMA 3FEUA 4LA1A 2YV9A 3VPQA 2LJRA 3UAPA 4A5PA 3D5JA 3L0HA 3WT2A 3MIXA 1WWJA 2B7JA 2QKEA 3FR3A 5ECHB 2H74A 2F9SA 2IMDA 2CV4A 1A8LA 1PKZA 5E59A 4KAEA 1HYUA 4ZBAA 1Z7RA 3ED3A 4FH8A 4YKGA 3GSSA 3FY7A 4I8BA 4O7HA 3Q6OA 1SYXA 2H1DA 3HVSA 3D21A 1YEPA 4OMVA 4L8EA 4ZBBA 2AJQB 2AHEA 3DKSA 3OR5A 4BVYB 4OO4A 2DJ3A 4BWSA 1O85A 3F3RA 4OWYA 3ZIVA 2G2QA 4FYCA 2GQMA 2YZUA 2VD1A 3CSJA 4K0GA 1ZYPA 4PX1A 2PWJA 1OAZA 5KOWA 5HFIA 1VF2A 2I1UA 1U3IA 1A0FA 1F2EA 4F0BA 4IW9A 5CYYA 4IGJA 1G0TA 4TR4A 2YN1A 2VL2C 1TI3A 5CRGA 1JLWA 4F9ZA 3TDGA 2IJYA 2JU5A 2XPDA 4K0NA 4MCUA 3PR8A 4GXZA 2OACA 2HYXA 2R2JA 3HZ8A 2VL9A 3EURA 2LRNA 3ZLPA 3NOFA 1GLPA 3GSTA 4Q5FA 2GZPA 5CO3A 3D6IA 2V6OA 1THOA 3TUEA 1T4YA 4PUAA 3ZTLA 1QXHA 2J23A 4TKYA 1UC7A 2HI7A 3GKMA 2FGXA 3UVHA 3BCIA 2CAQA 4YQVA 4RI6A 1K0MA 2GSSA 1MDKA 2IMIA 3P2AA 1SENA 5G2ZA 2R0PA 1NHOA 5BMUA 4L5LA 1WJKA 4BVYA 5CRDA 1T8EB 4RUVA 19GSA 2MBTA 3GHAA 1MEKA 3CMIA 1KEBA 1EP8A 1A2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOR A;  4WXT A;  3LEF A;  5G31 A;  4I2T A;  3K8N A;  2FWH A;  3APS A;  4NAX A;  4KND A;  3TRX A;  1SL0 B;  1AAZ A;  2KHP A;  1XOB A;  4KW6 A;  1G7O A;  3UIW A;  2LNT A;  5B6N A;  4HU9 A;  5DCH A;  4L0U A;  1KNG A;  1YEX A;  3KM6 A;  4K7I A;  3F6D A;  6GSX A;  2H73 A;  1SJI A;  4EE0 A;  4J57 E;  4KH7 A;  4EF0 A;  1OC9 A;  5COH A;  2YOI A;  3VWX A;  2DJJ A;  1ZGN A;  5B8A A;  4KGI A;  2H0G A;  3CRT A;  4XRD A;  3P7X A;  3UBL A;  1EP7 A;  1VF4 A;  1AQV A;  4XS6 A;  1AQX A;  1EGR A;  5DQY A;  3HVX A;  1TW9 A;  4OD7 A;  3MNG A;  1YKA A;  4GSS A;  4ML1 A;  1SJ6 A;  2KUC A;  5LNK e;  1RW1 A;  5IM9 A;  4O32 A;  2WGR A;  3UMA A;  4YAV A;  2K18 A;  3QFA C;  2GVP A;  4HEA 2;  2LJK A;  1ERT A;  1BQ7 A;  3KH7 A;  1DUG A;  3GX0 A;  4G10 A;  2M46 A;  4J2F A;  2VL3 A;  3O3T A;  3SBC A;  3CTG A;  2IWT A;  4EC0 A;  2JZR A;  5ECK B;  1EEJ A;  4F82 A;  5J9B A;  3M3M A;  4KDX A;  3M1G A;  14GS A;  3D22 A;  3Q19 A;  4HU7 A;  3RDW A;  5D9V A;  5ECN B;  2FD3 A;  1AQW A;  2FA8 A;  3EMP A;  1Z9H A;  2K6V A;  3KMN A;  4TN8 A;  3H1N A;  5F06 A;  2GTU A;  5JCU A;  4WR4 A;  4KE3 A;  2LNS A;  5IMV A;  2ON5 A;  5ECQ B;  2IL3 A;  1G7E A;  1Z7P A;  1XOA A;  3KGK A;  1O8X A;  2NPB A;  1YDK A;  3ERF A;  3CSH A;  5IPH A;  2YWM A;  5AIX A;  6GST A;  3JCM L;  2WJU A;  1XWG A;  3A2W A;  2L57 A;  3F3Q A;  5JWO B;  3C1S A;  1AIU A;  1S3D A;  4AJ6 A;  1XW9 A;  2VIM A;  3DEX A;  2CVD A;  3GKK A;  1ERV A;  5IOX A;  2OA7 A;  2YP6 A;  3KTL A;  1K0D A;  4G2E A;  3FR9 A;  2OKA A;  2P5R A;  2H1B A;  4NMU A;  4TOP A;  4EL1 A;  3C71 A;  2I81 A;  1F6M C;  2RM5 A;  1ML6 A;  1TU7 A;  2NBS A;  2FY6 A;  3L4N A;  1A24 A;  2GGT A;  3I43 A;  4JRR A;  2IN3 A;  1GLQ A;  2LEG A;  2PMT A;  3IAS 2;  2ES7 A;  2HSH A;  4V1A p;  1THX A;  2CA8 A;  1MTC A;  2C8U A;  1OKT A;  5D9T A;  4MPG A;  3P90 A;  3UOM A;  2BJX A;  3LWA A;  4YAP A;  3L9U A;  2FWG A;  2H0I A;  2VLV A;  3HKR A;  4MMM A;  2DLX A;  4N10 A;  4OFT A;  4JR6 A;  3C1R A;  1ACV A;  3EU3 A;  3EMX A;  2GT6 A;  3GA4 A;  4IJ3 A;  5DQS A;  3FZ5 A;  2VAF A;  3TB2 A;  3EWL A;  4ID0 A;  1GUK A;  2P5Q A;  3ZYW A;  4MJE A;  2YCD A;  4JU5 A;  5DJM A;  1LBK A;  1YF1 A;  4Q5N A;  1MDJ A;  4D73 B;  2RII A;  3F4R A;  4ML6 A;  5DAK B;  1M2B A;  1GH2 A;  2YJ7 A;  1FOV A;  4Q5Q A;  1TK5 B;  3GX8 A;  1RK4 A;  2BMX A;  3TJF A;  2JZT A;  2PER A;  3IK7 A;  2H8L A;  4WR5 A;  3DML A;  4ACS A;  4GLT A;  4JBB A;  3QR6 A;  2PVQ A;  1GSE A;  1ZMA A;  4ECB A;  2H76 A;  2X99 A;  1CQG A;  2A2R A;  2EIR A;  3KD0 A;  2LQO A;  5H5S A;  1TXX A;  4OCF A;  3GH9 A;  3QMX A;  2H70 A;  3A5W A;  3GKN A;  2R4V A;  1GSQ A;  2B1L A;  3QAV A;  1K0N A;  2CVK A;  3EYT A;  3GTU B;  1PGT A;  1XWB A;  3FYG A;  2QC7 A;  1TRS A;  1O81 A;  4MH2 A;  2IMF A;  3F63 A;  5CRH A;  1IYH A;  3VUR A;  3BOA A;  4JR4 A;  4DSR A;  1WE0 A;  2GSQ A;  1XZO A;  2O7K A;  3G7J A;  4LMV A;  5IMF A;  2YV7 A;  3RAZ A;  2X8H A;  2PPT A;  3ZIJ A;  3M0F A;  4D73 A;  3GUS A;  4OFN A;  4IS0 A;  2H71 A;  2VCT A;  2H19 A;  1BYE A;  3ME8 A;  5DAK A;  4JZQ A;  4DVC A;  4GQF A;  1EEM A;  1A2M A;  1FB0 A;  3IDV A;  4O5R A;  5J41 A;  4GCI A;  1EV9 A;  1TKD B;  5G5E A;  2A4V A;  3RPP A;  2RUF A;  4K9Z A;  13GS A;  3WGX A;  2X64 A;  2VM1 A;  4GWR A;  3GUR A;  1GSY A;  1WRY A;  1URM A;  2FLS A;  3TKR A;  1SK2 A;  1YQ1 A;  4PQI A;  1LU4 A;  1GTB A;  1QK8 A;  1QUW A;  2WCI A;  1V58 A;  1W4V A;  1TRW A;  3H8Q A;  5DAL A;  2X8C A;  3ZRE A;  1UA5 A;  4Z7X A;  2AAW A;  5E4W A;  5EL8 A;  2LQQ A;  5JWQ B;  3HJM A;  4PNF A;  3KP9 A;  4GQC A;  4X0X A;  2MMA A;  5D9X A;  4EDY A;  5F0G A;  5IIZ A;  3GH6 A;  4XRA A;  2REM A;  1TTZ A;  3GTU A;  1N2A A;  2DC5 A;  4H86 A;  4IN0 A;  4TRX A;  4ECI A;  3Q18 A;  4XS4 B;  4K6X A;  4TR0 A;  3UBK A;  1OC8 A;  4XTS A;  1T1V A;  3WYW A;  4ECJ A;  2B6M A;  1DE2 A;  2L6C A;  2I4A A;  4ZB9 A;  5J3R A;  1TK8 B;  4EO3 A;  1A23 A;  1RQM A;  2FHE A;  5IMZ A;  8GSS A;  3DVX A;  2DIY A;  3HD5 A;  4AJ8 A;  1B48 A;  2LRC A;  4POL A;  1Q4J A;  1K0O A;  5CP1 A;  5A4V A;  1MDI A;  2GLR A;  4OO5 A;  4NWY A;  1Z3E A;  3O76 A;  5D93 A;  2VCX A;  3UJ1 A;  2OAD A;  1J0F A;  3FZ4 A;  1XW6 A;  2ON7 A;  3EC3 A;  1SK0 A;  1TDI A;  5D96 A;  1PSQ A;  1R4W A;  1YKC A;  4JE1 A;  1OC9 B;  4LL1 B;  3TKS E;  1DBY A;  2GS3 A;  1DE1 A;  2IME A;  1GNE A;  2HRF A;  3FZA A;  1MD3 A;  3IHQ A;  1SKR B;  1SL1 B;  2J9H A;  6GSW A;  4BPY A;  4MF6 A;  4MK3 A;  5DVB A;  2DJ2 A;  4NV5 A;  1U87 A;  5DBQ A;  4K1F A;  2O87 A;  5B8B A;  1OE8 A;  1PX7 A;  2C3Q A;  2CZ3 A;  4O92 A;  5JCW A;  3F4S A;  2L4C A;  1A8Y A;  1K3L A;  2VUP A;  3EVI A;  2O89 A;  2H72 A;  2FCH A;  2VO4 A;  5F07 A;  5IO0 A;  4XS4 A;  4KSM A;  1JZR A;  1DSB A;  5CRE A;  3LXT A;  5GZZ B;  4AJ7 A;  1GUH A;  4E8E A;  1F9M A;  3BCK A;  3HYP A;  3VI5 A;  3GL3 A;  5CAX A;  1M9B A;  3HJO A;  3D4M A;  2MZC A;  5AGY A;  3LGC A;  2E2G A;  2PN8 A;  4HOJ A;  1PMT A;  4WF5 A;  2DIZ A;  2FWF A;  2DJ0 A;  4TW5 A;  1PN9 A;  2L5O A;  3DGQ A;  2KP2 A;  1QMV A;  2NTO A;  2TRX A;  5KN3 A;  4XCS A;  3VWV A;  3G9B A;  2CVB A;  2GST A;  5ELA A;  4GSN A;  6GSU A;  2VCW A;  2GSR A;  1GTI A;  3I69 A;  1E2Y A;  4CW9 A;  3VFI A;  1WPI A;  1GSD A;  2B5X A;  2RUE A;  3RPN A;  4YH2 A;  3GV1 A;  3LQ7 A;  3HJP A;  1XPV A;  2E7P A;  5ECS A;  3DVW A;  1LJR A;  1B4Q A;  2VCQ A;  5JCG A;  1X0R A;  1JZW A;  5GAN D;  4PQH A;  1XVW A;  4XHM A;  1FO5 A;  5G5F A;  5HR1 A;  5EVO A;  1PD2 1;  1JZD A;  1X5C A;  3HXS A;  1HNA A;  3WGE A;  2H30 A;  1GUM A;  1GWC A;  3WT1 A;  2L5L A;  3TKS A;  2WDU A;  4NHW A;  4V2L A;  2LV3 A;  3ME7 A;  1ZYE A;  1ILO A;  4G9H A;  4TXV A;  4N11 A;  1TK0 B;  2LST A;  1GTU A;  2C1Y A;  1KBN A;  5ABR A;  2DML A;  4P3Y B;  2F8A A;  1R7H A;  5IMA A;  4OFM A;  5ECM B;  1K3Y A;  2X8G A;  5H5Q A;  3ZVJ D;  4HJM A;  3D0Z A;  1HNC A;  3ZML A;  5HR2 A;  4RQX A;  1E6B A;  3E9J B;  3APQ A;  1AXD A;  1U3A A;  4XS1 A;  4F03 A;  2V1M A;  1MD4 A;  2E2M A;  2OBK A;  2ZUP A;  3KJY A;  3VK9 A;  2YJH A;  2C0E A;  2E0Q A;  3UVT A;  4MZC A;  1BED A;  16GS A;  3QAG A;  1S3A A;  22GS A;  1NW2 A;  4QL9 A;  3NIV A;  1F37 A;  3KTB A;  1AW9 A;  1XWA A;  1R5P A;  2V6K A;  3ZVJ A;  1I5G A;  4RI7 A;  1FHE A;  1GSF A;  2H1A A;  2TRC P;  3UAR A;  4HZ2 A;  4MJC A;  2Z9S A;  4K7O A;  1ST9 A;  1R5A A;  1M0U A;  4I2U A;  3RHB A;  3GRX A;  2K8S A;  4KCA A;  4BL7 A;  4KB3 A;  1OVN A;  4MPF A;  2EIQ A;  4ZL8 A;  1AC1 A;  4YQM A;  3EE2 A;  1SL2 B;  1J08 A;  3M8N A;  2I9H A;  3GFK A;  3H93 A;  1J9B A;  2H75 A;  3KEB A;  3WD6 A;  1B4P A;  4EDZ A;  1A0R P;  1XWC A;  4RQR A;  2PUK C;  2AB6 A;  4ISD A;  4N0Z A;  3APO A;  2EIO A;  5KN0 A;  3TCO A;  2WS2 A;  4QQ7 A;  3HVV A;  3VWW A;  5D73 A;  1K3O A;  3FHK A;  1ABA A;  4X1U A;  5DJL A;  2XBI A;  4KDY A;  3J7Y b;  4HI7 A;  1TRU A;  3KP8 A;  2LJA A;  4ZB8 A;  3TOT A;  4K8M A;  3HHV A;  3HZ4 A;  5ECL B;  4JED A;  4DSQ A;  3E0U A;  4ZXG A;  2HXK A;  3EIN A;  2R3X A;  2F8F A;  4X43 A;  1PRX A;  1SYR A;  2JSZ A;  5JWR B;  1OC3 A;  4FO5 A;  2QSI A;  3F6F A;  1G6Y A;  3W6G A;  5ID2 B;  3KCM A;  3L78 A;  1ZYQ B;  4WET A;  1WP0 A;  2YWO A;  4HJ2 A;  1F3B A;  3PGT A;  2H6X A;  1X9S B;  4IP6 A;  2C0D A;  2HT9 A;  3F0I A;  4BWQ A;  4MF5 A;  3HCZ A;  1V40 A;  2H6Y A;  18GS A;  5INY A;  5EPF A;  1PQN A;  2H0H A;  3FZ9 A;  1PKW A;  4L5O A;  4MLY A;  5DAL B;  1WMJ A;  2WFC A;  4NV2 A;  4V1A g;  3W8J A;  4PQ1 A;  4MF7 A;  1W89 A;  4KA0 A;  3QFB C;  4TR3 A;  2DMM A;  6GSY A;  3IE3 A;  2G0F A;  1SU9 A;  1B9Y C;  3TJB A;  3PH9 A;  1YZX A;  3S9F A;  4DSS B;  1OKD A;  1GSU A;  3VLN A;  1XWK A;  2OE3 A;  1Q98 A;  4LLR A;  2PVO C;  2LTK A;  3UL3 A;  4GRF A;  3CXG A;  2HE3 A;  3I6A A;  2FUG 2;  4AGS A;  2LKU A;  1O73 A;  3DRN A;  2KOK A;  1HQO A;  5GAP D;  5IPG A;  4WF4 A;  2R6K A;  4YQU A;  4G19 A;  1HD2 A;  1Y6E A;  3C7M A;  3TJK A;  1H4O A;  4ZIL A;  1BAY A;  4ZB6 A;  3WGD A;  5ID2 A;  3TRP A;  3BD2 A;  1QGV A;  3LJR A;  3L9V A;  3C73 A;  2AV4 A;  3C8E A;  2FNO A;  2XPE A;  3F8U A;  2D2Z A;  1BJX A;  3AY8 A;  5ELG A;  5L71 A;  1XVQ A;  2CX3 A;  3MAK A;  1T7P B;  4IP1 A;  4I6X A;  2DSA A;  1FVK A;  5IOW A;  4IVF A;  4I97 A;  2VCV A;  3F4T A;  2K8V A;  2YWI A;  2H01 A;  3TKS C;  3QAW A;  3VI7 A;  5HR3 A;  3M9K A;  5J9C A;  2P0G A;  1BX9 A;  1Z6M A;  3LYP A;  2OBI A;  4DSS A;  3Q74 A;  3L9S A;  4CDO A;  1ERW A;  3BJ5 A;  3U5R E;  2JSY A;  5LD0 A;  3GMF A;  3IC4 A;  2R5G A;  1M2A A;  3DIE A;  2K9F A;  4KCE A;  1M7T A;  3GN3 A;  3ZFL A;  1TJD A;  1G6W A;  1VF1 A;  3H79 A;  1EOG A;  4MJB A;  1GL8 A;  1QFN A;  1Z6N A;  3FK8 A;  2IFQ B;  3VWU A;  2M72 A;  2ZNM A;  2ZCT A;  1R26 A;  4MZW A;  1OYJ A;  1X5D A;  3ZFB A;  1ON4 A;  5FWG A;  3TRQ A;  1I9D A;  3FRC A;  3TGZ A;  4LL4 B;  2OE1 A;  1XIY A;  5F8B A;  1Y25 A;  2IMK A;  4MA9 A;  2C80 A;  3GYK A;  5ECR B;  5CNW A;  5HQP A;  5D8I A;  2NVL A;  1U88 A;  1XFL A;  2C3T A;  2FA4 A;  2N5F A;  4TR1 B;  4FIW A;  3TKP A;  2DJK A;  4ZL7 A;  3HDC A;  4KX4 A;  1TOF A;  2I3Y A;  2NDO A;  1ZL9 A;  4PUF C;  2V2G A;  2TIR A;  1SK1 A;  3IAM 2;  5DDL A;  1Z5Y E;  3KH9 A;  3ERG A;  5H5R A;  4V2M A;  2VOC A;  5B6M A;  3LSZ A;  3EU4 A;  4DEJ A;  2HZF A;  2V32 A;  2CX4 A;  5HFG A;  3GIX A;  4OCE A;  2HFD A;  2V41 A;  5G1K A;  4MJA A;  1WIK A;  3P8W A;  4MDC A;  2GZY A;  2F3M A;  3DD3 A;  4TXO B;  5ECI B;  5KEJ A;  4IQ1 A;  4K2D A;  1PX6 A;  4HDE A;  2B1K A;  2GT5 A;  1HNB A;  2IFQ A;  3DWV A;  3FW2 A;  1NM3 A;  2HRN A;  2GQL A;  3IXR A;  2EC4 A;  5KN2 A;  4BA7 A;  2LS5 A;  2RLI A;  2ALB A;  4N30 A;  2B5Y A;  2WRT A;  3HY2 A;  3QCP A;  4HZ4 A;  4ULX A;  5B7C A;  3GNJ A;  5C04 A;  3LG6 A;  4IHU A;  4PXO A;  2HSY A;  9GSS A;  2JZS A;  4POB A;  1EWX A;  3N5O A;  4XIH A;  3DXB A;  2QGV A;  4TR1 A;  4KUN A;  3QPM A;  2N5B A;  2F51 A;  5G30 A;  2YAN A;  2MBS A;  3ZL5 A;  1UN2 A;  4IJI A;  3F9U A;  2B7K A;  3VPT A;  1NHY A;  1AUC A;  3H4K A;  1V98 A;  1SD9 A;  3TOU A;  1XXU A;  1SJZ A;  2RM6 A;  1TP9 A;  5CRW A;  3NZN A;  1GSS A;  3TKQ A;  4LMW A;  3KZQ A;  5J4U A;  1KTE A;  4J56 E;  3US3 A;  4WEY A;  1H75 A;  3J7Y k;  2R37 A;  1YF0 A;  1SKS B;  3CRU A;  4ECC A;  2C0G A;  2L6D A;  4POM A;  4HQZ A;  4MP4 A;  1V9W A;  2HNL A;  2CQ9 A;  3RHC A;  4TXO A;  2HLS A;  2VM2 A;  5HFK A;  2CZ2 A;  2MMN A;  2WB9 A;  3ZRD A;  1JFU A;  3R2Q A;  3KMO A;  2OE0 A;  4PUR A;  3A3T A;  3CYN A;  3KXO A;  1TI1 A;  4I5Q A;  10GS A;  3MWH A;  3G7I A;  1VGL A;  1CQH A;  2DBC A;  3ERW A;  3CBU A;  5IO2 A;  2DJ1 A;  2HZE B;  3TJG A;  1B9X C;  5J5N A;  1IYI A;  4L0W A;  4FYU A;  4FYB A;  3ZMK A;  4WBJ A;  5HR0 A;  2WUL A;  4IQA A;  4EXJ A;  3GL5 A;  3FKF A;  4F0C A;  5G1L A;  4IEL A;  5LCZ A;  1F3A A;  1BG5 A;  4NXI A;  2LUS A;  2YZH A;  1X9W B;  1PL1 A;  3IK9 A;  1EZK A;  5A4U A;  1FB6 A;  3A2V A;  1UVZ A;  3IRA A;  4ZBD A;  3CSI A;  5GST A;  1ERU A;  2PU9 C;  2A2S A;  5ECP B;  2VL2 A;  4GF0 A;  2CAI A;  2B3S A;  4BVX A;  3HA9 A;  2VLU A;  2L59 A;  4MZB A;  6GSS A;  1FW1 A;  2C0F A;  3I9V 2;  5ECO B;  2IPA A;  3U6V A;  2MMZ A;  1YY7 A;  1M2D A;  3MDK A;  3QDN A;  2MMO A;  1ZCP A;  4KDU A;  1ZOF A;  1SKW B;  1EOH A;  2JL4 A;  1U6T A;  1GP1 A;  1GUL A;  2BTO T;  5AIS A;  4TVE A;  3ISO A;  3IR4 A;  5FHI A;  5EY6 A;  3D4T A;  3IPZ A;  2N5A A;  3DYR A;  3FR6 A;  2H66 A;  2LRT A;  2VD0 A;  2FWE A;  1JHB A;  1M99 A;  5ENU A;  3ZZX A;  1K0C A;  5A5K A;  2HZE A;  4HS1 A;  4N0V A;  4MAB A;  4PGT A;  1X5E A;  2PGT A;  1O7U A;  2H6Z A;  3G7Y A;  2C3N A;  1V2A A;  2P31 A;  2IIY A;  1OE7 A;  1NSW A;  2KP1 A;  4EKZ A;  4PNG A;  4WKW A;  4F2I A;  4E8H A;  1X9M B;  3V1W A;  3KIJ A;  1N8J A;  1A2L A;  3W8S A;  3IA1 A;  1B8X A;  3QOU A;  4V2N A;  4ZIJ A;  3IV4 A;  1S3C A;  1JZO A;  3RBT A;  2WZ9 A;  5F05 A;  4IKH A;  3ZIT A;  3TJJ A;  5A4W A;  2XHF A;  1T3B A;  2VLT A;  7GSS A;  1XCC A;  5KN1 A;  3MSZ A;  5D9W A;  1WOU A;  1GRX A;  1GTA A;  3N9J A;  11GS A;  1EV4 A;  2JAD A;  4GST A;  3QD9 A;  1GNW A;  1JLV A;  2GQK A;  1K0A A;  2JAC A;  3GKX A;  2AUV A;  2AYT A;  3IBH A;  2XC2 A;  2OJL A;  1T00 A;  1USB A;  4KSO A;  4EVM A;  4ZL9 A;  1M9A A;  3CTF A;  2B5E A;  1XW5 A;  3UEM A;  3PIN A;  3O6T A;  1FVJ A;  2C4J A;  3IOS A;  4CHS A;  1FG4 A;  3SWL A;  1FAA A;  1O8W A;  1YJ6 A;  2KLX A;  5FT3 A;  5IMD A;  5AIV A;  12GS A;  2MYG A;  5C00 A;  2L4Q A;  1VRS D;  1T4Z A;  4IBP A;  4QL7 A;  1TRV A;  20GS A;  2H1G A;  3LXZ A;  17GS A;  1SD8 A;  4AF2 A;  1K0B A;  4Q5R A;  2YNX A;  3M9J A;  1VF3 A;  4WBR D;  1XBS A;  2YWN A;  1QQ2 A;  1ZZY A;  1PL2 A;  2XBQ A;  4HQS A;  2PBJ A;  4HUA A;  2O85 A;  3BBY A;  1EGO A;  1C72 A;  5DCG A;  4POK A;  2GDR A;  3A2X A;  4EUY A;  5IQY A;  1TU8 A;  6GSV A;  2VCZ A;  5IMC A;  4NPB A;  4MH3 A;  4ILF A;  5AN1 A;  3LYK A;  1PA3 A;  4NHZ A;  5GSS A;  2GZZ A;  2O8V B;  3LFL A;  4K7N A;  3E3E A;  2M80 A;  1O6J A;  1V57 A;  2CT6 A;  4GTU A;  2YPM A;  3FEU A;  4LA1 A;  2YV9 A;  3VPQ A;  2LJR A;  3UAP A;  3D5J A;  3L0H A;  3WT2 A;  1WWJ A;  2B7J A;  2QKE A;  3FR3 A;  5ECH B;  2H74 A;  2F9S A;  2IMD A;  2CV4 A;  1A8L A;  1PKZ A;  5E59 A;  4KAE A;  1HYU A;  4ZBA A;  1Z7R A;  3ED3 A;  4FH8 A;  3GSS A;  3FY7 A;  4I8B A;  4O7H A;  3Q6O A;  1SYX A;  2H1D A;  3HVS A;  3D21 A;  1YEP A;  4OMV A;  4L8E A;  4ZBB A;  2AJQ B;  2AHE A;  3DKS A;  3OR5 A;  4OO4 A;  2DJ3 A;  4BWS A;  1O85 A;  3F3R A;  4OWY A;  3ZIV A;  2G2Q A;  4FYC A;  2GQM A;  2YZU A;  2VD1 A;  3CSJ A;  4K0G A;  4PX1 A;  2PWJ A;  1OAZ A;  5HFI A;  1VF2 A;  2I1U A;  1U3I A;  1A0F A;  1F2E A;  4F0B A;  4IW9 A;  5CYY A;  4IGJ A;  1G0T A;  4TR4 A;  2YN1 A;  2VL2 C;  1TI3 A;  5CRG A;  1JLW A;  4F9Z A;  3TDG A;  2IJY A;  2JU5 A;  2XPD A;  4K0N A;  4MCU A;  3PR8 A;  4GXZ A;  2OAC A;  2HYX A;  2R2J A;  3HZ8 A;  2VL9 A;  3EUR A;  2LRN A;  3ZLP A;  3NOF A;  1GLP A;  3GST A;  4Q5F A;  2GZP A;  5CO3 A;  3D6I A;  2V6O A;  1THO A;  3TUE A;  1T4Y A;  4PUA A;  3ZTL A;  1QXH A;  2J23 A;  4TKY A;  1UC7 A;  2HI7 A;  3GKM A;  2FGX A;  3UVH A;  3BCI A;  2CAQ A;  4YQV A;  4RI6 A;  1K0M A;  2GSS A;  1MDK A;  2IMI A;  3P2A A;  1SEN A;  5G2Z A;  1NHO A;  4L5L A;  1WJK A;  4BVY A;  5CRD A;  1T8E B;  4RUV A;  19GS A;  2MBT A;  3GHA A;  1MEK A;  3CMI A;  1KEB A;  1EP8 A;  1A2J A; 
#chains in the Genus database with same CATH topology
 3LOR A;  4WXT A;  3LEF A;  5G31 A;  4I2T A;  3K8N A;  2FWH A;  3APS A;  4NAX A;  4KND A;  3TRX A;  1SL0 B;  1AAZ A;  2KHP A;  1XOB A;  4KW6 A;  1G7O A;  3UIW A;  2LNT A;  5B6N A;  4HU9 A;  5DCH A;  4L0U A;  1KNG A;  1YEX A;  3KM6 A;  4K7I A;  3F6D A;  6GSX A;  2H73 A;  1SJI A;  4EE0 A;  4J57 E;  4KH7 A;  4EF0 A;  1OC9 A;  5COH A;  2YOI A;  3VWX A;  2DJJ A;  1ZGN A;  1M3I A;  5B8A A;  4KGI A;  2H0G A;  3CRT A;  4XRD A;  3P7X A;  3UBL A;  1EP7 A;  1VF4 A;  1AQV A;  4XS6 A;  1AQX A;  1EGR A;  5DQY A;  3HVX A;  1TW9 A;  4OD7 A;  3MNG A;  1YKA A;  4GSS A;  4ML1 A;  1SJ6 A;  2KUC A;  5LNK e;  1RW1 A;  5IM9 A;  4O32 A;  2WGR A;  3UMA A;  4YAV A;  2K18 A;  3QFA C;  2GVP A;  4HEA 2;  2LJK A;  1ERT A;  1BQ7 A;  3KH7 A;  1DUG A;  3GX0 A;  4G10 A;  2M46 A;  4J2F A;  2VL3 A;  3O3T A;  3SBC A;  3CTG A;  2IWT A;  4EC0 A;  2JZR A;  5ECK B;  5KOX A;  1EEJ A;  4F82 A;  5J9B A;  4CY6 A;  3M3M A;  4KDX A;  3M1G A;  14GS A;  3D22 A;  3Q19 A;  4HU7 A;  3RDW A;  5D9V A;  5ECN B;  2FD3 A;  1AQW A;  2FA8 A;  3EMP A;  1Z9H A;  2K6V A;  3KMN A;  4TN8 A;  3H1N A;  5F06 A;  2GTU A;  5JCU A;  4WR4 A;  4KE3 A;  2LNS A;  5IMV A;  2ON5 A;  5ECQ B;  2IL3 A;  1G7E A;  1Z7P A;  1XOA A;  3KGK A;  1O8X A;  2NPB A;  1YDK A;  3ERF A;  3CSH A;  5IPH A;  2YWM A;  5AIX A;  6GST A;  3JCM L;  2WJU A;  1XWG A;  3A2W A;  2L57 A;  3F3Q A;  5JWO B;  3C1S A;  1AIU A;  1S3D A;  4AJ6 A;  1XW9 A;  2VIM A;  2HRA A;  3DEX A;  2CVD A;  3GKK A;  1ERV A;  5IOX A;  2OA7 A;  2YP6 A;  3KTL A;  1K0D A;  4G2E A;  3FR9 A;  4HSC X;  2OKA A;  2P5R A;  2H1B A;  4NMU A;  4TOP A;  4EL1 A;  3C71 A;  2I81 A;  1F6M C;  2RM5 A;  1ML6 A;  1TU7 A;  2NBS A;  2FY6 A;  3L4N A;  1A24 A;  2GGT A;  3I43 A;  4JRR A;  2IN3 A;  1GLQ A;  2LEG A;  2PMT A;  3IAS 2;  2ES7 A;  2HSH A;  4V1A p;  1THX A;  2CA8 A;  1MTC A;  2C8U A;  1OKT A;  5D9T A;  4MPG A;  3P90 A;  3UOM A;  2BJX A;  3LWA A;  4YAP A;  3L9U A;  2FWG A;  2H0I A;  2VLV A;  3HKR A;  4MMM A;  2DLX A;  4N10 A;  4OFT A;  4JR6 A;  3C1R A;  1ACV A;  3EU3 A;  3EMX A;  2GT6 A;  3HVN A;  1PN0 A;  3GA4 A;  4IJ3 A;  5DQS A;  3FZ5 A;  2VAF A;  3TB2 A;  3EWL A;  4ID0 A;  1GUK A;  2P5Q A;  3ZYW A;  4MJE A;  2YCD A;  4JU5 A;  5DJM A;  1LBK A;  1YF1 A;  4Q5N A;  4Z2T A;  1MDJ A;  4D73 B;  2RII A;  3F4R A;  4ML6 A;  5DAK B;  1M2B A;  1GH2 A;  2YJ7 A;  1FOV A;  1ZYN A;  4Q5Q A;  1TK5 B;  3GX8 A;  1RK4 A;  2BMX A;  3TJF A;  2JZT A;  2PER A;  3IK7 A;  2H8L A;  4WR5 A;  3DML A;  4ACS A;  4EIP A;  4GLT A;  4JBB A;  3QR6 A;  2PVQ A;  1GSE A;  1ZMA A;  4ECB A;  2H76 A;  2X99 A;  1CQG A;  2A2R A;  2EIR A;  3KD0 A;  2LQO A;  5H5S A;  1TXX A;  4OCF A;  3GH9 A;  3QMX A;  2H70 A;  2HSM A;  3A5W A;  3GKN A;  2R4V A;  1GSQ A;  2B1L A;  4G0L A;  3QAV A;  1K0N A;  2CVK A;  4EIQ A;  3EYT A;  3GTU B;  1PGT A;  1XWB A;  3FYG A;  2QC7 A;  1TRS A;  1O81 A;  4MH2 A;  2IMF A;  3F63 A;  5CRH A;  1IYH A;  3VUR A;  3BOA A;  4JR4 A;  4DSR A;  1WE0 A;  2GSQ A;  1XZO A;  2O7K A;  3G7J A;  4LMV A;  5IMF A;  2YV7 A;  3RAZ A;  2X8H A;  2PPT A;  3ZIJ A;  3M0F A;  4D73 A;  3GUS A;  4OFN A;  4IS0 A;  2H71 A;  2VCT A;  2H19 A;  1BYE A;  3ME8 A;  5DAK A;  4JZQ A;  4DVC A;  4GQF A;  1EEM A;  1A2M A;  1FB0 A;  3IDV A;  4O5R A;  3CQF A;  5J41 A;  4GCI A;  1EV9 A;  1TKD B;  5G5E A;  2A4V A;  3RPP A;  2RUF A;  4K9Z A;  13GS A;  3WGX A;  2X64 A;  2VM1 A;  4GWR A;  3GUR A;  1GSY A;  1WRY A;  1URM A;  2FLS A;  3TKR A;  1SK2 A;  1YQ1 A;  4PQI A;  1LU4 A;  1GTB A;  1QK8 A;  1QUW A;  2WCI A;  1V58 A;  1W4V A;  1TRW A;  3H8Q A;  5DAL A;  2X8C A;  3ZRE A;  1UA5 A;  4Z7X A;  2AAW A;  5E4W A;  5EL8 A;  2LQQ A;  5JWQ B;  3HJM A;  4PNF A;  3KP9 A;  4GQC A;  4X0X A;  2MMA A;  5D9X A;  4EDY A;  2QA1 A;  5F0G A;  5IIZ A;  3GH6 A;  4XRA A;  4KF9 A;  2REM A;  1TTZ A;  3GTU A;  1N2A A;  2DC5 A;  4H86 A;  4IN0 A;  4TRX A;  4ECI A;  3Q18 A;  4XS4 B;  4K6X A;  4TR0 A;  3UBK A;  1OC8 A;  4XTS A;  2DKI A;  1T1V A;  3WYW A;  4ECJ A;  2B6M A;  1DE2 A;  2L6C A;  2I4A A;  4ZB9 A;  5J3R A;  1TK8 B;  4EO3 A;  1A23 A;  1RQM A;  2FHE A;  5IMZ A;  8GSS A;  3DVX A;  2DIY A;  3HD5 A;  4AJ8 A;  1B48 A;  2LRC A;  4POL A;  1Q4J A;  1K0O A;  5CP1 A;  5A4V A;  1MDI A;  2GLR A;  4OO5 A;  4NWY A;  3EPT A;  1Z3E A;  3O76 A;  5D93 A;  2VCX A;  3UJ1 A;  2OAD A;  1J0F A;  3FZ4 A;  1XW6 A;  2ON7 A;  3EC3 A;  1SK0 A;  3PPU A;  2X49 A;  1TDI A;  5D96 A;  1PSQ A;  1R4W A;  1YKC A;  4JE1 A;  1OC9 B;  4LL1 B;  3TKS E;  1DBY A;  2GS3 A;  1DE1 A;  2IME A;  1GNE A;  2HRF A;  4FQU A;  3FZA A;  1MD3 A;  3IHQ A;  1SKR B;  1SL1 B;  2J9H A;  4G0I A;  6GSW A;  4BPY A;  4MF6 A;  4MK3 A;  5DVB A;  2DJ2 A;  4NV5 A;  1U87 A;  5DBQ A;  4K1F A;  2O87 A;  5B8B A;  1OE8 A;  1PX7 A;  2C3Q A;  2CZ3 A;  4O92 A;  5JCW A;  3F4S A;  2L4C A;  1A8Y A;  5BRT A;  1K3L A;  2VUP A;  3EVI A;  2O89 A;  2H72 A;  2FCH A;  2VO4 A;  4O5U A;  5F07 A;  5IO0 A;  4XS4 A;  4KSM A;  3R3E A;  1JZR A;  1DSB A;  5CRE A;  3LXT A;  5GZZ B;  4AJ7 A;  1GUH A;  4E8E A;  1F9M A;  3BCK A;  3HYP A;  3VI5 A;  3GL3 A;  5CAX A;  1M9B A;  3HJO A;  3D4M A;  2MZC A;  5AGY A;  3LGC A;  2E2G A;  2PN8 A;  4HOJ A;  1PMT A;  4WF5 A;  2DIZ A;  2FWF A;  2DJ0 A;  4TW5 A;  1PN9 A;  2L5O A;  3DGQ A;  2KP2 A;  1QMV A;  1XG8 A;  2NTO A;  2TRX A;  5KN3 A;  4XCS A;  3VWV A;  3G9B A;  4Z2R A;  2CVB A;  2A4H A;  2QA2 A;  2GST A;  5ELA A;  4GSN A;  6GSU A;  2VCW A;  2GSR A;  1GTI A;  3I69 A;  1E2Y A;  4CW9 A;  3VFI A;  1WPI A;  1GSD A;  2B5X A;  2RUE A;  3RPN A;  3LQ7 A;  3GV1 A;  4YH2 A;  3HJP A;  1XPV A;  2E7P A;  5ECS A;  3DVW A;  1LJR A;  1B4Q A;  2VCQ A;  5JCG A;  1X0R A;  1JZW A;  5GAN D;  4PQH A;  1XVW A;  4XHM A;  1FO5 A;  5G5F A;  5HR1 A;  5EVO A;  1PD2 1;  1JZD A;  1X5C A;  3HXS A;  1HNA A;  3WGE A;  2H30 A;  4BL7 B;  1GUM A;  1GWC A;  3WT1 A;  2L5L A;  2R0C A;  3TKS A;  2WDU A;  4NHW A;  4V2L A;  2LV3 A;  3ME7 A;  1ZYE A;  1ILO A;  4G9H A;  4TXV A;  4N11 A;  1TK0 B;  2LST A;  1GTU A;  2C1Y A;  1KBN A;  5ABR A;  2DML A;  4P3Y B;  2F8A A;  1R7H A;  5IMA A;  4OFM A;  5ECM B;  1K3Y A;  2X8G A;  4ICY A;  5H5Q A;  3ZVJ D;  4HJM A;  3D0Z A;  1HNC A;  3ZML A;  5HR2 A;  3FMW A;  4RQX A;  1E6B A;  3E9J B;  3APQ A;  1AXD A;  1U3A A;  4XS1 A;  4F03 A;  2V1M A;  1MD4 A;  2E2M A;  2OBK A;  2ZUP A;  3KJY A;  3VK9 A;  2YJH A;  2C0E A;  2E0Q A;  3UVT A;  4MZC A;  1BED A;  16GS A;  4G0K A;  3QAG A;  1S3A A;  22GS A;  1NW2 A;  4QL9 A;  3NIV A;  1F37 A;  3KTB A;  1AW9 A;  1XWA A;  1R5P A;  2V6K A;  3ZVJ A;  1I5G A;  4RI7 A;  1FHE A;  1GSF A;  4K2X A;  2H1A A;  2TRC P;  3UAR A;  4HZ2 A;  4MJC A;  2Z9S A;  4K7O A;  1ST9 A;  1R5A A;  1M0U A;  4I2U A;  3RHB A;  3GRX A;  2K8S A;  4KCA A;  4BL7 A;  4KB3 A;  1OVN A;  4MPF A;  2EIQ A;  4ZL8 A;  1AC1 A;  4YQM A;  3EE2 A;  1SL2 B;  1J08 A;  3M8N A;  2I9H A;  3GFK A;  3H93 A;  1J9B A;  2H75 A;  3KEB A;  3WD6 A;  1B4P A;  4EDZ A;  1A0R P;  1XWC A;  4RQR A;  2PUK C;  2AB6 A;  4ISD A;  4N0Z A;  3APO A;  2EIO A;  5KN0 A;  3TCO A;  2WS2 A;  4QQ7 A;  3HVV A;  3VWW A;  5D73 A;  1K3O A;  3FHK A;  1ABA A;  4X1U A;  5DJL A;  2XBI A;  4KDY A;  3J7Y b;  4HI7 A;  1TRU A;  3KP8 A;  2LJA A;  4ZB8 A;  3TOT A;  4K8M A;  3HHV A;  3HZ4 A;  5ECL B;  4JED A;  4DSQ A;  3E0U A;  4ZXG A;  2HXK A;  3EIN A;  2R3X A;  2F8F A;  4X43 A;  1PRX A;  1SYR A;  2JSZ A;  5JWR B;  1OC3 A;  4FO5 A;  2QSI A;  3F6F A;  1G6Y A;  3W6G A;  5ID2 B;  3KCM A;  3L78 A;  1ZYQ B;  4WET A;  1WP0 A;  2YWO A;  4HJ2 A;  1F3B A;  3PGT A;  2H6X A;  1PFO A;  1X9S B;  4IP6 A;  2C0D A;  2HT9 A;  3F0I A;  4BWQ A;  4MF5 A;  3HCZ A;  1V40 A;  2H6Y A;  18GS A;  5INY A;  5EPF A;  1PQN A;  2H0H A;  3FZ9 A;  1PKW A;  4L5O A;  4MLY A;  5DAL B;  1WMJ A;  2WFC A;  4NV2 A;  4V1A g;  3W8J A;  4PQ1 A;  4MF7 A;  1W89 A;  4KA0 A;  3QFB C;  4TR3 A;  2DMM A;  6GSY A;  3IE3 A;  2G0F A;  1SU9 A;  1B9Y C;  3TJB A;  3PH9 A;  1YZX A;  3S9F A;  4DSS B;  1OKD A;  1GSU A;  3VLN A;  1XWK A;  2OE3 A;  1Q98 A;  4LLR A;  2PVO C;  2LTK A;  3UL3 A;  4GRF A;  3CXG A;  2HE3 A;  3I6A A;  2FUG 2;  4AGS A;  2LKU A;  1O73 A;  3DRN A;  4X4J A;  2KOK A;  1HQO A;  5GAP D;  5IPG A;  4WF4 A;  2R6K A;  4YQU A;  4G19 A;  1HD2 A;  1Y6E A;  3C7M A;  3TJK A;  1H4O A;  4ZIL A;  1BAY A;  1S3R A;  4ZB6 A;  3WGD A;  5ID2 A;  3TRP A;  3BD2 A;  1QGV A;  3LJR A;  3L9V A;  3C73 A;  2AV4 A;  3C8E A;  2FNO A;  2XPE A;  3F8U A;  2D2Z A;  1BJX A;  3AY8 A;  5ELG A;  5L71 A;  1XVQ A;  4YKF A;  2CX3 A;  3MAK A;  1T7P B;  4IP1 A;  2DKH A;  4I6X A;  2DSA A;  1FVK A;  5IOW A;  4IVF A;  4I97 A;  2VCV A;  3F4T A;  2K8V A;  2YWI A;  2H01 A;  3TKS C;  3QAW A;  3VI7 A;  5HR3 A;  3M9K A;  5J9C A;  2P0G A;  1BX9 A;  1Z6M A;  3LYP A;  2OBI A;  4DSS A;  3Q74 A;  3L9S A;  4CDO A;  1ERW A;  3BJ5 A;  3U5R E;  2JSY A;  5LD0 A;  3GMF A;  3IC4 A;  2R5G A;  1M2A A;  3DIE A;  2K9F A;  4K5R A;  4KCE A;  1M7T A;  3GN3 A;  3ZFL A;  1TJD A;  1G6W A;  1VF1 A;  3H79 A;  1EOG A;  4MJB A;  1GL8 A;  1QFN A;  1Z6N A;  3FK8 A;  2IFQ B;  3VWU A;  2M72 A;  2ZNM A;  2ZCT A;  1R26 A;  4MZW A;  1OYJ A;  1X5D A;  3ZFB A;  1ON4 A;  5FWG A;  3TRQ A;  1I9D A;  3FRC A;  3TGZ A;  4LL4 B;  2OE1 A;  1XIY A;  5F8B A;  1Y25 A;  2IMK A;  4MA9 A;  2C80 A;  3GYK A;  2R0G A;  5ECR B;  5CNW A;  5HQP A;  5D8I A;  2NVL A;  1U88 A;  1XFL A;  2C3T A;  2FA4 A;  2N5F A;  4TR1 B;  4FIW A;  3TKP A;  2DJK A;  4ZL7 A;  3HDC A;  4KX4 A;  1TOF A;  2I3Y A;  3IC8 A;  2NDO A;  1ZL9 A;  4PUF C;  2V2G A;  2TIR A;  1SK1 A;  3IAM 2;  5DDL A;  1Z5Y E;  4Z2U A;  3KH9 A;  3ERG A;  5H5R A;  4V2M A;  2VOC A;  5B6M A;  3LSZ A;  3EU4 A;  4DEJ A;  2HZF A;  2V32 A;  2CX4 A;  5HFG A;  3GIX A;  4OCE A;  2HFD A;  2V41 A;  5G1K A;  4MJA A;  1WIK A;  3P8W A;  4MDC A;  2GZY A;  2F3M A;  3DD3 A;  4TXO B;  5ECI B;  5KEJ A;  4MNN A;  4IQ1 A;  4K2D A;  1PX6 A;  4HDE A;  2B1K A;  2UZ8 A;  2GT5 A;  1HNB A;  2IFQ A;  3DWV A;  4PTS A;  3FW2 A;  3A5I A;  1NM3 A;  2HRN A;  2GQL A;  3IXR A;  2EC4 A;  5KN2 A;  4BA7 A;  1FOH A;  2LS5 A;  2RLI A;  2ALB A;  4N30 A;  2B5Y A;  2WRT A;  3HY2 A;  3QCP A;  4HZ4 A;  4ULX A;  5B7C A;  3GNJ A;  5C04 A;  3LG6 A;  4IHU A;  4PXO A;  2HSY A;  9GSS A;  2JZS A;  4POB A;  1EWX A;  3N5O A;  4XIH A;  3DXB A;  2QGV A;  4TR1 A;  4KUN A;  3QPM A;  2N5B A;  2F51 A;  5G30 A;  2YAN A;  2MBS A;  3ZL5 A;  1UN2 A;  4IJI A;  3F9U A;  2B7K A;  3VPT A;  1NHY A;  1AUC A;  4BVX B;  3H4K A;  1V98 A;  1SD9 A;  3TOU A;  1XXU A;  1SJZ A;  2RM6 A;  1TP9 A;  5CRW A;  3NZN A;  1GSS A;  3TKQ A;  4LMW A;  3KZQ A;  5J4U A;  1KTE A;  4J56 E;  3US3 A;  4WEY A;  1H75 A;  3J7Y k;  2R37 A;  1YF0 A;  1SKS B;  3CRU A;  4ECC A;  2C0G A;  2L6D A;  4POM A;  4HQZ A;  4MP4 A;  1V9W A;  2HNL A;  2CQ9 A;  3RHC A;  4TXO A;  2HLS A;  2VM2 A;  5HFK A;  2CZ2 A;  2MMN A;  2WB9 A;  3ZRD A;  1JFU A;  3R2Q A;  3KMO A;  2OE0 A;  4PUR A;  3A3T A;  3CYN A;  3KXO A;  1TI1 A;  4I5Q A;  10GS A;  3LW9 A;  3MWH A;  3G7I A;  1VGL A;  1CQH A;  2DBC A;  3ERW A;  3CBU A;  5IO2 A;  2HRK A;  2DJ1 A;  2HZE B;  3TJG A;  1B9X C;  5J5N A;  1IYI A;  4L0W A;  4FYU A;  4FYB A;  3ZMK A;  4WBJ A;  5HR0 A;  2WUL A;  4IQA A;  4EXJ A;  3GL5 A;  3FKF A;  4F0C A;  5G1L A;  4IEL A;  5LCZ A;  1F3A A;  1BG5 A;  4NXI A;  2LUS A;  2YZH A;  1X9W B;  4USS A;  1PL1 A;  3IK9 A;  1EZK A;  5A4U A;  1FB6 A;  3A2V A;  1UVZ A;  3IRA A;  4ZBD A;  3CSI A;  5GST A;  1ERU A;  2PU9 C;  2A2S A;  5ECP B;  2VL2 A;  4GF0 A;  2CAI A;  2B3S A;  4BVX A;  3HA9 A;  2VLU A;  2L59 A;  4MZB A;  6GSS A;  1FW1 A;  2C0F A;  3I9V 2;  5ECO B;  2IPA A;  3U6V A;  2MMZ A;  1YY7 A;  1M2D A;  3MDK A;  3QDN A;  2MMO A;  1ZCP A;  4KDU A;  1ZOF A;  1SKW B;  1EOH A;  2JL4 A;  1U6T A;  1GP1 A;  1GUL A;  2BTO T;  5AIS A;  4TVE A;  3ISO A;  3IR4 A;  5FHI A;  5EY6 A;  3D4T A;  3IPZ A;  4BIK A;  2N5A A;  3DYR A;  3FR6 A;  2H66 A;  2LRT A;  2VD0 A;  2FWE A;  1JHB A;  1M99 A;  5ENU A;  3ZZX A;  1K0C A;  3IHG A;  5A5K A;  2HZE A;  4HS1 A;  4N0V A;  4MAB A;  4PGT A;  1X5E A;  2PGT A;  1O7U A;  2H6Z A;  3G7Y A;  2C3N A;  1V2A A;  2P31 A;  2IIY A;  1OE7 A;  1NSW A;  2KP1 A;  4EKZ A;  4PNG A;  4WKW A;  4F2I A;  4E8H A;  1X9M B;  3V1W A;  3KIJ A;  1N8J A;  1A2L A;  3W8S A;  3IA1 A;  1B8X A;  3QOU A;  4V2N A;  4ZIJ A;  3IV4 A;  1S3C A;  1JZO A;  3RBT A;  2WZ9 A;  1M3J A;  5F05 A;  4IKH A;  3ZIT A;  3TJJ A;  5A4W A;  2XHF A;  1T3B A;  2VLT A;  7GSS A;  1XCC A;  5KN1 A;  3MSZ A;  5D9W A;  1WOU A;  1GRX A;  1GTA A;  3N9J A;  11GS A;  1EV4 A;  2JAD A;  4GST A;  3QD9 A;  1GNW A;  1JLV A;  3MYD A;  2GQK A;  1K0A A;  2JAC A;  2A2P A;  3GKX A;  2AUV A;  2AYT A;  3IBH A;  2XC2 A;  2OJL A;  1T00 A;  1USB A;  4KSO A;  4EVM A;  2X4A A;  4ZL9 A;  1M9A A;  4CY8 A;  3CTF A;  2B5E A;  1XW5 A;  3UEM A;  3PIN A;  3O6T A;  1FVJ A;  2C4J A;  3IOS A;  4CHS A;  1FG4 A;  3SWL A;  1FAA A;  1O8W A;  1YJ6 A;  2KLX A;  5FT3 A;  5IMD A;  5AIV A;  12GS A;  2MYG A;  5C00 A;  2L4Q A;  4K5S A;  1VRS D;  1T4Z A;  4IBP A;  4QL7 A;  1TRV A;  20GS A;  2H1G A;  3LXZ A;  17GS A;  1SD8 A;  4AF2 A;  1K0B A;  4Q5R A;  2YNX A;  3M9J A;  1VF3 A;  4WBR D;  1XBS A;  2YWN A;  1QQ2 A;  1ZZY A;  1PL2 A;  2XBQ A;  4HQS A;  2PBJ A;  4HUA A;  2O85 A;  3BBY A;  1EGO A;  1C72 A;  5DCG A;  4POK A;  2GDR A;  3A2X A;  4EUY A;  5IQY A;  1TU8 A;  6GSV A;  2VCZ A;  5IMC A;  4NPB A;  4MH3 A;  4ILF A;  5AN1 A;  3LYK A;  1PA3 A;  4NHZ A;  5GSS A;  2GZZ A;  2O8V B;  3LFL A;  4K7N A;  3E3E A;  2M80 A;  1O6J A;  1V57 A;  4O5Q A;  2CT6 A;  4GTU A;  2YPM A;  3FEU A;  4LA1 A;  2YV9 A;  3VPQ A;  2LJR A;  3UAP A;  4A5P A;  3D5J A;  3L0H A;  3WT2 A;  3MIX A;  1WWJ A;  2B7J A;  2QKE A;  3FR3 A;  5ECH B;  2H74 A;  2F9S A;  2IMD A;  2CV4 A;  1A8L A;  1PKZ A;  5E59 A;  4KAE A;  1HYU A;  4ZBA A;  1Z7R A;  3ED3 A;  4FH8 A;  4YKG A;  3GSS A;  3FY7 A;  4I8B A;  4O7H A;  3Q6O A;  1SYX A;  2H1D A;  3HVS A;  3D21 A;  1YEP A;  4OMV A;  4L8E A;  4ZBB A;  2AJQ B;  2AHE A;  3DKS A;  3OR5 A;  4BVY B;  4OO4 A;  2DJ3 A;  4BWS A;  1O85 A;  3F3R A;  4OWY A;  3ZIV A;  2G2Q A;  4FYC A;  2GQM A;  2YZU A;  2VD1 A;  3CSJ A;  4K0G A;  1ZYP A;  4PX1 A;  2PWJ A;  1OAZ A;  5KOW A;  5HFI A;  1VF2 A;  2I1U A;  1U3I A;  1A0F A;  1F2E A;  4F0B A;  4IW9 A;  5CYY A;  4IGJ A;  1G0T A;  4TR4 A;  2YN1 A;  2VL2 C;  1TI3 A;  5CRG A;  1JLW A;  4F9Z A;  3TDG A;  2IJY A;  2JU5 A;  2XPD A;  4K0N A;  4MCU A;  3PR8 A;  4GXZ A;  2OAC A;  2HYX A;  2R2J A;  3HZ8 A;  2VL9 A;  3EUR A;  2LRN A;  3ZLP A;  3NOF A;  1GLP A;  3GST A;  4Q5F A;  2GZP A;  5CO3 A;  3D6I A;  2V6O A;  1THO A;  3TUE A;  1T4Y A;  4PUA A;  3ZTL A;  1QXH A;  2J23 A;  4TKY A;  1UC7 A;  2HI7 A;  3GKM A;  2FGX A;  3UVH A;  3BCI A;  2CAQ A;  4YQV A;  4RI6 A;  1K0M A;  2GSS A;  1MDK A;  2IMI A;  3P2A A;  1SEN A;  5G2Z A;  2R0P A;  1NHO A;  5BMU A;  4L5L A;  1WJK A;  4BVY A;  5CRD A;  1T8E B;  4RUV A;  19GS A;  2MBT A;  3GHA A;  1MEK A;  3CMI A;  1KEB A;  1EP8 A;  1A2J A; 
#chains in the Genus database with same CATH homology
 3LOR A;  4WXT A;  3LEF A;  5G31 A;  4I2T A;  3K8N A;  2FWH A;  3APS A;  4NAX A;  4KND A;  3TRX A;  1SL0 B;  1AAZ A;  2KHP A;  1XOB A;  4KW6 A;  1G7O A;  3UIW A;  2LNT A;  5B6N A;  4HU9 A;  5DCH A;  4L0U A;  1KNG A;  1YEX A;  3KM6 A;  4K7I A;  3F6D A;  6GSX A;  2H73 A;  1SJI A;  4EE0 A;  4J57 E;  4KH7 A;  4EF0 A;  1OC9 A;  5COH A;  2YOI A;  3VWX A;  2DJJ A;  1ZGN A;  5B8A A;  4KGI A;  2H0G A;  3CRT A;  4XRD A;  3P7X A;  3UBL A;  1EP7 A;  1VF4 A;  1AQV A;  4XS6 A;  1AQX A;  1EGR A;  5DQY A;  3HVX A;  1TW9 A;  4OD7 A;  3MNG A;  1YKA A;  4GSS A;  4ML1 A;  1SJ6 A;  2KUC A;  5LNK e;  1RW1 A;  5IM9 A;  4O32 A;  2WGR A;  3UMA A;  4YAV A;  2K18 A;  3QFA C;  2GVP A;  4HEA 2;  2LJK A;  1ERT A;  1BQ7 A;  3KH7 A;  1DUG A;  3GX0 A;  4G10 A;  2M46 A;  4J2F A;  2VL3 A;  3O3T A;  3SBC A;  3CTG A;  2IWT A;  4EC0 A;  2JZR A;  5ECK B;  5KOX A;  1EEJ A;  4F82 A;  5J9B A;  4CY6 A;  3M3M A;  4KDX A;  3M1G A;  14GS A;  3D22 A;  3Q19 A;  4HU7 A;  3RDW A;  5D9V A;  5ECN B;  2FD3 A;  1AQW A;  2FA8 A;  3EMP A;  1Z9H A;  2K6V A;  3KMN A;  4TN8 A;  3H1N A;  5F06 A;  2GTU A;  5JCU A;  4WR4 A;  4KE3 A;  2LNS A;  5IMV A;  2ON5 A;  5ECQ B;  2IL3 A;  1G7E A;  1Z7P A;  1XOA A;  3KGK A;  1O8X A;  2NPB A;  1YDK A;  3ERF A;  3CSH A;  5IPH A;  2YWM A;  5AIX A;  6GST A;  3JCM L;  2WJU A;  1XWG A;  3A2W A;  2L57 A;  3F3Q A;  5JWO B;  3C1S A;  1AIU A;  1S3D A;  4AJ6 A;  1XW9 A;  2VIM A;  2HRA A;  3DEX A;  2CVD A;  3GKK A;  1ERV A;  5IOX A;  2OA7 A;  2YP6 A;  3KTL A;  1K0D A;  4G2E A;  3FR9 A;  2OKA A;  2P5R A;  2H1B A;  4NMU A;  4TOP A;  4EL1 A;  3C71 A;  2I81 A;  1F6M C;  2RM5 A;  1ML6 A;  1TU7 A;  2NBS A;  2FY6 A;  3L4N A;  1A24 A;  2GGT A;  3I43 A;  4JRR A;  2IN3 A;  1GLQ A;  2LEG A;  2PMT A;  3IAS 2;  2ES7 A;  2HSH A;  4V1A p;  1THX A;  2CA8 A;  1MTC A;  2C8U A;  1OKT A;  5D9T A;  4MPG A;  3P90 A;  3UOM A;  2BJX A;  3LWA A;  4YAP A;  3L9U A;  2FWG A;  2H0I A;  2VLV A;  3HKR A;  4MMM A;  2DLX A;  4N10 A;  4OFT A;  4JR6 A;  3C1R A;  1ACV A;  3EU3 A;  3EMX A;  2GT6 A;  1PN0 A;  3GA4 A;  4IJ3 A;  5DQS A;  3FZ5 A;  2VAF A;  3TB2 A;  3EWL A;  4ID0 A;  1GUK A;  2P5Q A;  3ZYW A;  4MJE A;  2YCD A;  4JU5 A;  5DJM A;  1LBK A;  1YF1 A;  4Q5N A;  4Z2T A;  1MDJ A;  4D73 B;  2RII A;  3F4R A;  4ML6 A;  5DAK B;  1M2B A;  1GH2 A;  2YJ7 A;  1FOV A;  1ZYN A;  4Q5Q A;  1TK5 B;  3GX8 A;  1RK4 A;  2BMX A;  3TJF A;  2JZT A;  2PER A;  3IK7 A;  2H8L A;  4WR5 A;  3DML A;  4ACS A;  4EIP A;  4GLT A;  4JBB A;  3QR6 A;  2PVQ A;  1GSE A;  1ZMA A;  4ECB A;  2H76 A;  2X99 A;  1CQG A;  2A2R A;  2EIR A;  3KD0 A;  2LQO A;  5H5S A;  1TXX A;  4OCF A;  3GH9 A;  3QMX A;  2H70 A;  2HSM A;  3A5W A;  3GKN A;  2R4V A;  1GSQ A;  2B1L A;  4G0L A;  3QAV A;  1K0N A;  2CVK A;  4EIQ A;  3EYT A;  3GTU B;  1PGT A;  1XWB A;  3FYG A;  2QC7 A;  1TRS A;  1O81 A;  4MH2 A;  2IMF A;  3F63 A;  5CRH A;  1IYH A;  3VUR A;  3BOA A;  4JR4 A;  4DSR A;  1WE0 A;  2GSQ A;  1XZO A;  2O7K A;  3G7J A;  4LMV A;  5IMF A;  2YV7 A;  3RAZ A;  2X8H A;  2PPT A;  3ZIJ A;  3M0F A;  4D73 A;  3GUS A;  4OFN A;  4IS0 A;  2H71 A;  2VCT A;  2H19 A;  1BYE A;  3ME8 A;  5DAK A;  4JZQ A;  4DVC A;  4GQF A;  1EEM A;  1A2M A;  1FB0 A;  3IDV A;  4O5R A;  5J41 A;  4GCI A;  1EV9 A;  1TKD B;  5G5E A;  2A4V A;  3RPP A;  2RUF A;  4K9Z A;  13GS A;  3WGX A;  2X64 A;  2VM1 A;  4GWR A;  3GUR A;  1GSY A;  1WRY A;  1URM A;  2FLS A;  3TKR A;  1SK2 A;  1YQ1 A;  4PQI A;  1LU4 A;  1GTB A;  1QK8 A;  1QUW A;  2WCI A;  1V58 A;  1W4V A;  1TRW A;  3H8Q A;  5DAL A;  2X8C A;  3ZRE A;  1UA5 A;  4Z7X A;  2AAW A;  5E4W A;  5EL8 A;  2LQQ A;  5JWQ B;  3HJM A;  4PNF A;  3KP9 A;  4GQC A;  4X0X A;  2MMA A;  5D9X A;  4EDY A;  2QA1 A;  5F0G A;  5IIZ A;  3GH6 A;  4XRA A;  4KF9 A;  2REM A;  1TTZ A;  3GTU A;  1N2A A;  2DC5 A;  4H86 A;  4IN0 A;  4TRX A;  4ECI A;  3Q18 A;  4XS4 B;  4K6X A;  4TR0 A;  3UBK A;  1OC8 A;  4XTS A;  2DKI A;  1T1V A;  3WYW A;  4ECJ A;  2B6M A;  1DE2 A;  2L6C A;  2I4A A;  4ZB9 A;  5J3R A;  1TK8 B;  4EO3 A;  1A23 A;  1RQM A;  2FHE A;  5IMZ A;  8GSS A;  3DVX A;  2DIY A;  3HD5 A;  4AJ8 A;  1B48 A;  2LRC A;  4POL A;  1Q4J A;  1K0O A;  5CP1 A;  5A4V A;  1MDI A;  2GLR A;  4OO5 A;  4NWY A;  3EPT A;  1Z3E A;  3O76 A;  5D93 A;  2VCX A;  3UJ1 A;  2OAD A;  1J0F A;  3FZ4 A;  1XW6 A;  2ON7 A;  3EC3 A;  1SK0 A;  3PPU A;  2X49 A;  1TDI A;  5D96 A;  1PSQ A;  1R4W A;  1YKC A;  4JE1 A;  1OC9 B;  4LL1 B;  3TKS E;  1DBY A;  2GS3 A;  1DE1 A;  2IME A;  1GNE A;  2HRF A;  4FQU A;  3FZA A;  1MD3 A;  3IHQ A;  1SKR B;  1SL1 B;  2J9H A;  4G0I A;  6GSW A;  4BPY A;  4MF6 A;  4MK3 A;  5DVB A;  2DJ2 A;  4NV5 A;  1U87 A;  5DBQ A;  4K1F A;  2O87 A;  5B8B A;  1OE8 A;  1PX7 A;  2C3Q A;  2CZ3 A;  4O92 A;  5JCW A;  3F4S A;  2L4C A;  1A8Y A;  5BRT A;  1K3L A;  2VUP A;  3EVI A;  2O89 A;  2H72 A;  2FCH A;  2VO4 A;  4O5U A;  5F07 A;  5IO0 A;  4XS4 A;  4KSM A;  3R3E A;  1JZR A;  1DSB A;  5CRE A;  3LXT A;  5GZZ B;  4AJ7 A;  1GUH A;  4E8E A;  1F9M A;  3BCK A;  3HYP A;  3VI5 A;  3GL3 A;  5CAX A;  1M9B A;  3HJO A;  3D4M A;  2MZC A;  5AGY A;  3LGC A;  2E2G A;  2PN8 A;  4HOJ A;  1PMT A;  4WF5 A;  2DIZ A;  2FWF A;  2DJ0 A;  4TW5 A;  1PN9 A;  2L5O A;  3DGQ A;  2KP2 A;  1QMV A;  2NTO A;  2TRX A;  5KN3 A;  4XCS A;  3VWV A;  3G9B A;  4Z2R A;  2CVB A;  2A4H A;  2QA2 A;  2GST A;  5ELA A;  4GSN A;  6GSU A;  2VCW A;  2GSR A;  1GTI A;  3I69 A;  1E2Y A;  4CW9 A;  3VFI A;  1WPI A;  1GSD A;  2B5X A;  2RUE A;  3RPN A;  3LQ7 A;  3GV1 A;  4YH2 A;  3HJP A;  1XPV A;  2E7P A;  5ECS A;  3DVW A;  1LJR A;  1B4Q A;  2VCQ A;  5JCG A;  1X0R A;  1JZW A;  5GAN D;  4PQH A;  1XVW A;  4XHM A;  1FO5 A;  5G5F A;  5HR1 A;  5EVO A;  1PD2 1;  1JZD A;  1X5C A;  3HXS A;  1HNA A;  3WGE A;  2H30 A;  4BL7 B;  1GUM A;  1GWC A;  3WT1 A;  2L5L A;  2R0C A;  3TKS A;  2WDU A;  4NHW A;  4V2L A;  2LV3 A;  3ME7 A;  1ZYE A;  1ILO A;  4G9H A;  4TXV A;  4N11 A;  1TK0 B;  2LST A;  1GTU A;  2C1Y A;  1KBN A;  5ABR A;  2DML A;  4P3Y B;  2F8A A;  1R7H A;  5IMA A;  4OFM A;  5ECM B;  1K3Y A;  2X8G A;  4ICY A;  5H5Q A;  3ZVJ D;  4HJM A;  3D0Z A;  1HNC A;  3ZML A;  5HR2 A;  3FMW A;  4RQX A;  1E6B A;  3E9J B;  3APQ A;  1AXD A;  1U3A A;  4XS1 A;  4F03 A;  2V1M A;  1MD4 A;  2E2M A;  2OBK A;  2ZUP A;  3KJY A;  3VK9 A;  2YJH A;  2C0E A;  2E0Q A;  3UVT A;  4MZC A;  1BED A;  16GS A;  4G0K A;  3QAG A;  1S3A A;  22GS A;  1NW2 A;  4QL9 A;  3NIV A;  1F37 A;  3KTB A;  1AW9 A;  1XWA A;  1R5P A;  2V6K A;  3ZVJ A;  1I5G A;  4RI7 A;  1FHE A;  1GSF A;  4K2X A;  2H1A A;  2TRC P;  3UAR A;  4HZ2 A;  4MJC A;  2Z9S A;  4K7O A;  1ST9 A;  1R5A A;  1M0U A;  4I2U A;  3RHB A;  3GRX A;  2K8S A;  4KCA A;  4BL7 A;  4KB3 A;  1OVN A;  4MPF A;  2EIQ A;  4ZL8 A;  1AC1 A;  4YQM A;  3EE2 A;  1SL2 B;  1J08 A;  3M8N A;  2I9H A;  3GFK A;  3H93 A;  1J9B A;  2H75 A;  3KEB A;  3WD6 A;  1B4P A;  4EDZ A;  1A0R P;  1XWC A;  4RQR A;  2PUK C;  2AB6 A;  4ISD A;  4N0Z A;  3APO A;  2EIO A;  5KN0 A;  3TCO A;  2WS2 A;  4QQ7 A;  3HVV A;  3VWW A;  5D73 A;  1K3O A;  3FHK A;  1ABA A;  4X1U A;  5DJL A;  2XBI A;  4KDY A;  3J7Y b;  4HI7 A;  1TRU A;  3KP8 A;  2LJA A;  4ZB8 A;  3TOT A;  4K8M A;  3HHV A;  3HZ4 A;  5ECL B;  4JED A;  4DSQ A;  3E0U A;  4ZXG A;  2HXK A;  3EIN A;  2R3X A;  2F8F A;  4X43 A;  1PRX A;  1SYR A;  2JSZ A;  5JWR B;  1OC3 A;  4FO5 A;  2QSI A;  3F6F A;  1G6Y A;  3W6G A;  5ID2 B;  3KCM A;  3L78 A;  1ZYQ B;  4WET A;  1WP0 A;  2YWO A;  4HJ2 A;  1F3B A;  3PGT A;  2H6X A;  1X9S B;  4IP6 A;  2C0D A;  2HT9 A;  3F0I A;  4BWQ A;  4MF5 A;  3HCZ A;  1V40 A;  2H6Y A;  18GS A;  5INY A;  5EPF A;  1PQN A;  2H0H A;  3FZ9 A;  1PKW A;  4L5O A;  4MLY A;  5DAL B;  1WMJ A;  2WFC A;  4NV2 A;  4V1A g;  3W8J A;  4PQ1 A;  4MF7 A;  1W89 A;  4KA0 A;  3QFB C;  4TR3 A;  2DMM A;  6GSY A;  3IE3 A;  2G0F A;  1SU9 A;  1B9Y C;  3TJB A;  3PH9 A;  1YZX A;  3S9F A;  4DSS B;  1OKD A;  1GSU A;  3VLN A;  1XWK A;  2OE3 A;  1Q98 A;  4LLR A;  2PVO C;  2LTK A;  3UL3 A;  4GRF A;  3CXG A;  2HE3 A;  3I6A A;  2FUG 2;  4AGS A;  2LKU A;  1O73 A;  3DRN A;  4X4J A;  2KOK A;  1HQO A;  5GAP D;  5IPG A;  4WF4 A;  2R6K A;  4YQU A;  4G19 A;  1HD2 A;  1Y6E A;  3C7M A;  3TJK A;  1H4O A;  4ZIL A;  1BAY A;  4ZB6 A;  3WGD A;  5ID2 A;  3TRP A;  3BD2 A;  1QGV A;  3LJR A;  3L9V A;  3C73 A;  2AV4 A;  3C8E A;  2FNO A;  2XPE A;  3F8U A;  2D2Z A;  1BJX A;  3AY8 A;  5ELG A;  5L71 A;  1XVQ A;  4YKF A;  2CX3 A;  3MAK A;  1T7P B;  4IP1 A;  2DKH A;  4I6X A;  2DSA A;  1FVK A;  5IOW A;  4IVF A;  4I97 A;  2VCV A;  3F4T A;  2K8V A;  2YWI A;  2H01 A;  3TKS C;  3QAW A;  3VI7 A;  5HR3 A;  3M9K A;  5J9C A;  2P0G A;  1BX9 A;  1Z6M A;  3LYP A;  2OBI A;  4DSS A;  3Q74 A;  3L9S A;  4CDO A;  1ERW A;  3BJ5 A;  3U5R E;  2JSY A;  5LD0 A;  3GMF A;  3IC4 A;  2R5G A;  1M2A A;  3DIE A;  2K9F A;  4K5R A;  4KCE A;  1M7T A;  3GN3 A;  3ZFL A;  1TJD A;  1G6W A;  1VF1 A;  3H79 A;  1EOG A;  4MJB A;  1GL8 A;  1QFN A;  1Z6N A;  3FK8 A;  2IFQ B;  3VWU A;  2M72 A;  2ZNM A;  2ZCT A;  1R26 A;  4MZW A;  1OYJ A;  1X5D A;  3ZFB A;  1ON4 A;  5FWG A;  3TRQ A;  1I9D A;  3FRC A;  3TGZ A;  4LL4 B;  2OE1 A;  1XIY A;  5F8B A;  1Y25 A;  2IMK A;  4MA9 A;  2C80 A;  3GYK A;  2R0G A;  5ECR B;  5CNW A;  5HQP A;  5D8I A;  2NVL A;  1U88 A;  1XFL A;  2C3T A;  2FA4 A;  2N5F A;  4TR1 B;  4FIW A;  3TKP A;  2DJK A;  4ZL7 A;  3HDC A;  4KX4 A;  1TOF A;  2I3Y A;  3IC8 A;  2NDO A;  1ZL9 A;  4PUF C;  2V2G A;  2TIR A;  1SK1 A;  3IAM 2;  5DDL A;  1Z5Y E;  4Z2U A;  3KH9 A;  3ERG A;  5H5R A;  4V2M A;  2VOC A;  5B6M A;  3LSZ A;  3EU4 A;  4DEJ A;  2HZF A;  2V32 A;  2CX4 A;  5HFG A;  3GIX A;  4OCE A;  2HFD A;  2V41 A;  5G1K A;  4MJA A;  1WIK A;  3P8W A;  4MDC A;  2GZY A;  2F3M A;  3DD3 A;  4TXO B;  5ECI B;  5KEJ A;  4MNN A;  4IQ1 A;  4K2D A;  1PX6 A;  4HDE A;  2B1K A;  2UZ8 A;  2GT5 A;  1HNB A;  2IFQ A;  3DWV A;  4PTS A;  3FW2 A;  3A5I A;  1NM3 A;  2HRN A;  2GQL A;  3IXR A;  2EC4 A;  5KN2 A;  4BA7 A;  1FOH A;  2LS5 A;  2RLI A;  2ALB A;  4N30 A;  2B5Y A;  2WRT A;  3HY2 A;  3QCP A;  4HZ4 A;  4ULX A;  5B7C A;  3GNJ A;  5C04 A;  3LG6 A;  4IHU A;  4PXO A;  2HSY A;  9GSS A;  2JZS A;  4POB A;  1EWX A;  3N5O A;  4XIH A;  3DXB A;  2QGV A;  4TR1 A;  4KUN A;  3QPM A;  2N5B A;  2F51 A;  5G30 A;  2YAN A;  2MBS A;  3ZL5 A;  1UN2 A;  4IJI A;  3F9U A;  2B7K A;  3VPT A;  1NHY A;  1AUC A;  4BVX B;  3H4K A;  1V98 A;  1SD9 A;  3TOU A;  1XXU A;  1SJZ A;  2RM6 A;  1TP9 A;  5CRW A;  3NZN A;  1GSS A;  3TKQ A;  4LMW A;  3KZQ A;  5J4U A;  1KTE A;  4J56 E;  3US3 A;  4WEY A;  1H75 A;  3J7Y k;  2R37 A;  1YF0 A;  1SKS B;  3CRU A;  4ECC A;  2C0G A;  2L6D A;  4POM A;  4HQZ A;  4MP4 A;  1V9W A;  2HNL A;  2CQ9 A;  3RHC A;  4TXO A;  2HLS A;  2VM2 A;  5HFK A;  2CZ2 A;  2MMN A;  2WB9 A;  3ZRD A;  1JFU A;  3R2Q A;  3KMO A;  2OE0 A;  4PUR A;  3A3T A;  3CYN A;  3KXO A;  1TI1 A;  4I5Q A;  10GS A;  3LW9 A;  3MWH A;  3G7I A;  1VGL A;  1CQH A;  2DBC A;  3ERW A;  3CBU A;  5IO2 A;  2HRK A;  2DJ1 A;  2HZE B;  3TJG A;  1B9X C;  5J5N A;  1IYI A;  4L0W A;  4FYU A;  4FYB A;  3ZMK A;  4WBJ A;  5HR0 A;  2WUL A;  4IQA A;  4EXJ A;  3GL5 A;  3FKF A;  4F0C A;  5G1L A;  4IEL A;  5LCZ A;  1F3A A;  1BG5 A;  4NXI A;  2LUS A;  2YZH A;  1X9W B;  4USS A;  1PL1 A;  3IK9 A;  1EZK A;  5A4U A;  1FB6 A;  3A2V A;  1UVZ A;  3IRA A;  4ZBD A;  3CSI A;  5GST A;  1ERU A;  2PU9 C;  2A2S A;  5ECP B;  2VL2 A;  4GF0 A;  2CAI A;  2B3S A;  4BVX A;  3HA9 A;  2VLU A;  2L59 A;  4MZB A;  6GSS A;  1FW1 A;  2C0F A;  3I9V 2;  5ECO B;  2IPA A;  3U6V A;  2MMZ A;  1YY7 A;  1M2D A;  3MDK A;  3QDN A;  2MMO A;  1ZCP A;  4KDU A;  1ZOF A;  1SKW B;  1EOH A;  2JL4 A;  1U6T A;  1GP1 A;  1GUL A;  2BTO T;  5AIS A;  4TVE A;  3ISO A;  3IR4 A;  5FHI A;  5EY6 A;  3D4T A;  3IPZ A;  2N5A A;  3DYR A;  3FR6 A;  2H66 A;  2LRT A;  2VD0 A;  2FWE A;  1JHB A;  1M99 A;  5ENU A;  3ZZX A;  1K0C A;  3IHG A;  5A5K A;  2HZE A;  4HS1 A;  4N0V A;  4MAB A;  4PGT A;  1X5E A;  2PGT A;  1O7U A;  2H6Z A;  3G7Y A;  2C3N A;  1V2A A;  2P31 A;  2IIY A;  1OE7 A;  1NSW A;  2KP1 A;  4EKZ A;  4PNG A;  4WKW A;  4F2I A;  4E8H A;  1X9M B;  3V1W A;  3KIJ A;  1N8J A;  1A2L A;  3W8S A;  3IA1 A;  1B8X A;  3QOU A;  4V2N A;  4ZIJ A;  3IV4 A;  1S3C A;  1JZO A;  3RBT A;  2WZ9 A;  5F05 A;  4IKH A;  3ZIT A;  3TJJ A;  5A4W A;  2XHF A;  1T3B A;  2VLT A;  7GSS A;  1XCC A;  5KN1 A;  3MSZ A;  5D9W A;  1WOU A;  1GRX A;  1GTA A;  3N9J A;  11GS A;  1EV4 A;  2JAD A;  4GST A;  3QD9 A;  1GNW A;  1JLV A;  3MYD A;  2GQK A;  1K0A A;  2JAC A;  2A2P A;  3GKX A;  2AUV A;  2AYT A;  3IBH A;  2XC2 A;  2OJL A;  1T00 A;  1USB A;  4KSO A;  4EVM A;  2X4A A;  4ZL9 A;  1M9A A;  4CY8 A;  3CTF A;  2B5E A;  1XW5 A;  3UEM A;  3PIN A;  3O6T A;  1FVJ A;  2C4J A;  3IOS A;  4CHS A;  1FG4 A;  3SWL A;  1FAA A;  1O8W A;  1YJ6 A;  2KLX A;  5FT3 A;  5IMD A;  5AIV A;  12GS A;  2MYG A;  5C00 A;  2L4Q A;  4K5S A;  1VRS D;  1T4Z A;  4IBP A;  4QL7 A;  1TRV A;  20GS A;  2H1G A;  3LXZ A;  17GS A;  1SD8 A;  4AF2 A;  1K0B A;  4Q5R A;  2YNX A;  3M9J A;  1VF3 A;  4WBR D;  1XBS A;  2YWN A;  1QQ2 A;  1ZZY A;  1PL2 A;  2XBQ A;  4HQS A;  2PBJ A;  4HUA A;  2O85 A;  3BBY A;  1EGO A;  1C72 A;  5DCG A;  4POK A;  2GDR A;  3A2X A;  4EUY A;  5IQY A;  1TU8 A;  6GSV A;  2VCZ A;  5IMC A;  4NPB A;  4MH3 A;  4ILF A;  5AN1 A;  3LYK A;  1PA3 A;  4NHZ A;  5GSS A;  2GZZ A;  2O8V B;  3LFL A;  4K7N A;  3E3E A;  2M80 A;  1O6J A;  1V57 A;  4O5Q A;  2CT6 A;  4GTU A;  2YPM A;  3FEU A;  4LA1 A;  2YV9 A;  3VPQ A;  2LJR A;  3UAP A;  4A5P A;  3D5J A;  3L0H A;  3WT2 A;  3MIX A;  1WWJ A;  2B7J A;  2QKE A;  3FR3 A;  5ECH B;  2H74 A;  2F9S A;  2IMD A;  2CV4 A;  1A8L A;  1PKZ A;  5E59 A;  4KAE A;  1HYU A;  4ZBA A;  1Z7R A;  3ED3 A;  4FH8 A;  4YKG A;  3GSS A;  3FY7 A;  4I8B A;  4O7H A;  3Q6O A;  1SYX A;  2H1D A;  3HVS A;  3D21 A;  1YEP A;  4OMV A;  4L8E A;  4ZBB A;  2AJQ B;  2AHE A;  3DKS A;  3OR5 A;  4BVY B;  4OO4 A;  2DJ3 A;  4BWS A;  1O85 A;  3F3R A;  4OWY A;  3ZIV A;  2G2Q A;  4FYC A;  2GQM A;  2YZU A;  2VD1 A;  3CSJ A;  4K0G A;  1ZYP A;  4PX1 A;  2PWJ A;  1OAZ A;  5KOW A;  5HFI A;  1VF2 A;  2I1U A;  1U3I A;  1A0F A;  1F2E A;  4F0B A;  4IW9 A;  5CYY A;  4IGJ A;  1G0T A;  4TR4 A;  2YN1 A;  2VL2 C;  1TI3 A;  5CRG A;  1JLW A;  4F9Z A;  3TDG A;  2IJY A;  2JU5 A;  2XPD A;  4K0N A;  4MCU A;  3PR8 A;  4GXZ A;  2OAC A;  2HYX A;  2R2J A;  3HZ8 A;  2VL9 A;  3EUR A;  2LRN A;  3ZLP A;  3NOF A;  1GLP A;  3GST A;  4Q5F A;  2GZP A;  5CO3 A;  3D6I A;  2V6O A;  1THO A;  3TUE A;  1T4Y A;  4PUA A;  3ZTL A;  1QXH A;  2J23 A;  4TKY A;  1UC7 A;  2HI7 A;  3GKM A;  2FGX A;  3UVH A;  3BCI A;  2CAQ A;  4YQV A;  4RI6 A;  1K0M A;  2GSS A;  1MDK A;  2IMI A;  3P2A A;  1SEN A;  5G2Z A;  2R0P A;  1NHO A;  5BMU A;  4L5L A;  1WJK A;  4BVY A;  5CRD A;  1T8E B;  4RUV A;  19GS A;  2MBT A;  3GHA A;  1MEK A;  3CMI A;  1KEB A;  1EP8 A;  1A2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...