2LL3A

The solution structure of tgmic4 apple-5 domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
CVHTGNIGSKAQTIGEVKRASSLSECRARCQAEKECSHYTYNVKSGLCYPKRGKPQFYKYLGDMTGSRTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Micronemal protein 4
publication title Galactose Recognition by the Apicomplexan Parasite Toxoplasma gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell adhesion
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2ll3A00
2YIOA 1Z40A 4UAOA 5CT2A 2HGFA 1BHTA 1GP9A 2Q8AA 2YIPA 4DURA 3MKPA 5CS1A 4Z0FA 2X2ZA 2J8JA 2QJ4A 4R1BA 4R19A 5CT3A 3SP8A 3HN4A 3HMRA 2LL3A 1GMNA 3HMTA 5CS5A 2Z8VA 2Q8BA 3ZLEA 2LL4M 4R1CA 5EOKA 3ZWZA 1HKYA 5CP9A 5EODA 4A5TS 2YILA 1I8NA 3SRIA 2QJ2A 2F83A 2Z8WA 2K13X 3SRJA 5CS9A 4Z0EA 3HMSA 5COEA 5CS3A 5CSQA 4UV6A 1NK1A 2J8LA 1GMOA 1W8KA 4APLA 1YXEA 1W81A 4APMA 4IUAA 5I25A 4Z0DA 4R1AA 4Z09A 5CT1A 2Y8RA
chains in the Genus database with same CATH superfamily
2YIOA 1Z40A 4UAOA 5CT2A 2HGFA 1BHTA 1GP9A 2Q8AA 2YIPA 4DURA 3MKPA 5CS1A 4Z0FA 2X2ZA 2J8JA 2QJ4A 4R1BA 4R19A 5CT3A 3SP8A 3HN4A 3HMRA 4YIZA 2LL3A 1GMNA 3HMTA 5CS5A 2Z8VA 2Q8BA 3ZLEA 2LL4M 4R1CA 5EOKA 3ZWZA 1HKYA 2KL5A 5CP9A 5EODA 4A5TS 2YILA 1I8NA 3SRIA 2QJ2A 2F83A 2Z8WA 2K13X 3SRJA 5CS9A 4Z0EA 3HMSA 5COEA 5CS3A 5CSQA 4UV6A 1NK1A 2J8LA 1GMOA 4YIVA 1W8KA 4APLA 1YXEA 1W81A 4APMA 4IUAA 5I25A 4Z0DA 4R1AA 4Z09A 5CT1A 2Y8RA
chains in the Genus database with same CATH topology
2YIOA 1Z40A 4UAOA 5CT2A 2HGFA 1BHTA 1GP9A 2Q8AA 2YIPA 4DURA 3MKPA 5CS1A 4Z0FA 2X2ZA 2J8JA 2QJ4A 4R1BA 4R19A 5CT3A 3SP8A 3HN4A 3HMRA 4YIZA 2LL3A 1GMNA 3HMTA 5CS5A 2Z8VA 2Q8BA 3ZLEA 2LL4M 4R1CA 5EOKA 3ZWZA 1HKYA 2KL5A 5CP9A 5EODA 4A5TS 2YILA 1I8NA 3SRIA 2QJ2A 2F83A 2Z8WA 2K13X 3SRJA 5CS9A 4Z0EA 3HMSA 5COEA 5CS3A 5CSQA 4UV6A 1NK1A 2J8LA 1GMOA 4YIVA 1W8KA 4APLA 1YXEA 1W81A 4APMA 4IUAA 5I25A 4Z0DA 4R1AA 4Z09A 5CT1A 2Y8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIO A;  1Z40 A;  4UAO A;  5CT2 A;  2HGF A;  1BHT A;  1GP9 A;  2Q8A A;  2YIP A;  4DUR A;  3MKP A;  5CS1 A;  4Z0F A;  2X2Z A;  2J8J A;  2QJ4 A;  4R1B A;  4R19 A;  5CT3 A;  3SP8 A;  3HN4 A;  3HMR A;  2LL3 A;  1GMN A;  3HMT A;  5CS5 A;  2Z8V A;  2Q8B A;  3ZLE A;  2LL4 M;  4R1C A;  5EOK A;  3ZWZ A;  1HKY A;  5CP9 A;  5EOD A;  4A5T S;  2YIL A;  1I8N A;  3SRI A;  2QJ2 A;  2F83 A;  2Z8W A;  2K13 X;  3SRJ A;  5CS9 A;  4Z0E A;  3HMS A;  5COE A;  5CS3 A;  5CSQ A;  4UV6 A;  1NK1 A;  2J8L A;  1GMO A;  1W8K A;  4APL A;  1YXE A;  1W81 A;  4APM A;  4IUA A;  5I25 A;  4Z0D A;  4R1A A;  4Z09 A;  5CT1 A;  2Y8R A; 
#chains in the Genus database with same CATH topology
 2YIO A;  1Z40 A;  4UAO A;  5CT2 A;  2HGF A;  1BHT A;  1GP9 A;  2Q8A A;  2YIP A;  4DUR A;  3MKP A;  5CS1 A;  4Z0F A;  2X2Z A;  2J8J A;  2QJ4 A;  4R1B A;  4R19 A;  5CT3 A;  3SP8 A;  3HN4 A;  3HMR A;  4YIZ A;  2LL3 A;  1GMN A;  3HMT A;  5CS5 A;  2Z8V A;  2Q8B A;  3ZLE A;  2LL4 M;  4R1C A;  5EOK A;  3ZWZ A;  1HKY A;  2KL5 A;  5CP9 A;  5EOD A;  4A5T S;  2YIL A;  1I8N A;  3SRI A;  2QJ2 A;  2F83 A;  2Z8W A;  2K13 X;  3SRJ A;  5CS9 A;  4Z0E A;  3HMS A;  5COE A;  5CS3 A;  5CSQ A;  4UV6 A;  1NK1 A;  2J8L A;  1GMO A;  4YIV A;  1W8K A;  4APL A;  1YXE A;  1W81 A;  4APM A;  4IUA A;  5I25 A;  4Z0D A;  4R1A A;  4Z09 A;  5CT1 A;  2Y8R A; 
#chains in the Genus database with same CATH homology
 2YIO A;  1Z40 A;  4UAO A;  5CT2 A;  2HGF A;  1BHT A;  1GP9 A;  2Q8A A;  2YIP A;  4DUR A;  3MKP A;  5CS1 A;  4Z0F A;  2X2Z A;  2J8J A;  2QJ4 A;  4R1B A;  4R19 A;  5CT3 A;  3SP8 A;  3HN4 A;  3HMR A;  4YIZ A;  2LL3 A;  1GMN A;  3HMT A;  5CS5 A;  2Z8V A;  2Q8B A;  3ZLE A;  2LL4 M;  4R1C A;  5EOK A;  3ZWZ A;  1HKY A;  2KL5 A;  5CP9 A;  5EOD A;  4A5T S;  2YIL A;  1I8N A;  3SRI A;  2QJ2 A;  2F83 A;  2Z8W A;  2K13 X;  3SRJ A;  5CS9 A;  4Z0E A;  3HMS A;  5COE A;  5CS3 A;  5CSQ A;  4UV6 A;  1NK1 A;  2J8L A;  1GMO A;  4YIV A;  1W8K A;  4APL A;  1YXE A;  1W81 A;  4APM A;  4IUA A;  5I25 A;  4Z0D A;  4R1A A;  4Z09 A;  5CT1 A;  2Y8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...