2LLGA

Nmr structure of the protein np_814968.1 from enterococcus faecalis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein NP_814968.1 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2llgA00
2LLGA 3QFGA 3CFUA 4LESA 1LMIA
chains in the Genus database with same CATH superfamily
2DS4A 4L4VD 4YSAA 2X1OA 4AL8L 3R0NA 1EK3A 3AREC 4GP5B 5D7JC 1ODUA 2VZOA 4FA8A 2BIQA 3FQ1A 4C4KO 3PY9A 4MNGB 3BUIA 1FL3B 3DKHA 2J8UA 5IFHH 3FH8A 5LB1A 4GI6A 4XNQA 4BKTC 4ZW7A 1JYXA 3QUXC 4XPBL 2OSWA 1KBGH 4N2MA 4WWID 3RJQB 4BGLA 4WF7A 2H1PH 1JZ7A 1N0XL 4BQ8A 1F45A 3NIGB 1E2WA 1J9TA 5EU6D 3GMOB 1KJ2A 1URZA 1QI4A 1SN0A 1UWEH 3EYSH 3PL6C 3SZ6A 3D50A 3IRZA 5HI4C 1F6AA 1FZOB 1GS8A 1KN4H 5E4AA 5EUOB 1R5WB 1W0YT 2Y6TE 4LEXH 3VFMA 4F7PA 4XC3L 1QKZL 2B16A 1LO2H 1MJ8L 4YSTA 3DRTA 5L0QB 2C4FT 3IDGB 3B37A 3LH2H 1E2VA 5T1JA 3HZYB 3K6FA 1A22B 1AKJB 3FT3A 2EXTA 2WNGA 5F8RC 5CF3A 5FWRA 1IZKA 3TH3T 4NKOB 2LV4A 3DGGA 3QWOA 1UJ3C 2PCPA 1KEGH 1NLDL 1MCOL 3A0OA 1RUPH 3BLPX 3IM1A 2ARJB 3MV7A 2PWGA 3SDDD 2H26B 4ERSL 4JM0A 3LKQB 1UWGL 3PNWA 5IMOA 3NZSA 1MHCA 3QJTB 4P9HL 2HKHH 3ARGA 2UZIH 3OJMB 3SO3C 3P4MA 2RCSH 3II1A 5JPNA 3VQMA 2X6CA 2D2CC 2JJUA 4GQRA 1EAPB 3DO7B 3E8UH 4LL9A 2WK2A 4QHKI 4R8WH 4D9LH 3DX6A 3BLKA 4MMZC 4BSVB 2ODHA 2XXFA 2XTJB 4TYUA 5HGBB 4YFEA 2I07B 2D7TL 5FUZH 2JKWA 1D5IH 2X9XA 1NFDA 2FO1A 4AEHH 4M7KL 4GSDH 2Z6FA 4ZW8A 4XX1G 4F33A 5MP6L 3B4NA 3C8KB 3CCHB 4HPOL 4L8CB 1DBAL 3VXMB 5IQ7L 1XCXA 1RI8A 2R2EA 3TBVB 5F7DA 1KBKA 3K74B 3FRUA 1CDCA 3I6KB 2NXZC 4I48A 4AXWA 3UPCA 1AXTH 1XF5A 1LK3H 4ORGA 4JFXB 3KD4A 5ICZA 2VR7A 1MIEL 5HSFA 4NO2A 4A2EA 1FIGH 4L1TA 2CO6A 3MA9H 4HIJA 2R69A 4JRXA 2FATL 4K71C 5F2FA 5GZOA 5K1NA 1KCLA 4NQDD 1SQMA 1FIGL 4FQ1H 4NRYB 4O4YH 4U6TA 1WUNT 1QBLL 4ODVL 4WO4A 1MIEH 4EUPA 4LSQH 3NUKA 1M7XA 3NEOA 3EO1B 3VFRA 1MI5D 3FO2A 1F4YH 1G7QB 5FK9A 1TJIH 4FLQA 2G5BB 1MVFA 1XF3B 2XWDA 1B4RA 4XB7A 3QZPA 4G72B 4MNGE 4PRDB 5D7LA 4XPAH 1DBAH 4OQTL 1EO8H 4OIAA 4X6BB 3S5LG 5AW9B 5IQ7H 5E9DA 4QYAA 1X7SA 3V4PL 5AAPA 1OPOA 4KXBA 1Q9KB 3VXSA 1GS7A 3GJEA 4QRTB 4ANVA 3AM8C 3OAYK 4IIQC 2FX7L 2XWXA 3BDXA 4PV8A 3MLRH 4UZGA 1QKZH 1FFOB 3ESNA 3MKGA 3DYOA 5GZND 3N43B 1HJCA 1T66C 4FXTA 3KLKA 1KN4L 1G7LB 2ZSWA 4HC1A 3OVUB 3VMPA 3QPQD 4JFOA 3X17A 5CZXC 3EDJA 4L3EE 2F58L 4N5EC 2FHBA 1PKQE 3S4SB 4DO5A 5CBAA 2ADYA 3ZKND 4YHZH 4AQZA 3PE9A 5IQ9B 5IR1B 1S9KC 2VO5A 2VLKE 4JR9H 3V5DA 1H5BB 2IG2L 3U36A 1NLDH 1U8JB 3L3KB 1YY8A 5JA8B 3JV4A 5FUCC 1OE2A 4PRAA 3FUDA 5K9OB 2BSRB 1KC5H 5BMFL 3Q44A 3E2HC 3EUUA 1VENA 2YD3A 5CGMA 2AFNA 3I6KA 5IWLA 2QQQA 3FB6A 1U3ZA 2OCFD 3QIUB 3HZMA 1HHJA 1UH2A 1LWJA 3LTVA 2ZKHL 3GGWB 2XWJA 5FYLE 4QYOB 1HDMA 3VSQA 3BUBA 2Y5TB 3E80A 4G7SB 1UD6A 1NCCH 3A6OA 3DV6A 4H8VA 3K81A 1G0DA 1N0XH 4JPSA 4EDXB 3T1FA 4Y9FA 3E6FB 3WFZA 1BFVL 3W37A 2FJSA 1BXXA 2OTWA 4J3XA 2GVYA 5KS9B 1HQ4B 3K4ZA 4XPBH 3UG3A 1C08A 4AMKL 5LG6A 4B41A 5AOIA 4X6FB 3ISWA 2YD4A 1GGTA 3S2AA 4RVBA 1MFCH 3D12B 2JELL 4Y1SA 4S1RH 1M7IA 4PRDA 2MCG1 3TBTB 3U9WA 3KL0A 3ZRSA 1OPGH 2Y7LA 4KDTA 5HHVL 4LPXA 3VXPA 3TBSA 2FBJL 2GIXA 2CGRH 2WNKA 4FXKC 3T3PB 4XOBA 4G42B 2PCPB 3TX4A 2Y6SD 4F8OA 4JZJC 4MZRA 4YDZA 2ZP0T 3QHTC 2CE6A 2C7UB 3MCYA 2ZOLB 2QZQA 2FEJA 4UTAA 3PHAA 4BKLB 1YQVL 1XH0A 2EKSB 1YYMH 1FZMB 2MNWA 1Q0EA 4X7TA 3BAWA 3KPOB 5AW1B 4KJYB 1YUHA 3BZ4A 1XGUB 1CXIA 3HG0A 4RZKA 3BVNB 3WTSA 2XWTB 2WGXA 2H2PC 3QG6A 3GMOA 4MA1B 4CVUA 5C92A 4KJWD 4UAOB 3K4AA 2ZONA 3D5OF 2Y1AA 5F7EH 1UOLA 4HF5H 3MJ7A 3K3QA 2W65A 2O6FA 3OMNB 1ZXKA 1A7RH 2GQHA 4Y2OA 1CD8A 5E9DE 3ZE1B 4APQD 2AS5M 4UQAA 4K3DL 5DRXA 1G6RA 1X5LA 3BZDA 1HKFA 2VR4A 3ZW3A 3AMLA 1CI5A 3AS2A 5E8PB 1SFDA 3FTWA 3PS6A 2G75A 4HJGB 2Y1ZA 3MODL 4NFCA 5KYXB 2BVPB 4HQQH 5C7ZA 4JL1A 3DVFA 4ZAKB 1I1AD 3OC8A 3IKCA 3TNNA 4EOWH 1AJ7L 4JG0L 2ATPB 2CAKA 3LRKA 3K5RA 2YKLH 3OGCB 1QNIA 4Y4KA 4RGND 1HHKA 4KPHH 4PLJD 4XP6H 1NMAL 4E41E 1T1XA 1LK2A 3UEZA 3L3DB 3WTWA 1BXVA 2AC0A 4WHYH 1UT9A 5L7XL 1DJWA 3W3BA 3VD7A 3CZUB 1C8PA 4MMXB 4G9FE 2IGTA 1BXUA 2WXPA 2QGDA 3LHAA 5HYJA 5T5NG 1JFQL 2DBJA 1KGCD 2NY6C 1L3WA 2CXKA 2BCKB 4NHUB 1OEZW 4Q89A 4DZ8A 3V52L 4IW4C 1GY2A 2V4LA 4H4NA 4Y16C 3NIFF 4DH2A 1BQSA 1U95B 3FQRB 4FFZL 2V9TA 2XFXB 4ZS7H 5C08A 4PQXA 4JO8A 5KBKA 3RAJH 4GKZA 4R7XA 3HS9A 5HJBA 4DP7X 5IB3A 1AO7D 4ODHL 1ERNA 2JXMA 3L5WB 5H94B 3GXPA 2H2SD 5DQDH 1FVCA 3MRLA 4IOIB 4ZQKA 3VRLF 4DSYA 3WDHA 1KYAA 5IB5A 2YD9A 1N6QH 4I18C 2JKIS 2CK0H 4HVBA 5SV4A 3G7TA 1GHFL 1KYFA 3BWAB 1FUNA 5CP3A 5FC9A 2TSBA 2DKSA 2XIBA 3ARQA 1NGWB 1XL6A 4G6AD 5IHWA 4DKTA 4PJ7F 1IBYA 1ZY9A 4ODXB 1EHKB 3A67L 3P2BA 1EH9A 1E27B 1YYLL 1E4XL 3G5XB 1BGXL 1S7RA 4RGNB 2H1LM 3P11L 1V55B 4XR8C 4F58L 2FBJH 5IV2B 2J73A 3DLQR 1ZRUA 1P7KA 2RIKA 5EH1A 3R8QA 2E3VA 3OKOB 3Q0HA 3QFJB 1MFCL 1WHOA 2ARJQ 4ETQA 3ARBD 3QUZA 5CGYC 3P3TA 1O7DE 4PJ9C 1E65A 4U3HA 4LLUA 2NSQA 1DBML 1D5MB 3DWTA 4NKOA 1FHNA 4F8QA 5SWZB 4YIQA 5AYUL 1T4WA 4UQ3B 3SBQA 2WWKT 3FBQA 3MBXH 4UQBA 4HD5A 3RKPA 1IC5L 2X89A 5IHZB 1EFXD 1G4MA 4AZ8B 3L9YA 1U3NA 1KJ2B 4PGZA 3ULAB 1CO1A 2OZ4L 2JI3A 3QCTL 2UWEE 2WTPA 3UG4A 4GBXC 2AQQA 2HJKA 4FRWA 2YSTA 5F8QC 2LT9A 1CE1L 1J1PH 1Z2KA 3H3PH 3TYGL 3WFHB 1R34A 4DGYH 2ADGA 3UZVB 3VFOB 1Q72L 4BK8A 5KG9A 2RTTA 3HI6H 4XO9A 4PJIE 4KNTA 1KDIA 3UBHA 2V2WA 4LVOB 3I9AA 3IWUA 1EZVY 3RTQD 1FQ9C 1JWUB 1LO4H 2VABA 3QIBC 4XI5C 5TQ2L 5DJCA 3PWPA 5GS1A 1PZ5A 1A3QA 1IM3A 5GGUB 4UINH 1G6VK 3HCVA 4E36A 3JTSB 5DJ2B 2RMNA 3MLYL 1HC1A 4Y8DC 3OR6A 1EZSA 1YMMA 4YH6A 1LDSA 3VG0H 4N2EA 1QSFA 2UX7A 3U6XS 1RHHA 4GG8A 1B88A 2CO6B 4HIJB 2NX5B 3N40F 1QHQA 3TWCL 4OZIE 2YIHA 2WWKO 4RWYH 2H6UA 4KNSA 1ILSA 1A2YB 1FFRA 1HQRA 4EDWH 3BKMH 1SNRA 4L8BB 1LILA 3RYMA 1HEZB 2BP0B 2J1XA 3QUZB 4XXCC 1BM7A 1NFAA 4EQ3A 2Y7OA 1AKPA 4MJJA 1BAFH 2CU9A 3JT2A 1BVZA 4QRRD 5B1JA 5SV3A 1ZS2A 4JRLA 3HC4L 4AXWB 2IANB 1SN5A 4FQHA 2BOCB 4R96A 1ZGLP 2XKUA 4OFDA 4LBEA 2DI9A 3C5ZD 2FL5A 4HW6A 3ARGD 3OKLA 4YHOH 3UTTB 5C0JB 5CCGE 4KZDL 3RWHB 1E5CA 4HMDA 4JLRB 2UWEF 4P3CH 3IF1A 4F2MB 4G7YH 4GQ9H 2APVA 3FT1A 3RWJB 3SDDA 1P2CA 4Y2DC 1MWAL 2X1PA 3LIUA 4R6UA 2DMBA 3MO1A 4HLJA 1EHLH 1FV1B 2FWOA 2CNYA 4ZOAA 3V52H 3VTTA 4FFWC 4EN3D 4MAYA 3F8UB 5GZOD 1N7MH 2YAPA 4HJ1A 3T77A 3IU4H 4FAAB 1KT2A 5D7LD 1JPST 4R0LB 2ATPA 1K8IB 1UXSB 1CS6A 5D1ZA 4P48A 4H8WC 1MCKA 3LNIA 4Z7NF 2VQTA 4P2QA 4D9QE 4FQQB 3FCUB 3QUGA 3PPSA 3GXTA 1XF3A 1XR8B 2DICA 2HG5B 4NUGL 2BY3A 1AP2A 4ODUB 2PPCA 4LFHD 3VXNB 4FJYA 4ZAKC 3O2DA 4ICXA 1IBBA 3G5ZB 1NAKL 4HK3N 4M62H 5KVGE 1KYOK 5CZXD 1A4JA 3C6EA 1CVSC 4PI2A 5ETUB 2B9BA 3GHBH 2CRIA 1RURH 3QEQD 5I1KH 1RLBA 4M1DL 1PGRB 1R46A 2EILB 1QQDA 1ETJA 1QWUA 3F58H 4XNXL 4OLXH 2OTWB 5DDHA 4QRBA 5SWQA 4UTBA 2HJLA 1F4HA 25C8H 4I3RH 4N0FA 1O5DT 1U95A 4RWHA 4H13C 1GGBH 3ZZSA 4QXTB 3KYKL 4XTRC 5FOBA 2CJTA 4Y5YB 3TO2A 4B5ZA 1ZT1B 3O41B 4RGOH 4XBPB 3NPSB 5C0FA 1H8LA 1DEDA 3BPLC 3GSWA 4WHCA 1MJ8H 2IWEA 4LLAA 2KC0A 2WWNA 3PP3K 1O6VA 4QHLB 5GGRY 4ELKA 1JXJA 1M56B 1PU0A 2XA8H 3FQTB 2WXKA 4WFHE 3HS0B 3GO1L 3K72A 3LZPA 3NCBB 4NLHA 3IEAA 3EYSL 4QXGH 4Z95H 3WL9A 2WXLA 3VMNA 4JY4A 4Y4KB 4TPRL 1NC4D 3WMPA 5L2KA 3N1GC 3IJEA 4TQEH 2HKFH 2IH1A 2P5WA 4V1DD 3PDDA 5GRJL 2JCCF 1OD7A 3TA3B 2VDML 3FCTB 5IB2A 2EIZA 2AJYL 5GJSH 2G9HB 4K7PY 1YNTB 3GSUB 1VADA 2FJGA 2QV2A 3SD5A 2YAQA 2OXGA 3BIAX 4JPVL 3G6JA 1YN7B 4G7VL 1E3FA 1K72A 4O2EB 1U93B 3DETC 1QSVA 1BCIA 1L4IA 5LHDA 3BE1L 2BIMA 3OXRB 3ZRFC 5CLWA 4KV5E 5EORL 3U7YH 2YC1A 35C8L 4MJ6A 3RWIB 1Q0YH 4Q9QH 2VL5B 4BA0A 3TPUA 3B2VL 3CN3A 2IOOA 4J4PC 2A3TA 4FQXB 4NZJA 1LDPL 3S36X 5IHUL 1ACCA 4WHTA 5JOPD 2FCBA 1WS8A 1U8PB 4JKPL 3QPXL 2QR0A 1RZKH 4GRLD 4FQJH 3UBGA 2H2PD 5I1CL 5KYYB 3U0PA 4X9BA 5GQBA 1CIUA 1QFWI 3LIZH 4J3OF 5DGQA 2GUYA 5PCYA 3MRCB 1A65A 4JFDD 3ARBB 4JY6A 1XV8A 1W0WA 2BSTA 1L9RA 2KUTA 5K93A 3OHMB 4AQEA 2GTZB 1HOCA 2HFFB 3MRFB 3ZTCC 3FCGA 4E0RA 2H2SC 4XPGL 4ZX6A 1BFSA 1TIUA 2Q8BL 2YD8A 4KXZI 1BQUA 5I1EL 1DCEA 1KNOB 2V17L 4AEIL 4HCGA 3CSBA 4A7TA 4JHAH 1KXQA 3KPSB 4OF6A 2AV1A 1MF2H 4KHTH 4BZ2A 4FL4C 3H56A 1OP3K 4JPWH 2NR6C 3HUJA 3DARA 1ORSA 4N2KA 3U1SL 3V0WH 4JPQA 5K59E 4NUQA 1J5OL 3MUGA 1AGDB 4N8UA 4OLWL 3VWJC 1XF4B 5KTEH 2VRAA 1EDYA 12E8H 1RK1A 4JPKL 3UO1H 3Q2CA 4YHNA 3CSTA 4JDZB 4KI5D 4PJHA 4MXWL 4DP9X 2GEQA 2GAZA 3RZCD 5DEJA 4PN6A 4YHOL 3HN5A 2JV6A 5KVFH 5IROD 3WFBH 1ZK5A 2BNUB 3CAFA 2QKIA 3A47A 4X6EA 2NY5L 5J6GB 3KDPB 3FFOA 3ZKXB 4UQ2B 4S0SD 1IT9H 5JDSB 4BH8B 3ULUH 4LLWA 1TZHA 4IOIA 4M48H 1MQKL 4JAMB 4UNVA 2VLJB 3D4CA 2AQRA 2G3MA 3CZFB 1QFPA 3DGGB 4PJ9D 4Y16D 3OTTA 3ZDXF 1YEIH 1LE5B 1GZPA 1I3GH 4WHTB 2FYVA 5C08E 2Z8SA 4M7KH 5K39B 2QQKL 4GAYB 3D2TA 2AAAA 1L7TL 1K85A 3IXAB 2GITB 2WLYA 1UA6H 2IANA 4PB0L 3I50L 4R0LC 5EWIL 3ZE0B 3JV6B 2QPEB 4JFOB 1O6TA 3TTSA 2EDXA 2W94A 3B7SA 1X5FA 4XO3A 4CMMA 5HYQA 5AAWA 2LU4A 4PBXA 5AYTA 1J9QA 4XO5A 3UJTL 2C1PA 4JANA 4LSDA 1E30A 3LY6A 5AEAA 1F3DH 2PW2B 2CO2A 5I1DA 5SX5H 3CHOA 1MQKH 4PJCE 4WTZA 3IXTB 1CF1A 4KFZC 1OCRB 2XUWA 3DHPA 3QFJA 4FQCL 3JYBA 1J7VR 2WO3B 4AEHL 4ELMA 2OLDA 4W6WB 2X4NB 3BVTA 3OR6B 1J1PL 4ENZA 5KYWB 1RJZA 3HNSH 3U4BH 3I3EA 4B6ZA 2GUOB 2AJVL 4OF7A 1JV5B 1JI1A 3C60D 2C9UA 3HS0A 3TONA 4POZD 3RPKA 1LP9A 1XGZA 4AITA 4M6AA 2G0KA 4MS8D 3ZIYA 5LAPA 1RP8A 1XCTA 5T3XL 3D3VE 1SJVA 3A4EA 4LSUH 5HYIA 3WBDA 1HH6B 2CLRA 2OX5A 5IKCA 4Z9KB 5C07B 3W81A 3AG3B 3TH2T 2E8YA 3QR0A 5DQJA 1G94A 1KBGL 3EDEA 3WFHA 4CA4A 5DD5H 4TQHA 2HJKB 4CU8A 3QNYA 1MG3C 4LKXB 2OYKA 2IAMA 3KLAB 4PCYA 1ZHLB 3RE0A 3JTTB 3RVUC 5ESAB 3DXAD 3HG1E 5IOPA 4WNQB 1W9XA 1RSYA 3DBSA 4MKMA 3GRBA 4DCQB 2CBMA 2EE9A 2X4QB 1KIUB 5AVUB 2XQBH 3PXJA 3RFZA 2YD6A 1BLNB 4JX0A 5CJOH 3TF7C 2R2BB 4YO0A 1OF2B 2ATKB 1G9ML 2Y07H 1RZJC 3BT2L 3QORD 4HUUA 4A55A 3U6XA 1TITA 2CCVA 4PFEA 1OT2A 3HR5B 4CBZA 2BMKB 4AWJC 2VLKA 3HKFA 3MMEB 3VYPA 3CUPB 3B2MA 3QHZH 1QNZL 4YXHL 3NPZB 3UZQB 1QSFB 3RP1A 5ICUA 1T2QL 3FU7A 4AGNA 1G7LA 2FIKA 3Q6GH 3QJSB 1C5CL 2DWEB 4PWJA 3QDME 4YDKH 2J1YA 2ICEC 4M7JL 2XKNB 4MJ4A 4HGWB 4JZOA 4WAFA 1IMHC 2ZCLL 2RGSA 4PJDB 4ZTOH 1F0LA 1YNTA 3GSUA 5HGAB 3WFDH 4OF5A 4HFWB 2GT9A 1A7PL 2OQJA 2WAHA 3UTPD 1JP5A 3TFKC 2XWBA 1AQDB 4WY7L 5F44A 5HHPA 3VXSE 2LR4A 1MCSA 1QRKA 3SJVB 5KG9B 1IBHA 1VFOA 1GC1L 2ZXCA 2X5PA 1HEJC 1HINH 3GMNA 4IRJA 4J2QA 5TF1L 4PY8J 4LCVA 4XP9L 3IMUA 4HZLB 3KCWA 2WXGA 3EJZC 3QVAA 4KHXL 4ZAKA 4LVEA 1HHJB 1I9IH 1NBYA 2IH3B 2N3JA 1XBRA 3JWNH 1BYOA 4WFED 1X5AA 5I82A 1BA9A 4ODTH 1NBVH 2HH0H 3MFFB 1MJJA 1JPTH 5GS0C 4YHIB 1HQRB 3C6LD 3UYPA 1K2DB 2F68X 4ELKB 1XGPB 2VJ8A 2KDYA 3MN8A 3MR9A 3EH1A 3NTCL 5KOMC 3AB0C 4CRPA 1ZE3H 5KAQF 2QV4A 4G82A 5TJWK 5IB4A 3OF6D 5DUBA 4KUZH 4FLOA 4C47A 3RNQB 2OCCB 2ICWA 3QULA 3T0DA 4N26A 1T0NB 4PJBF 3N6YA 1LE5A 1JZ5A 4I0PB 2GY5A 5EBMA 1YNTF 2X3BA 1FLTX 1WGOA 5EU3B 4KROC 4RNRA 4YFDB 1M1XB 5HI3D 2EEDA 3O4LD 1EVTC 1EAPA 3DO7A 4O5LL 5EEYA 3ZZ1A 4C4KT 1U8IB 4PBWD 3TYFA 3S88H 3MCKB 2NUPB 4GSUA 1GH7A 2ZUUA 3K0YA 4HA1A 3RI5K 3UZQA 3MUY1 2GSGB 4P49A 2WP3O 1I1FB 1NEPA 4R0LA 4IMLB 1WISA 2QL1A 3WU1A 2WWOA 2I60H 2FGWH 2UZYA 5A6MA 1BYNA 4MVBD 4XO8A 5L7XH 1M6UA 3GZOA 4UTBL 3F7LA 4F9LC 2NY0D 2PPDA 2WO2B 2CPCA 5TPWL 5FF6B 2VNCA 1NMAH 3K72B 1SDDB 4WDIA 1M53A 2DYSB 3HHMA 4JRXE 4QRSB 5T3XE 1RIVH 3HMXA 4JHWL 4M5YH 1EAQA 3DGCR 2Y24A 3R19A 2XNAA 1BHGA 3NPSC 3LS4L 3QJFB 2YD7A 4G8FA 3HUJE 4HUMB 2XZQL 3T09A 2WZPA 4U6HA 2GITA 4Z7QB 4WWKC 2K9UA 3W39A 1II4E 5KSUB 5IW6A 2ZX9A 1QFWM 4N2GA 4ZJ9A 1XCTB 2ICEA 3GDBA 4JGJA 4OLYH 3C8KA 3CCHA 3RILA 4HKJB 1PZCA 4OZGE 2YLHA 5DS2A 4AIXA 4G9FB 2NY1D 3BVWA 2GK2A 4TXVB 1EV2E 1XZWA 1JPTL 5DUPH 3AGVA 2B08A 5DGRA 2IFGA 1QFUL 4NZTH 3S9DB 4NCC1 4NNXA 3D34A 3D85B 1C5CH 3S35X 2RAMA 1D9KD 4OIFA 3N44B 4JO3H 5MERB 4M43H 1MFEH 2I24N 5JOEA 3D2UB 4K0OA 3BDBA 2A74B 2ZSWB 1EQWA 4PJIF 2IQAA 5I0ZA 2H0EA 3OX8B 4XVTL 2EVGA 3JUZA 2YUZA 3WIFA 3BX7C 3B56A 2OS7A 5FK9B 5LO7A 2DLEA 2P80D 3SDAD 1BX2B 3MLUL 1HXMB 3GSVB 4CL7A 1IGIL 1PG7H 2PCXA 3RIFK 5IB3B 4B96A 5E9DB 9CGTA 3EH4B 1MFDH 3P02A 5BS0D 4I1RA 1Q9OA 5E1QA 1WH0A 2A6DA 2E8ZA 1K8DA 5EHFA 1Q72H 2NQDA 1A6UL 3OSVA 3V4VB 4ODWA 3RX8A 5DFVC 3FT2B 4OF0A 1F56A 1MLBA 4G8GA 3ZQWA 1Y0LA 3AXLB 1W72H 4QOKB 3V7AE 3GLZA 5ILTL 4MQSB 3VGEA 5HHNB 4U1GB 4BV1A 4F93B 1ZTMA 4OLVL 3U0WH 4NWTH 3LH8A 2D7MA 2X0WA 3IDIB 3DIVA 3L95A 3U9UB 1BMZA 2WCPA 3FUMA 5D7JA 5ALBL 3OLDA 3FTGA 4XXWC 1VZHA 1X3DA 3WEOA 5BNXD 5JIIA 3T0ED 3BIKA 4X6DB 5B38G 3MPCA 5FEBA 3O2WL 4XN7A 5JW3L 3KPNA 5TDPA 3HJEA 5TE4L 3WIIH 4IU3A 3NVQA 4M7LT 4DP4X 3PFUA 5DD6B 3FBKA 3QNFA 4YNYA 4OUUB 1ZK9A 1NBCA 4K5LA 3BHBB 3VI4E 4F15C 1WZ1L 4KK6C 4DN4L 4P46B 2V5TA 1OAKL 3GFUA 3A24A 5KVDE 1BVOA 1USQA 2EYSB 4N9OB 2QSTA 5AW7B 1MOEA 2VR8A 3B8YA 5F7KC 2VLKD 4GKSA 4JY5H 3S35H 2NY4C 4Z7WF 5T5FA 1W72A 3OLIA 2J2ZB 3L54A 4R5VA 1JRHI 4OGAC 3O3BA 4RMUA 5JNYA 3F7QA 2HLFC 2QQLH 1X4ZA 1V3JA 4AE0A 4X7FC 2ZSVB 2WCSA 4WSKA 1A5FL 4G11A 1R3LB 3QWQB 3L4CA 5HJGA 5JLZA 1Q1JL 5ITBH 5GJTH 1CXLA 1CE6B 1SOXA 4GT0A 3V9EA 1HXYA 2C9AA 3Q2WA 3TF4A 4J12A 4AK2A 4RCAA 2BHYA 2G2RB 3MJ8A 3P9MB 1RIUL 1MHHB 5BO1L 4FJZA 2DM3A 5DC2A 4X5LA 1GZPB 5IBUG 2A83A 4YSSA 2N7AA 3M46A 4A6YL 2FGWL 2ZUQC 1XMEB 4DPAX 1KTLB 3QJOA 2WC7A 1YC8A 4X5XA 2NNRA 3BGAA 3MLTA 1MG2C 3AT8A 3NMEA 3IDMA 2CWRA 2F8XC 3UTQB 1F00I 1JXKA 2Q76B 1RD6A 2A6KA 3S88L 4EBQL 5CP3H 4ZUTB 4YPGA 1CFQB 2GJ6E 5H37H 3BUPA 3QNZA 3PHOB 4YFLF 3ETSA 5E6SB 2P26A 2WUCL 3QZWG 4ZO9A 2B5IC 5C1MB 1WLHA 2OQJB 3IJHA 1FFOA 2C3XA 3DPDA 4IKLA 4ZW6A 4FFYA 5E4EB 1IGJA 4HWBA 5ENWA 4JDTL 4WZ9A 4XNDA 2EDWA 4HS3B 2MQ3A 4ZMTA 5HYEA 1K4DB 1VFAA 2NY5H 1CGXA 4FFYH 1WIOA 5F3HB 3ARFA 3MUUA 3WOVA 3QRLA 4OKDA 4LHUD 1PY9A 3F2LA 1P7QB 3MREA 3QSKB 4HJGA 3ZZQA 3MJ9A 1ONQA 4AKOA 2BNRB 4G8EB 3D4YA 4Y9CA 2H7WA 2L4OA 5EPMB 4BZ1L 5EO0A 3FU3A 1TYJA 1DLFH 4G70B 1BZDA 3EF7A 5BJTA 3MQIA 4RETB 4JDVB 2NY0B 4N25A 2HRLA 3OLEA 3BPCB 4IDJH 2K4AA 5D6CA 3VFGH 2X4RA 3ZE1F 5C86A 3F6IA 4WV1A 5J6SA 1IX2A 2NXZD 3CX5J 3QDGD 3PUUA 4M1CD 1SYVA 3SJVE 3E9UA 4OLUL 2Z4QA 1B9ZA 1U33A 2F1EA 3ASWA 1N4XH 4X8JA 3NCFB 3DJSA 3CLFH 2KLRA 1GGUA 4XMUA 5KBNC 2Q7YA 1YNKL 2NRDA 3JWDH 1CU4H 4FMKA 4OD1H 4OM0H 4F1ZA 5JTWA 3W5MA 4FEIA 2CSPA 2DYPD 2WKLA 3RY6A 1UB5A 4CSPA 3LN4A 4GJTB 1V05A 1I4FB 1UASA 4DGWC 1FL5A 1AD9A 4NQVB 5E6UB 3BSHA 1EO5A 5I71B 3O3DB 2CKBH 3MLWH 2F53D 3V6FA 3TBSB 1T4KA 2EC9T 5HHME 4TUUA 3EOBA 2UZYB 3RIKA 1LYQA 3G6DL 4PSRA 2ESVD 4PJFE 4Z95L 4DFIA 4WKXA 4OCLC 1NCCL 1MCIA 3K5SA 2X9WA 2X1QA 3U7YL 4Z7AA 2Y1VA 1DVFD 2J5LB 5AB1A 2ZKWA 3DVGB 5ERWA 4HH9A 1R75A 1CK0L 3BP5A 4GLRI 1PSKL 4QRPA 4WW1A 2XZCH 3U2SB 2WZ5A 1IGMH 3UAAA 4XAWL 3WIHA 2AJYH 3LD8B 1UA3A 4PWGA 4QHLA 5IG7A 1CL7H 4IDJL 2L7JA 3V0FA 1GGBL 1WITA 1U3YA 2DPKA 1OCCB 2MNUA 3L6FA 4QRRE 2OMYA 3S3CB 3T0EB 5KBLA 4K8RD 1PEWA 1P7HL 1OQOA 3QDHA 4AZ8A 2OL3A 5T1DH 2DM2A 3KL3A 2BS8A 3PABB 3DRQB 2EDTA 4I18A 4NPJA 3FH7A 2VQ1B 4DQOH 1MAMH 1OSPH 4JN1L 2J71A 1NOFA 3KXFE 4OLUH 3ZL2A 2W9EL 1S9WB 1EEYB 2Y36L 3NSYA 4NWUL 3KPRB 2N59A 3Q9QA 3KS0J 2DBLL 2DIBA 1IFGA 4LSRH 4UQCA 1GC1C 2IDCA 5IIEA 3W0WA 3SOBL 5ECJE 4DW2H 3UBXA 4FNSA 5FKPB 3WXVH 1DLFL 4FOMA 4PBDA 4XOEA 4N1HB 2HRPH 5GHWL 3T2LA 1PBYA 4P23B 5D4JA 1RURL 2NYYC 4OVUA 3U7WH 5J1TC 1GYWA 1ZDSA 4N2IA 3DTXA 4XI5D 2BVOB 4XCYA 1UOVA 2J21A 3HHRB 4CC1A 1DSWA 4FQ1L 4O4YL 5EEZA 4PY7A 1N8OE 3WY4A 5EU3A 2A6KB 2JCCA 1PCXA 5GGVL 1URIA 1T3FB 1WP6A 2HT2C 1XB8A 1INQA 2YXMA 4YGVA 1CLYL 2FO4A 4L3CA 3VSVA 5F3FA 4XPAL 2VR5A 1Q94B 5JIKA 4OCWL 2DOCA 3LN5A 4KKBC 1YLBB 2VLJE 4YSOA 4AQ8A 2WUCH 1XQ4A 2LTQC 5D7IB 1GPOL 1JNNL 4ZX4A 2BNQB 4PMEA 1WZAA 3ZY7A 5MENA 3STZB 4PJAB 3UACA 4H8WL 4P3CL 3FTZA 4RAVA 2Q1EA 2X1WL 2OMZB 3ARDD 3CFKA 1DQVA 1UH3A 3FT9A 5CUSL 3VH8G 4CSSA 3WKQA 4ZSOA 3CGTA 3EJYC 3E8UL 4HJJL 4PPTA 1LO0L 3HC4H 1ODAA 4MZIA 3BGFB 3PXHA 2HB0A 4M7LH 3DIDA 1XAUA 3L7FA 2NY3C 3GSNL 4A2MA 4YX2H 3FO1A 2D9QB 1TEGA 1SOQA 4XOAA 1GR7A 4OY9A 2EIBA 3N43F 4OCSH 5EEVA 2E4FA 3ZYOA 2Z64C 5AB0A 3PNRB 1E4XI 3HC0B 2XU9A 2YQGA 1A6ZA 1QR4A 2COQA 1OGSA 1UQSA 4EKJA 4M5ZH 2GJ6B 2AABH 3BP7B 1CYWA 3SZKC 3D3VD 5B3JF 3CUPA 3S4SG 2VC2L 1LTXA 5JORB 2VMJA 2HKHL 5HDLA 1XSKA 2DY2A 1AZRA 4Y19B 4WWOA 3L9RA 3WI9A 1AY1H 1C7TA 1A3RL 1ETZB 3RPIA 5IEHB 1AANA 3AU0A 4XBPA 4HWZB 5ISZD 2NUTB 3INUL 5CJQH 4JKWA 3DHUA 4JCLA 4CILA 5B3SB 4KUCD 3S5ZA 4YZWA 5D7IA 4YLCA 1I1RA 2G0LA 3DOIA 4YVUA 4ODWB 2ADJA 5F1KC 1N0LB 5E4EC 3JWOC 4AGLA 4N22A 3HE7B 4QOKA 2P24B 3REWB 1KGCE 4X98A 2OMZA 3FT2A 2V5RA 5J06A 4N0CD 4PUBL 1CDJA 1CICB 1SLVA 4OZ4B 2ZNXA 4PJAA 5MHSE 1JTPA 4I1NB 2BOBB 3F85A 3NFPB 1I85A 1BFTA 4U1HA 3MXWH 5AL0A 5D2LB 3GMLA 1TMQA 1PJWA 2JKSA 3CVBA 4M3JA 4BZ2H 1ZHKB 2BOLA 4G59C 4XPHH 5EU7E 2CCWA 3UBFA 2VERN 1SUJA 3FFDA 4FNLL 5DXWA 3HTLX 4EKXA 1SUHA 1WWCA 1W0VA 1U42A 5IF0B 1U3JA 2WXNA 4PRNB 5D7IE 1R5IA 1IILE 1FL6A 1VCBC 3J2PA 4TNWF 2XPYA 1MPAH 2YO3A 4FD0A 3FQTA 1DEEA 2A6JB 2CDFB 3QWOB 4K7PX 5L8LB 3I75B 1VGEH 3QNXB 3N40P 4I2XB 1QYGH 3ZDZB 3VFTB 5BQ7A 3CK0L 3DJTA 4YPGB 2P7TA 5I18H 4UU9B 1TPXC 5DRWB 1MRCH 3GJFA 4FQHB 2XDHA 1KPVB 4RRPA 2Z4QB 4UDTB 2YPVL 1QLFA 1CFQA 1MVUA 1RZJH 3PREA 1ZTXE 1X5MA 2ALWA 4RBPH 4OCRH 4BFIB 5LVEA 1KJVB 5SWQB 3C5SB 3D2UD 4R26H 4PJAF 2QVTA 1XGQB 5D4QA 2EIMB 1AO7E 5T1MA 3DYPA 2FZ3A 2VQ1A 3FHEA 1E5AA 4NO0B 1KTDB 4W81A 4HDIB 3KPMB 2AHIA 1NKOA 3EGSA 4ZMXA 2XBZA 1JZFA 2JQMA 1MHHA 2OXHA 4OF3A 3CFQA 2BNRA 4P2QB 3D39E 2ZUTA 5HDBF 4AJ0A 4P9MH 5I0XA 2ADFH 1BVLB 3AC0A 5EBLA 3QEHA 5F3BB 2HZHA 4O00A 2VDLL 2ADFL 4YHNB 5DEGA 4NSKB 5I19L 2A9NL 4QOKD 2OZNA 4Q4EA 1X6LA 3O6KH 5IB1B 2NY4B 4G7YL 4P2AA 4IU2A 4CMHB 1S7QB 5D72L 5IV2A 4XCYB 5TE7L 1TTGA 2IAAC 3GBMH 3QIBB 2HWZH 3FN9A 4WI6A 3RZCC 3V4UH 2BX5A 1FPTH 3L7FB 2WKGA 2YEZB 2BXYA 1ZSDA 3X1EA 4NBXB 1FO0L 1JF5A 4X5WB 4LBEB 4JFDA 1DQKA 2D3JA 2D4DA 1NUFA 3WKPA 4Z3IA 4HCIA 4B50A 2XA3A 2GSIB 3OV6A 4HALA 5GRUL 4O2FB 3VU1A 1NH6A 4NYLB 4NXSA 4F37F 5KJRL 4KNQA 4B9IA 2FBRA 1BZ9A 4TOYH 1QEWB 3DOHA 3QORA 5L4MA 1DUYA 1JS4A 3VYOA 1BJ1J 3TBYA 4IOFC 1F58H 1IAKB 4X4MA 3JQOB 2N0MA 3TBBA 4N2NA 4FQIH 4K3DH 3QRBA 3L5JA 3VG0L 1QRNB 2QDVA 3GM8A 3MV7E 4JQIH 1QLFB 3QI9D 2IAMD 1M2VB 5EO9A 4LVNC 3JTBA 1FGNL 5JPNC 4K7FA 3CFBB 5HHVH 2VYRE 4PWHA 1JRHL 5FKAA 4XMVA 5HPMA 1A8ZA 1QTYT 2A6DB 2G3ZA 4IS6A 1I7TB 2HFGL 3L5IA 1U0QA 5IJBC 4IRSA 4B3EA 1EZLA 1AOHA 6PAZA 2ED8A 4GBXD 1FE8L 4G6MH 4A39A 5BVPL 4M7JH 1QLEH 5DS8A 5B38A 5HHOA 3N85L 3P1VA 1SDDA 3DTXB 5T5FH 3ZTDC 3LDBB 3N04A 3QIUD 4XP1H 4N24A 4E42A 2ZIDA 1ZT7B 3RY6C 4RGMC 1L6XA 1MCCA 3CXHK 4JZNA 3POCA 4ENED 1PX8A 4W9GC 2BZ7A 5T3ZE 1ZT4B 1BIIB 1PPIA 1Z66A 4OIIH 4QHUB 1U9KA 3AS1A 2CR6A 2F8VA 3T3MB 4PYGA 1HHKB 4DT2A 3D85D 4WK0B 1EZVX 3BUDA 1YJDH 4ALAH 2VTFA 2C1OA 4MLSA 1CYGA 1MSPA 2OM5A 4NO3B 4TUOB 2QMKA 3ZE1E 4UM8A 5I24A 5C0BE 1G7MA 2VZ3A 3HI1A 4J3OH 4KVNL 4N2FA 2YZ1A 2FAUA 1B2WH 4R5TA 4WNQA 5C09E 3HRPA 4PJ8C 2P48B 3PP3H 2D2OA 4OCXL 3DV4B 1JZJA 5HHQA 4OV5A 4XHJD 2W5PA 5C3TA 4JCMA 4BHUI 3EFFB 1ZPLA 3SEPA 2ITCA 4IIQA 4KI5F 1RZFH 3NSCA 3S3JA 5JW5A 1VESA 5FO2A 1OTUD 1T89C 3CFEA 1OAQH 4AGOA 2VW4A 4A37A 2OSLA 4F58H 5ICXB 4YJZL 4KX7A 2UXTA 2H3NA 4QAMB 1HZKA 2DYRB 4HEPG 2VXTH 4FMFA 4XCEA 2IPUK 4QTIH 4Y16B 2MCAA 4OZGF 3WIAA 1J86A 3SPGA 3OHXA 5D96C 2Q87A 2FWLB 3VM5A 1U3HD 1W8OA 5DTFB 3OB0H 3ZSSA 1KG0A 4FI6A 4JM4L 4I1PA 2K45A 1I9JL 2VDNH 5AZEL 1JERA 1AHKA 3NJKA 2HLAB 5JO5B 4YDIH 4FQQA 4LHUG 4Z3FA 1O7SA 4B27A 3SJVA 3DX7A 1F4YL 3SD2A 3BZFA 4E68A 2DW5A 4HETA 2RJMA 4LCUA 4AQAA 4I77H 5F96L 1LO0H 4GKNA 3A6BH 3DTUB 4N4YB 1DVTA 4ELMB 2J6EH 2P44B 1TQVA 3KAAA 2G60H 1F97A 4ANKA 1TTUA 1GZHC 2LLLA 1S9XA 3OKEA 5F6HJ 3B5HA 4R4FH 5KZCD 1CC3A 2P3YA 2DEWX 4FP8H 3SDXF 5B3NA 1HWHB 5E5UB 4N5ED 4HG4J 4ZS7L 3T2QA 5BZDA 4H1LG 2CA4A 1IGCL 3NRPA 2MMXA 3OB0K 4WSJA 2Z93B 1ACYL 1CGYA 4WUUB 2GI7A 5ESQB 4ACPA 4EQ2A 1C16B 1BF2A 1JNJA 3LRMA 3C60B 4N68A 1TQCB 2UXFA 1BZOA 1S3KH 3KPNB 4WW2C 4DPBX 4X5PA 4L1LA 1A7NH 1I8AA 4I48B 3CDYA 1D5IL 3BJ91 4LSQL 1QBLH 4HUWA 5AVQB 3VG9C 3TBVA 5FDWA 1CDHA 3A6CH 3DV4A 3FFCB 4Y5XC 5HYJB 1WCQA 4G8EA 3II3A 1E90A 3NRQA 3WLBA 1NBYB 1KPUB 4KPHL 5EBWB 5EIVA 3PF2A 2WVVB 1IJ9A 4M03A 1SZNA 2CDEB 1VACA 2HRPL 3MYJA 2ENPA 4RDQG 3IKCB 4LLQB 4HPOH 2NPLX 2VDPH 3C6SA 4IOSD 4LGPB 4I13B 1OCZB 1LLAA 1DSFH 3WHXB 3HG2A 5MEOB 3QUMH 5KVFE 4ODSL 1LE9B 5HDBE 3Q3GA 1A7RL 2H6PB 4HHAB 4XODA 4EN3C 1QWNA 3RGVA 4HT1L 5GS1C 4FTVD 3KW8A 3ZQ9A 1LO2L 1JGLH 4O9HL 1R0AL 1E8XA 4NQDA 1KUMA 1VB9A 2F54B 5EZOL 4QRTA 5EN2B 4LCUB 4I0PC 4TQIA 1F8TL 2F53E 2UZIL 1U8OA 2YFOA 4I5BB 4JMXA 4TQ8A 5C6PB 1NA8A 3NJGA 2ICWI 3ZKXC 5MEQB 2HT4D 1AGEB 2W9LA 4JFSA 3HG3A 3RUGA 2GTWA 4PJAE 5D8JH 2CALA 3LIZA 1ADWA 1K4CB 2AJXH 5AVVB 1UZGA 2TSAA 3HNTH 4HDIA 3AU1B 4NKQB 1FWXA 1ZD6A 3ARBA 2BMKA 3QUZD 4ONHB 3SCMC 3LNDA 4J6IA 4KZEH 4A04A 2R0LH 4UT9L 3S36L 2Q86B 3GUFA 2YPKB 2HVJA 2F7RA 3GNMH 3I74A 4OFYA 2ITEA 3FOLB 4EJ1C 3AQDA 5FF6A 4ETQB 3OGOE 1UZ6F 4R2GC 4NT6A 3TVMB 3TPKA 2C7FA 2XNAB 4AG4H 1MZZA 1AG6A 3OKDB 5EZPA 5A2LH 5HHQB 3IMTA 4OV5B 3NOIA 3UC2A 1RCYA 2WQAA 4HC1L 2ZKXA 4Z8FH 1BM3H 5LBSL 1N2RB 4L8SB 3PGCA 1BFVH 4WFHD 4ZOCA 4GI9A 4ETYA 1UM5L 2GAZB 3NCJH 1GL4B 1A4CA 1TLMA 3DVIA 1JK8A 2XA8L 1HZLA 4UZSA 4GS7B 5E6RB 3WN5C 4XBMA 3IDUA 2V2TB 1F8TH 4PVMA 2VN3A 4QHUA 5LWYL 4I0PD 4MBRA 3LDBC 1QI5A 5DRNA 5BPPA 3MRIA 3RDTA 5I6MA 3NSXA 3ZPDA 5KWYC 3PP4H 3IRPX 2NW3A 2F1AA 1QHOA 1QVOA 4F92B 2OP4H 1RULL 5I0DA 4LAJH 1I8LC 3B2UD 4BRVA 2ZG2A 5I5IA 4YFLI 5HHNA 4UILL 1CPUA 4UIKL 2Q7YB 2EE3A 5D5MA 5L6YL 3B3BA 25C8L 4QIRA 1FL5B 2JXMB 5AVWB 4R4ND 1WZLA 3K2IA 2MCPH 4AOFA 4R7NB 4BCYA 1FFNB 2GJRA 3QULB 2R56L 5CHNB 2GKIA 1DBJH 3TIDB 3RIFF 4NJAL 3ML8A 4ZMPA 1OKEA 3GI8H 1R5WA 4P2RE 4ZPVB 4F7PB 4C56B 4FG0A 3RKDD 4I4WB 4JEGB 1GOFA 2BRQA 1J0ZA 1RUKL 1R33A 3KPSD 1MDAA 3Q8EA 4F15B 2D31A 3O11B 5B3JE 3I2CH 3RL1A 3STBA 3WNKA 1J8HB 3ULVL 4GRMB 8FABA 2XWEA 1VZIA 3T6XA 4ABQA 5DFAA 1Q0XL 4JDTH 2N7SA 1TTFA 5CIPA 3AS3A 3OJVC 5CS7A 1MRDL 1QEWA 4N0UB 7PCYA 3WHE0 1UWYA 3QGVA 4U1MA 2R0ZH 5E0QA 1AR1C 5DO2C 1FNGA 3ARGB 2EDDA 1JK9B 1FSKB 2BW5A 4PJ6A 1LEKA 1P7KB 1UGNA 1ZEAL 2CHZA 2DV6A 3C6LB 3TIEB 1KF9B 4NM8H 4PU2A 4ZOBA 4V2CB 2W9DH 1E9OA 3OKNB 4WW2B 1QSZA 2P4AB 5FUCE 4KDTC 3UAJD 1M71A 2CIIB 1H8NA 5CD5C 1JAEA 3A4FA 5CBEB 2LGNA 1P69B 5TDPB 3W2DH 2OMXA 1KLFB 5C0CE 4U1LB 3QDMD 1AXTL 4ZUWB 4AYSA 3L17A 4I18B 4UBDC 1OT1A 3T0VA 3DRTB 3VXME 2O6PA 1FZOA 5EUOA 4DPCX 5ESAA 1NDGA 1QUNA 3KXFA 2FECL 1EFXB 1Q1JH 5ITBL 2XN1A 2OSLB 4JFQB 3NCWA 4RWYL 1PD1A 2VIRB 1P9MC 1OB1B 4HK0A 1IKFL 4PRHE 3CDZA 3L3GA 5CGTA 4LSVH 4KTGA 2WPGA 2VW7A 4R8WL 5ETUA 1BLNA 3LHPH 4LOEA 2V7NB 1MCJA 2B5IB 3FT0A 1RZQA 4ZDHA 4C4BA 1CE6A 2X44D 3ARPA 5FIEA 4JB9H 3V5DB 3NSJA 1GGIH 4WI2A 1IC7H 4N0UE 1ZLSH 3Q8CA 3V8OA 4YGVB 5DJCB 4J8RA 3WUWB 1VCAA 3C5ZB 1HSAA 3E9TA 5B7FA 1ZS8B 2C9PA 3H4HA 3ILPB 5FYKU 3ES6B 4P57A 3LNFA 3TWCH 5B4MC 3VB9A 3GKZA 3MLVH 4MBOA 1AQDA 3LEXA 4AYFB 1QBML 3QWRA 3M1OA 4WWKA 4B5EA 4LP5A 1LEIB 2BPBA 4J6RH 4MCYB 1I1AA 4C56E 1RERA 1TQCC 4ABWA 4P46A 3TBWA 3ILEA 1CR9H 2AI0L 1RUQH 1BZEA 4KJPD 1E9OB 5AG8A 1A7QL 3D4GA 3NIGE 4I3SH 5FHBL 4PRID 5TQ2H 1TZ8A 1BBJB 2WMPA 3FQNA 1G6RH 5FV1L 3T1WA 3VFSB 1S46A 4XMXA 5EOCL 5FPIA 5EIIG 2B1AL 4IGBC 1DQIA 3RB7A 4AJWA 1Z6JT 4LU5L 1UXLA 5T1KB 1BLIA 3GI9L 3LQZB 5LG1A 4DP6X 1MIML 1PFCA 1T5KA 2BFVH 3HIZA 3UYPB 1Z9NA 3V9CA 1D7FA 3UTTA 1U3HA 4JGUA 3WJMB 2QGEA 1OSZA 1D5MA 4ESKA 3BPLB 2IVFC 1ZT1A 3CZFA 1GGCH 3O41A 3CN1A 1KPUA 4KO9A 1BMGA 5SWSD 3SYAA 5CAYB 3QFGA 5EU6A 1C1EL 2DRUA 4WSGA 4C55A 5M95B 4IEFA 1J12A 3J27A 5A2BA 4PJEE 4HS8L 1TVHB 5ADOH 1KJMB 1MFAL 3P11H 4ZUVB 4DN3L 4PRPE 1LO5B 5F6HI 5GISH 1I9RH 3K7UA 2VGLM 1N5AB 4HBQA 2F61A 4GXVH 4L2LA 4KVCH 5HJ3A 4IBWA 4L4TE 3H0TA 3N1MC 5AYUH 1TO4A 1YUHB 3RLSA 3X14A 1W72B 4QRQB 2WLLA 1Q9OB 2WUBL 1MW1A 2AEWA 3RGVB 5A2IH 1T89A 2ALAA 2C26A 4GO6B 4JFYB 1OAXH 2Y3NA 3AQYA 4J2XA 2E6JA 5DFWH 3CNKA 1G7PA 2CK0L 2YAOA 4Y4HA 4HIIA 2OKMA 4IJ3B 5GRVL 1A6AB 5J1AA 3WUWA 5J57B 1M3JA 5HYSG 5CCHE 1JDDA 1FN4A 1Y18B 1XD1A 2CHDA 3L4ZA 2BVUA 2OMWB 2Z31C 3H7LA 4X7CC 3BO8A 2JTYA 3GSXB 1PEZA 2MTAA 3AUWB 1QPPA 3BPNC 4JFFB 2AW2A 5DZLA 2WVVA 3T4AA 1AD9B 4NQVA 2J12B 2A83B 2D3LA 4GRWH 3EIFA 2VDOH 3HG5A 4WRLA 2F74B 1KY7A 1GKEA 1PLGL 2FRGP 3CFNA 2I5YH 3T1FB 4DZBA 4MQXD 3W39B 3O8XA 4XMKL 4EN2A 4F27A 4ZMYA 5J11B 1WFTA 1TEFA 1FYTD 2NY7L 1PZ3A 2BWQA 2QBWA 4HWEH 5TPWH 1JYWA 3MACH 5MENE 2EVHA 1PKOA 4NERA 5BQDA 5I76B 1JGUL 3BESR 5IW6B 2FGZA 3QFJE 1QABA 4AMWA 1J18A 4YC2B 1WTLA 3SYQA 2D7PA 2EXWC 1SY6L 2FNBA 4XP6L 2KLSA 3ZYZA 4N8CL 1IBFA 1JGUH 2ZT9C 1ZIAA 1HL5A 1PFOA 3DK2A 2YN5A 4AJVA 3CSYA 1AS6A 2FJGB 3GBNH 2V7HB 4LCWD 3ZSTA 4X2UA 5CLTA 3IGKA 1V54B 3QNXA 1RZ7H 1X7QA 4PS7A 1NIFA 1RVFH 4GP4B 1HL9A 5EZJB 1DQJA 3B6SB 1DVFC 3KLDA 3PAZA 3VWKC 3WE1A 4JJ5B 4LGRB 5I23A 5L8JB 3TIEA 3NH7L 1UJ3A 3VXSD 1FNSH 3VVVA 4AQ1A 1T3FA 3NEEA 4TS6A 3TGXA 3KH3A 4EIZC 1MFBL 2D7OA 5LXVA 1KN2L 5I2IA 1YEKL 4ONOA 4MYWB 4U1KB 5LNDA 1JYNA 3KVDD 1GZHA 4ZMNA 4MMYA 3VJ6B 1VJSA 2VXSH 4ZZFA 4LNVA 3H2WA 1MH5A 2YZ8A 1TJGH 3NESA 3LZRA 4B53A 1D6VH 1X4XA 3FQRA 2NX5E 4R4NC 4NQEE 1NCAH 2ZOKA 1UZ6E 2Y7QB 1ECYA 3UBXI 4QRUB 4BM7A 4XP9H 2DI8A 2VE6A 2J25A 4YDJA 3MHZA 1WBYB 2L8AA 1YRKA 3OXSB 3NN8B 3P0VH 1OLLA 4AY0A 4XC1L 4PRIA 1DVZA 4OGZA 1OP5K 5C6TL 2GBVA 1XGPA 1K4CA 1PD0A 1KXQE 2O5XH 4NXKA 1MW0A 3ZGHA 3SQRA 3IJ9A 2KI6A 1SMDA 4KK8D 4MD5B 3UPAA 3VX0A 1L7IH 4MAYC 2XTJC 3GMMA 2YC1B 4MJ6B 4BFFA 1ZJBA 3I6GA 1TZIB 2V3FA 5GGQH 4JHVA 4FQ2H 4WW2A 3L45A 4GS7C 4DK5A 3B2DC 3QQ4A 4Z7VB 4NOFA 2ERJC 4EN3B 2KHAA 4XNMA 3QYNA 3WFEL 3BKYL 1YECL 3RFRA 2J88L 1TTBA 2KT6A 1A0QH 4DIXA 4F3FA 4NO0D 2YRLA 3V0AC 2F7QA 3NBNA 4R7DA 4NKIH 3NJNA 1YNLH 5I9QB 3EKCA 2D7NA 3Q1EA 1A7QH 2VSCA 1MFMA 2VMFA 4H8PA 3RWHA 5SWSA 5T3ZH 2AABL 1KBPA 1HOCB 1OTSD 2E9WA 3IMRA 4X6CF 4GRMA 3HFML 3FO1B 3ML9A 1OK0A 5IFAH 5HD8C 4H2AA 1J88A 4MJ5B 2YR3A 4JFDE 3ULVC 1Z9OA 3PWVB 3F64A 1CXHA 1A64A 2BO0A 4LL1A 1FF5A 2ROYA 2W38A 2LAAA 3GDCA 1UACH 2YMOA 5H4ZA 4P5TA 2AXFB 4NCDA 2AANA 5IZ7A 5K9JH 5T33L 1CVRA 1CQYA 4LP4A 4HFUH 1QPKA 1EJ8A 2XYBA 4QHKJ 43C9B 4M1CC 1U8QB 5LAXA 4PJXE 2VE6B 5J6HA 1TFPA 4JB9L 1IEHA 5L2KE 5C0BD 2NXYB 3ABKB 4RSYA 2A4ZA 4WWKD 2J20A 2APBA 3MNWA 3IDYB 3RPIB 3QZMA 1KCRL 4ZFFA 2EH8L 1P6AB 2VISA 5JHDA 1WT5C 1PYWB 2FO8A 4JR9L 4L8DB 4PG2C 1ZIBA 5I74C 1AR1D 3RY5A 3SDDC 1GPOH 3UEQA 2CMRL 4LFHG 4NPYA 3THMH 3V4PB 1CWVA 5B21A 1AO7A 1E5UI 1OAZL 2Y25A 1DUZA 4A67A 3Q1SL 4DGVH 1N70A 2BC4A 5ESVA 4XN5A 1S4IA 3B8SA 1WICA 1FNGB 2DQEH 4MNQE 3S96A 3WSQL 5DUML 3TZVA 2Y5TA 3RVTC 1W91A 3I50H 4HXBH 1PVHA 2UV3A 3MRBB 1CURA 5GRZA 1U8LB 3HE6A 4CVZB 5CD3B 3DX9A 2P5PA 4P99A 3OAUH 3VXRB 3X3FH 1AKJD 4R83A 4JG1H 4W6YB 2NY2C 2VUOA 3KBHE 3KPTA 5FYLH 4U3CA 2C1PB 4JANB 3P4OA 5L88L 3BEVB 4HUNB 3DVNA 3V6OA 5AZ2L 1EHXA 3K0WA 4WU7A 4V1DA 4H2CA 1MFNA 3LKOA 1NSNH 4MA1C 1M42A 1BV8A 4PJXF 4APQC 4C56D 1JZ4A 4RZCA 2Y36H 1RIHL 3D1MC 1TETL 4LO9A 3OWRA 5I5MA 3RZCA 4ZNEA 4LIQH 4HPYH 2CLZB 3RDTD 5FGBA 5DR5H 3H55A 5MEQA 3ESMA 2WXQA 2G30A 2MTPA 2NT0A 4BSVA 1XT5A 5DUJA 1OF0A 1J8HD 3TS8A 1MCEA 4IBQA 5CFAA 1D3CA 1SXNA 1XH1A 3L1FA 3L2LA 3K91A 5F9OH 2AMUA 2ZUYA 1RHHB 4KHTL 3VWKA 4JHAL 4HIXH 2ZOTA 2V8MA 5K9KA 4KKLD 4GSDL 3BQUA 1EO7A 4Z8FL 4QOKE 4WEBH 4JVUA 1NC4A 5IGXH 5TFSL 1RULH 3FFDB 1NLBH 3MLZL 3BUQA 4LAQH 5HPOA 4D9LL 3LH2L 4M6ML 1FZJA 1E40A 2YJLA 3LQAH 4FQLL 2DQCH 3WL9B 5LGJB 4Y1AD 3PWLA 3ULVD 4OI8A 3CDGB 3O6FC 3PV6A 2XT1B 5EU5A 1VGKA 3LZLA 3QJHB 4AJYV 1CF8H 3PGCB 3CVDA 5E00A 3VFRB 1FVDB 2EADA 3CC5B 2AEPL 3JVGC 1N5AA 5IHUH 4E9YA 4M4PA 1RKRA 3FTXA 2H0PA 1KEGL 3B9KC 3BSGA 3WO4C 1R5VA 2VDPB 3NK3A 4UCFA 3GIVA 5CEYA 3RPBA 4GUQA 3DSFH 3PWPE 4J3SA 4Q8BA 1YHPA 2DWSA 4PYHA 5D1XE 5I30L 3BZ4B 3PL6D 4AG4L 3PABA 1ECZA 1TKWB 4QCIB 1PAZA 4OIBA 2LABA 3IYLW 4Z76B 4IGBA 2P8PA 3GQFA 4OZHA 2P1YA 4HIEA 2BHZA 2KYIA 2AF2A 3IK2A 3QDJA 3QORB 1AZVA 4XMPL 1N5YL 2WBJB 4ZW3A 3RDTC 4WEBL 4JNXA 5JYLA 1RAMA 3HNTL 5IQ9A 5IR1A 4CC4A 3LKQA 5KVDH 5HYSA 3L3JB 5IFHL 1OCOB 3KWWA 3ESOA 3O4OC 1JYVA 4HV8A 2NY1B 1DZBA 3D0VA 2J6WA 5BXFA 2PCFA 3TH4T 4R97C 3KPSE 1MLCB 1I8IB 1SEBA 3IWVA 3E3QC 2O26U 3QC6X 2MOVA 4JFYA 4N2LA 4XXCA 2HTKC 1NC4B 3IMSA 3L1OL 4FS0A 4PY7B 4ELME 3H9YA 5IB1A 4UANA 2IBGA 2EKJA 4JFTA 4G83A 4HPYL 2H8PA 2DIJA 3S34H 3BMVA 4AVHA 3EOAB 3LXCA 3VH8A 2WXRA 3W56A 3TN0C 4TNWK 1RZKC 2V0AA 1U8MA 4WTXA 3US9A 4FFYL 4OGXH 5D7JD 1A9EA 1LD9B 1DANU 4M02A 4IOFD 1XF1A 3Q5TA 2X9ZA 3QDGE 4YEEA 3D0LB 5IJCC 2Z65C 3P30L 3FYIB 4WK4B 3QEQA 4ZXBD 1CTMA 4HU8A 2X6BA 4OTXL 3BZEB 4Q6YA 4EZKA 3MJ9H 2R15A 4NRYA 2WYZA 2WQSA 3B9KD 3UFIA 3QA3B 3EFDH 4U0QB 5AB2A 1CG9B 1DJXA 4LIQL 4HXBL 4JDEA 2A0LC 2PNDA 2XV3A 2YRZA 3FQUA 5D7IF 3UTSA 4MDIB 2W80C 1WD8A 2J6EL 5I8OH 5ISZE 1ZGLB 1IM3D 4LCYB 3WTYA 2RQ8A 4DGVL 4MD0B 1U93A 1XFPA 3IU4L 3V8CA 5BQ7B 5HDWA 3LEYH 5A2AA 4WO4D 3HS8A 5DT1L 2QPDB 2YEZA 5E0FA 5DD1L 4NM4H 4RAHA 3L3IB 3UTSE 4I0CC 4EIBA 3FU9A 1I9JH 1KLUB 2B14A 3HZVB 3EBHA 5CJBA 4GKSB 1JTOA 2OL3H 1F4AA 4P3WA 1E6JL 4G6JL 4HWBL 4NP4H 4IBUA 2OMTA 5C0AB 1NGYA 5HYSB 4IOSA 2ADGB 3ZKMC 3ZO0A 1GSMA 3DXAE 3HG1D 2H26A 4M3KB 5DZOA 9PCYA 5I1GL 5J1SC 4I2XE 3ZDYF 4QRRA 4W4OA 4HCFA 3FUHA 4OFVA 3SGJC 4HIQA 3LPWA 4DP2X 1W0WB 2BSTB 1O9ZA 2HTKD 5F89A 4PRIB 3FAXA 1J1OL 1CD1B 4Y1AA 4AV4A 4UUJB 5E8PA 5LQBH 4N8VB 4WVRA 2CMRH 1J5HA 5T33H 4R7VA 1K3IA 4QTHA 3CVHB 1OCWH 2GC4C 2ITDA 4PTUA 3BEWB 3GS7A 4AYBA 3KJ6L 4Z7QF 3OR7A 2NNAB 3GGWA 5SWZA 1MH5B 1G87A 4PJFA 4LVOC 4Z0XA 1WC7B 3ARTA 5B1CA 1L9MA 1NFKA 2CKBA 1TTAA 4M00A 2RB8A 4Z7QE 5LQBL 3T0EC 1MFAH 5HI4D 3M7OA 4F7CB 1KBWA 2A77H 4MJHA 3U4KA 4KY1H 3GK8H 3IPEA 1YEEL 3HS0C 4X0NA 3ZTEA 3U0WL 4U1SB 3ZTJH 3DIFA 2OMXB 1SDYA 5CP7A 1MJUL 5D71H 5EN3A 2ZXWB 1RJLB 5MEOA 2GG1A 1UACL 3VW3L 5F7MC 1G1OA 5JXAH 1A14H 2FH8A 1WGVA 5ALCL 2F19H 1FL6B 3D87B 1ZV9A 4FI8A 4AK1A 5C08D 1KELH 1RJZB 3O3UN 5JXAL 4FULA 4Y4FB 2FJFA 3H53A 5IF0A 2YRBA 3VMOA 5CILL 1FE8H 1AHWA 1TJMA 3QXVA 1OGAA 4GQQA 5C97A 1IGIH 1PG7L 3IU3A 4U2YA 4NBYB 3N91A 5GZOC 2Z1PA 2N56A 1DL7H 1T6BX 5I74B 3SDDB 3MROB 4XC1H 4DVBA 4P4RA 3QI9A 2D3NA 3KDMA 2WLLB 3TO4D 3E7JA 4N8PA 2FEDD 4HP5A 1H3VA 1CFBA 3SO5A 3L3JA 4H88H 3VFVB 1IEAA 4RISH 2JI2A 3KJ6H 5DJDA 3FSAA 2JE8A 2FLBT 3D39B 2V5SA 1P7QD 1IU1A 4XP1L 1XGUA 3DUUA 4LSSL 3FTSA 5C8JB 3ARDC 4PMFA 5EA0H 3HC2A 3LRSA 3DYMA 3P40A 5ESQA 1IFHL 1I1YA 1CQKA 1CGTA 3BEWA 4Y4KD 3EGSB 3FHQA 5I1AB 1R24B 1UUSA 1KJ3L 1YEEH 3MI6A 3NFSL 3VGFA 1KTDA 5MENB 1A4JB 3T4AB 4WUKL 1MLBB 4E9LA 4B0MM 1JPSL 3OAWA 1C5BL 1IARB 5DFTA 2HAZA 1HKLL 4UTAL 3UXFA 5CD3A 1U8NA 1AGEA 5EG6C 4GW4B 4XGZA 4XZUB 1MWAB 5DWUL 5E2VH 3O81A 3IFPB 5GGUA 4HOZA 4TVPH 4PRHB 2VDLB 2UY6B 1PZ2A 1LK2B 2EVFA 4BFNA 4XHQA 2V2TA 1Z3RA 3BP4A 3QIBA 3OGCA 3CU1A 4XCCL 3WNIA 3CV5A 1RU9H 3L16A 3MRDA 4X99A 5DJ6A 1DO5A 3SODB 1ITCA 5KJRH 2ITFA 4XWOD 5LGJA 1KTBA 1VERA 2IDTA 3BXNB 5DF0A 3SQOL 3NABH 3H42L 5JHDB 1T0PB 2VKWA 3NACH 4AENB 2XQYG 1AQHA 4MNHA 1GAFH 2IOMA 5IMLB 2H3KA 4U7KA 1NCJA 4FABL 1ZPUA 5KSBA 2HWZL 3L8QA 1L5GA 3QHFL 4UQEA 4Q0XL 3FSWA 4YHYB 1NUDA 4LF3B 2Y2WA 5ACZA 1S9VA 2CGYA 4TN9A 4O5LH 4XRCB 2CJSA 3STLB 4YHIA 3FN0L 4FFZA 3R7QA 1JUFA 5EO1A 1QLEB 1B3IA 2B59B 4HYTB 2VDOL 3ZHDA 5BRPA 3MRLB 4ZQKB 3DRQA 2ODIA 4KZ0A 2PPAA 5E6YA 5H37G 4JM2B 3DUUB 4TLKA 4LHJB 1XVSA 1MFVA 3EHBC 4LCCC 3I3BA 4RQQA 3H42H 5FYKE 2QVKA 2Y2TA 1I8UA 1VLXA 2HJFB 4P2OA 2PXYC 3QS2A 5HHPB 4LB8A 4OZIA 2PP7A 3EYQD 4R7NA 7FABL 2OV0A 1WIUA 5I1LA 3UGXA 4L4VB 3MODH 4OI9A 4NZFA 1NBVL 1PNDA 2HH0L 3PJNA 3FDWA 2WQXA 4P23A 1JVOA 3HN3A 4E42B 3BP5B 5FA4B 1E27A 2R0KH 3BSZA 3IJHB 3SBRA 1A6PA 1AS8A 2M1KA 3P4NA 2XPZA 4E9WA 2NZIA 3KVPA 1A1MB 2WM0A 4HKBB 4UTAH 4H0IA 1Q9WB 4H0LC 2DEYX 5DCCA 4EPSA 2YGNA 2DQUL 4ZPTB 5K9KB 3CIQA 2VQUA 1QLRB 2A6IB 2BCMA 5IT2H 3DROB 1WQVT 3B2UC 3CZKA 4D7BA 3NJHA 1BD2D 2YD0A 1JGDB 5EBWA 2E5EA 3RWJA 3ZT5A 3QE5A 4PJ5A 1BW8A 1SJMA 2XCMC 1RY7B 3MV8A 4OKVA 2BSSA 1P4UA 3BW9A 4DAGH 3HEIB 4XNUH 4YIQB 4LMQE 3WDIA 4EIUA 4UMGA 2Y5EA 3LVTA 3Q6GL 3CPUA 1B0GB 4D7PA 1WEJH 1SBSL 2P46B 2NNAA 4FKEA 3DOSA 5DSCB 1FZKB 1CL7I 1PZSA 4AV0A 5C0EA 5JW5B 1IGFL 5E00B 2WLJA 5F7NC 5EOCH 1E9PA 3GIVB 2ICEB 5CEYB 4DHLA 1YEGL 5CMAA 1A9VA 2GC7C 3SE4C 4KQ3H 3FB7B 3DUSB 4X9HA 4BFRA 3IE9A 5D6CB 2B59A 1OQXA 1KLFA 2B1HH 5IEHA 1ZA6A 4Z7UE 4ZTPL 1RSFA 4BEIA 3BN3B 4JFZL 3APMA 3UPRB 3O4LA 4LT7A 3T65B 1OAYL 3IDJB 2O61B 1UKSA 1CGSL 2P5EB 1MI5A 2OJEB 1K5NB 4NKDA 4Y9EA 2OSXA 3U2SA 4PP2A 2IDFA 4JRXD 1E8YA 4WCYL 4NBZB 2Z7WA 3KYMA 2ZX5A 5EIQA 3RX5A 4OU3A 4ZQTA 2Y1YA 2QADC 3ZUNC 3H9SD 4KDWA 3L3HA 4GMTH 3QIBD 4GRWF 3UZEA 1VPOH 3P4NB 3QB7C 4MSWB 4QJ3B 5EOTB 1T4KB 4B3VA 1OARL 1NCUA 3CFCH 3P3YA 2PKDA 2BIIA 4OGYH 1CLZL 1CR9L 4D3CH 1YCSA 4FQLH 1QSED 2EYTB 2J1WA 3EJQA 4G43B 3K71A 3LZOA 1F86A 3GMRA 2YRPA 4XNZC 3QEGL 3SE9L 3VRJB 2B20A 4GW1A 2VL4A 1A4BA 1M2OA 2R51A 4G3YH 3EXJA 3UCRA 4ZSOB 2X28A 3AXLA 4N5UA 3LJ3A 2JJVA 1INDH 1OW0A 4MD5A 3V4LA 3QUHA 2ZXBA 3MNVB 1DJGA 1KCKA 5BV7H 4XNQB 5EUKB 3ULUC 2WAQA 2XPGA 4DGUA 2ENSA 3AY4A 1CBVL 1MEXH 5JIDA 2EO7A 4IKIA 4PRBA 5K39A 2A77L 3JT0A 4H8HA 4OB5H 4OZFH 1PIGA 3C5ZC 3EUDA 3EYOA 4F7EA 5GGTA 3FULA 5ANME 3MREB 1RIHH 4JFHE 2AQ1A 3RDTB 2KLTA 1KIPA 3A6CL 4EMZA 1U3HB 5HYJE 3UGUA 1TU2A 2WTRB 2VL5A 4IMKC 1OCWL 3RQ3A 1A7NL 4AT6B 1YEFH 4B60A 3JVFC 2QTEA 5KSBE 3ROOA 2VKXA 1PW3A 1TJIL 5EMYA 4DW2L 1QW8A 2VJ0A 1HXMA 3GSVA 4E41A 1BQRA 3PNWB 5IMOB 3TV8A 1UGKA 5BUPA 5K5YA 2FSEA 4KXCA 2DBLH 2OA9A 3MRMB 4UNIA 4XWGL 1RZIA 1SXCA 4LOUD 3ZKMD 2Q6WB 3GZPA 1SOSA 4S2SA 1DBKL 4DETA 2D03L 3ZLQC 3EG9A 4F7CA 5DVMA 5I1LB 3ORJA 3EJPA 1ZLUH 4NP4L 4FQXC 1ZTXL 4NP9A 4RFEA 4JG5A 2BLFA 3WHE1 5EF2A 5J6HB 4HMEA 4Y89A 1KNOA 2ADJB 2EO9A 2I25N 4Z7IA 1CN4A 3CQFA 1PLCA 3THML 5IY5B 4CMMB 5MP6H 4BCXA 2FX8H 4UZUA 4UQIM 2J55A 3ARDA 3SOBH 3F84A 1G84A 2XXCB 4Y5XA 4CSTA 2IBZY 3UL4A 4LMQI 2LLGA 3H8NA 3L08A 4UUJA 3IVKB 1LHZA 3FRUB 4DGIL 2DLFH 1NIBA 2Q8BH 2H9GB 2OTPA 4WWPA 3LKNB 5BUGA 5FM8A 4G5ZL 5KYUB 1MAML 1FVDA 3CFCL 3D9AH 1FL3A 4CGUB 2ATAA 4MAUL 1DE4B 2J2ZA 2DWDA 4GINA 4OZFG 5TE6H 2B9AA 4NN5C 3TN0A 1XTLA 3RWEA 1F3RB 1Q4NX 4U6YA 4D0CA 3LIZL 3RX7A 1YECH 2FD6H 1RZKL 5I1CH 4PJ7A 1CD9B 2DLIA 3MGOB 1WBXA 5KVDL 1DEEB 2A6JA 2CDFA 1BBDL 2CA3A 4BSWA 5DJYB 4PJEA 3EJTA 1FLRL 5FGCB 5LN4A 5DMIH 5CN1A 1RPUA 4NO5B 1P84K 5D1ZC 2JKRM 1I8KB 3B7YA 4PJIA 4YSDA 3PP4L 8CGTA 3BZFB 3MRRA 1NAMB 1YNKH 3JWDL 3ATAA 3L1OH 4OM0L 4K5PA 1D5BA 1E6OL 1UWEL 3IAPA 1J5DA 1FG9C 5E8EB 1JF1A 1C9SA 3ZIMA 4DP0X 3KYMB 5BRZD 3EOBB 4GMTL 2UUDK 2NY3B 1M1XA 4LASL 1IQWH 3BKYH 1Z9SB 5GS0D 2J7LA 4LZKA 4NO0A 1F1AA 2IWFA 4LHUB 5DRZA 3ZHLA 4HC1H 3JWDC 5J89A 5D1QD 1KB5A 3U36B 1MHEB 2GTZA 2ZG3A 1RV6X 4RBPK 1MUJB 5FLVA 2Q76A 2BM3A 5DJZB 1E2ZA 1JZIA 2GBUA 3TC9A 2IPKB 3QIWA 4PI0A 1A7BA 3FCBA 1PX3A 2BSEA 2ZWLT 3CFBA 3OWEA 2C3VB 5FM4A 3C09C 1NIDA 2DQCL 4J27A 5E6IC 3H4FA 5E8NA 1R0AH 3ZQXA 2EINB 1UZ8B 2AP2A 2C8NA 2PTUA 4P46D 4PJ8A 3MLZH 3QO1B 2WJ5A 1PKQA 1EIBA 3QUML 5CZVL 1P4BL 3GXDA 4MJIE 4N87A 1F4WH 4WUUE 1ZHNA 1MREH 4Q6KA 3VFGL 3VXRE 2OPCA 3LQAC 1BG1A 1OGAE 1QOKA 4AKPA 1XMWA 4HXAH 5ID0B 1VFBA 4FADA 3T4YA 1ONQB 5AOMA 5TD4A 1LEKB 2Q3XA 2Q7AA 5IVZA 2QKSA 3GHBL 3BUYA 3FL7A 1YEDB 3GHPA 1UXSA 1KSRA 3BAJA 4UT7H 2X2HA 3QJVB 5K1VA 2DLFL 5J3HC 4HUUB 5IW1B 1KBVA 1NSNL 3MRDB 4ZNCD 2ZXEB 3GUTB 5EUOE 3UG5A 4L37B 3VI3E 4HWUA 3QQ4B 4Z7VA 2E56A 2O72A 3O2VH 4EF3A 1WUZA 4XMZA 1ES0B 3OSKA 3GD1C 3SCMD 4HIXL 2EDBA 1PF3A 1U6AH 3FNKA 4O2CA 2FHFA 3SY0A 2WIMA 4H26A 3FC8A 4V11A 1EHLL 3FCSB 4PCSA 1A9BA 1B6UA 4ADJA 3WXWH 4CN1A 2ZWSA 3CLWA 3KPOA 1Y6NR 3Q8AA 4XTRD 1ZLWK 4OW6A 2Z35A 2AK4B 3GJFH 3LV3A 2W0FB 1WPCA 4ANWA 3MRPB 2C3VA 4D8OA 1F1DA 1AG0A 3NJLA 2R8SL 2EEFA 1UEMA 3BGMB 3C9NA 5DVLA 2V2XB 5DU7A 2K7PA 4Z77B 4WEMB 3MC0A 1HE7A 3S37X 3HN8A 1TLKA 2H5UA 2BC4B 2X2IA 4H25A 3IDNA 1QEXA 2F5AL 2CK2A 5GS1B 1YQ2A 3EH3B 1KTCA 1BAWA 2O93L 5EB9A 1UFGA 1OW0C 4MCYA 2ZPKL 4XVOA 1S7QA 2YUWA 3RVXD 3RVTD 3KPSA 3S3BB 4YQXH 5DUMH 3OX8A 2AJ3B 2PO6D 4LQFH 4KI5C 4DKEH 5JDJA 4EVNA 5F96H 2UX6A 4HAFA 1NCBH 2WIIA 1RZGB 4OFIA 1DDHB 2AEQH 2X87A 1QTPA 5LBVA 1QRND 2HXAA 4GT7A 2XC8A 1KFAL 3FQUB 1H6FA 3S48A 4YDIL 3KGTA 3L3OB 2CIKA 5D7SL 4HKZA 4HZ1A 4XCNB 5DJ0A 5DWPA 5KSVA 3O6LL 4HIPA 4ZI8A 5B39G 4NO2B 4Y5XB 4ES9A 1UT2A 4H88L 4UAHA 4PJCF 3GBDA 1Y0LB 1JI2A 3IETB 3QDGA 5E9AA 4HUVB 4P46C 1KULA 3VXRA 1CLZH 5DK2B 1R3KB 2UYLB 4J1UA 5DD0L 3UJJL 4K5NA 1OM3L 4HK3J 2FR4A 1DL7L 5I8CB 2VWEC 5ALBH 4YMPA 1Z7JA 1ZHBA 4PWKA 4KKPA 3NFSH 3U4EB 2G4EA 1FNEB 5GGTL 1AD0A 3HRZC 2W0PA 3FB5B 3WJLC 1T04A 2VMEA 5C07A 4S10A 5I6OA 3KCPB 4GNKB 2EECA 4M29A 4BHUA 5KW9L 1I3RB 3X1FA 1MFEL 4LEEA 5HI3C 4QRSA 2AJZB 1JSYA 3INUH 5CJQL 2N1KA 3CHQA 1CD1A 1CDYA 4Y1AB 3VD3A 2XJKA 4OJYA 4H25B 2NY4D 4Y7OC 3U83A 5HGAA 1XIWB 4GFTB 1IV8A 4NZTL 5CKGA 2WYIA 1PAMA 2VLLB 1YSOA 3ZDXE 3MRNB 4GO8A 1FBIL 3RIAF 1IC7L 4JZNB 4XMWA 2D73A 4ODXA 4MVBC 5BCAA 5BS0E 1RK1B 2IXQB 4L3EB 4OIIL 1FNLA 2E9IA 3PUCA 4XX5A 1XR9A 5C0DB 2XYCA 4M5ZL 3U48A 3QPQC 1SBSH 2WINB 1U8QA 5LAXB 4F8TA 4WENB 3IS0X 5JW4M 1RZ8B 4M56A 3H6JA 4EAEA 4L05A 4NDMA 3MR9B 5I76A 4TVPD 4JK0D 3DPBA 1QFUH 1HXYB 3F12A 2PYFB 2K1MA 2UVEA 2NQCA 3BOVA 5FDYA 5GRUH 4KO6A 5IKCB 2MJWA 4UOW0 2HRHA 5F7DB 5GS0L 3QEUA 4AUJA 3EZJB 1KOAA 2Z0BA 4M6OL 3EG9B 1CDGA 4HJJH 4HZLA 4QT5A 4BQCA 4KKQA 4U7MA 1N9PA 1L0PA 5AW2B 1JGVH 5BS0B 3ARFC 2R0KL 4O2FA 2QVFB 4G8IB 4QO1A 1HSBB 3O3EB 3OAYH 3DMMB 4XN2A 5J9PB 5KAQG 1LE9A 1KGXA 4HCRH 3LS4H 2OTUB 4RSVA 1D9KC 2DQDL 4AYDC 1KFAH 2H3XC 4GAGL 1DQJB 1U21A 3H2PA 4KO7A 5HHXL 4PJHF 1OAJA 4X4KA 2WTRA 2PO6C 2WZ6A 1U2CA 5E94A 1SY6H 4GLRH 3VVWA 3IFOB 2NW2B 4PJ9A 1PZ5B 4X80L 4TKWA 3WEBA 5TDNB 4PRHD 3W9EB 3IGFA 3T6VA 3QDAA 1I1AB 1MY5A 4UNUA 2LHAA 5DHVA 3SOTA 3RX9A 1UH4A 1ZANL 1J87A 4JZOB 1EPFA 3NP3A 3F7VA 3P54A 4NM8L 3FQ2A 1I7ZB 1NC2B 2NY5C 3NCCB 1QSFE 3J07A 3PWJB 4NZDA 5I19H 1AJ7H 3FFCD 4JG0H 1YMME 5D2LE 3VD4A 2XWTA 3KWTA 3QXWA 3Q6FA 4PM1A 1WFIA 4QYOA 1SEQL 3O6MH 4UB0L 5IOKA 4YBLB 3IGAB 3H9SE 1AQKH 4BH7B 2AQ3A 3VYNA 4JY6B 1HEZA 3JZ7A 3KJ4B 5K9QG 2VXQA 3MLSH 1IKOP 1FH2A 4IHOB 4NIYE 5CR8A 1K6QH 1PDKA 4PJXA 2X4UB 3GSQA 3OL2A 1NINA 1GAFL 1I7RA 5EC2A 3SCMB 5DS1A 5ABZA 5F7BA 1VGEL 3L4VA 3NACL 5CNHA 3GLEA 5KN5A 4HUWB 3OHXC 4FE9A 5JPMA 2HVBA 3QQ3B 4JHBA 5MI0C 3EFDL 1RMFL 5T1LD 5I26A 2QPUA 4UM8B 2OL3B 3DURB 4GAJL 1CMOA 3ALPA 5EC1A 1A9EB 1LD9A 1U8LA 4QLRA 4WI4A 3WFDL 1JK8B 1D5BB 1U8OB 4I5BA 5IMLA 2GJ6D 4HXAL 2MCPL 4YUEL 4K7PH 2WLIB 4F2ME 3BPOC 3KH4A 3UYOD 4DKFL 5SWSE 4AKQA 3BD5A 2YMXL 1JWMB 3FU8A 4M7ZB 1F4WL 1UM6L 2ZE0A 1KGYE 4K07A 5EU5B 3PV7A 5D1QE 3FS9A 3KR3L 4X4XB 4QGYA 4ZUUA 2L04A 1CL7L 2BY1A 5C3LD 2F18A 5CWSB 4RGNC 3VB8A 3F83A 2G2NA 3LAFA 5BXFB 2P5EA 3KS0H 4HFWA 1KB3A 2PETA 4B9CA 4HS8H 3EH5B 3BT2H 2FQFA 4DOHE 1PSKH 4J8RB 1RLWA 5HHOB 1P6FA 3I9PA 4XCEB 3M7FB 2VUYA 1OPGL 3LZQA 1CI3M 4U6XB 2RD0A 2DH2A 4JKNA 2F8OA 4OF8A 1KPRA 1UCTA 3DSNB 3RNKB 5F0MB 3K4DA 4H1LB 2WXFA 4WI7A 1ML0A 1YMHB 2FVNA 1LXMA 3G5YB 4G1MA 2X09A 3SGDH 4AUYA 4ZMAT 4P2YA 4H8QA 3TJHD 2X4PA 1DVUA 4OM1H 2X70A 1IQWL 1QNZH 2OXHB 3QPKA 1Y6MR 2VZTA 4H5SB 3MDJA 3Q43A 1CF8L 5AVXB 4IBSA 3T6ZA 4CN4A 4LLDB 2EXWD 3H85A 5AOJA 2VUKA 3TO2B 4GG6F 3ZE0E 4KOCA 3CE1A 1JZ2A 4GH7B 1JPEA 3G5VB 4UDUA 1INQB 5D1XD 1GTFA 4RFOH 4E5XA 4E9XA 4XMTA 3LRHA 1S9YB 4ZZKA 4ZPTA 5DJZA 2Y7MA 3O4LE 2EIKB 3NQIA 5AVYB 1RJYA 3MTXA 3QO0A 4XP5H 3QXAB 3BVUA 4G1EB 2ENJA 5BRQA 5CEZE 2IG2H 4K71B 1OAUL 2IH1B 1Q90A 2XJLA 5D8JL 5KSAD 2Z8WC 2HMID 3MROA 5E51A 1YVLA 4X8GA 3PL6B 1VFBB 2OK0L 3VWKD 1B3JA 1EJFA 3B6SA 4LNRA 2UXGA 3TZVB 4Z7WE 1KIPB 5LJYH 4WK2B 3QZBA 5F7FA 1JF6A 5AKVA 1MCRA 4WO4B 3WLBB 5K1JA 1T83A 2O61A 2G5BA 2ENYA 4NC2B 5E99L 4IU3B 4IQHA 4KKBD 2CCLA 2F54D 5FUOH 3VNYA 1QX1A 5EO9B 3FO2B 3QZWB 1WT5A 4O02L 4PG2A 3WKNA 3LZFL 2A2QT 2QGCA 3EO0B 3O6FD 2NZ9D 2PLTA 2C3WA 4NLAA 1BFOA 3C5XA 2BWIA 5I1AA 4FYSA 4XB8A 3H7BB 1GSKA 2D7QA 3ARYA 2A73A 5C0GB 2DTML 4JG1L 4YX2L 3DX1A 5TDOA 1JV2B 2ZX7A 2XVLA 1ES0A 4S0HA 3ULUL 4YXKH 1Z9PA 4FP8L 2R7EA 3SN6N 3HBZA 1A25A 3FO9B 2VH5H 2Q8AL 2E46A 4WW1B 4LSVL 3US1A 2HFEA 5CBEA 3A6BL 1S3RA 1ZXQA 4M61B 5IESH 1H6UA 4PVLA 1G7JB 1OZTG 3O8XC 3UAFA 3WCYA 4YL9A 1OAZH 1KFGA 1LEIA 3VI3A 5BO1H 1HCVA 2P28B 2BZCA 2I07A 3WNNA 3ZKQD 3MCLL 3Q13A 4WJKB 3T3MF 4F24A 3CPLB 3IDXH 3MX0B 4X8CA 1OM9A 5I8KH 3V7MA 1FGVL 2GW5A 5DK0B 4DTGL 3W2DL 4MWFB 4ZXBA 3IJSB 4D0DB 1A5FH 4GW4A 4NWUH 4XGZB 1YA5A 4KJPC 3UDWA 2W9EH 2M8XA 3HW7A 1FSKC 2WKOA 3RTLA 4OFYD 1AGDA 1J0IA 3GC3A 3GS4A 4I85A 4U6YB 4D0CB 2FWUA 2MNJB 1D7CA 1HL4A 3WE6B 3V79C 5GRYA 4QNPF 1H0DA 2Y06H 1HK6A 1F3DJ 5G4NA 2R56H 4QEGA 4WQOA 4FFTA 2A4EA 3HLAA 4Y16A 2HPOA 5GHWH 1OTSC 5FO8A 3BH9B 2YUVA 2IDUA 1UWGH 3CTTA 4QWWD 4X4YA 1W8NA 4DN4H 1H9VA 3AM8A 1TVHA 4Z7UF 1RL1A 3SGEI 2ZCHL 2XWCA 3I9IA 4UAOC 2WOBA 4U6VH 5DMGD 2P8PB 2OP4L 2R1YB 3APNA 1F3JB 4J3WA 3MXVH 1JCKA 2VDQB 3NCEB 1JXGA 2V37A 1NFIA 4YBHA 5DDHB 5L4IA 4D0BB 4G5AA 2DL2A 1N3NA 1OWWA 1U36A 3FN3A 2C7UA 1E4WL 4ZYKB 1AC0A 4N90D 5E08L 4FHKA 4OZFB 2Y7QA 3A5VA 4UDTA 4K3EH 3TV3L 1OGAB 3F7PC 3RG1C 1I1AC 1DBBL 2WXOA 4Q2ZB 1CFTA 3JTSA 3NJJA 3UABA 1AGFA 2OMWA 2V9QA 4U0RC 3PLYA 2CJ3A