2LLGA

Nmr structure of the protein np_814968.1 from enterococcus faecalis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein NP_814968.1 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2llgA00
1LMIA 2LLGA 3CFUA 3QFGA 4LESA
chains in the Genus database with same CATH superfamily
1N10A 1PY9A 3B5GA 4I0PC 3L9RA 4FHJA 3UDWC 1KLFB 3PFQA 3QO1B 1QEXA 4S1RL 2CHXA 3WKMH 2X4NA 3DBXB 1CN4A 1U2CA 2G4GA 1DANT 2BDNH 1CK0L 5CHNA 3S96A 3S5ZA 3ZKMD 1MCFA 2JKRM 1I31A 3BYTA 5IVZA 25C8H 4N2MA 2WUBL 1CG9B 2ZUYA 1C12A 4PRID 1QRNE 3T6WA 3CXHJ 5GHWL 5EBWA 5EU7C 2PXYC 1A6UH 1BVNP 2DV6A 2IQ9H 3LOWA 4QHKI 3P2DA 1B0GB 5CIPB 2UXGA 2Z64C 2GJ6E 3FB6B 3NIFE 3G5YB 3ESPA 3K6DA 1BDYA 3FB5A 4F2EA 4HA1A 2AQ3A 5B39G 1HHKA 1S9YB 3WTXA 1I1FB 1IGJB 1J0KA 1HL8A 2BVPB 3BMVA 4JKNA 5DHXB 5HI5C 4S1SL 4UBDD 1E90A 4QTHB 1AGCB 5FA4A 4XCEB 3WTYA 3OQRA 1NCBH 4H5SB 4IRJA 3DJTA 4JGUA 4A6YL 3K8LA 1LO2H 3APNA 1AIZA 3FBKA 4KDTC 2A77L 1UCTA 5C6TL 3HG1A 1DUYA 1KNOB 3ULUE 1UACL 1UFGA 3WIFA 2NY6C 4UT9L 2VW7A 4OZHF 3BAYA 3DNKA 2DD8L 1IEAA 2EAEA 1UWXK 4LSTL 3VFPB 2E5EA 3BQVA 1HJBC 3L9BA 2NNRA 4QWWC 5DRXB 3D4ZA 2X4PB 1ORSB 4BFKA 4JRYE 2W92A 3RWFA 1NCWH 2HLFC 4X7CC 4AEIH 3ESNA 3CSBA 4JFSA 1K2DB 2VDNL 4L4VA 4OZIA 2PXYB 4M4RA 5E0FA 1NIAA 2AGJH 3W2DL 2XN0A 2VLKB 3L4CA 3SN6N 3QHZL 4ZFOA 4JPKH 4HS8L 1M6OA 4E41E 4LFHG 2P8MA 3L3IB 4X7TB 3RTQB 3T3MB 5KZCB 2R29A 2BVEA 1MSPA 5T1LD 1GVIA 3TVMB 5L9DH 3QWRD 5AD0A 3IT8D 2EVJA 4TF4A 3NZUA 5CLTA 2QFRA 2BOBB 3FTGA 3HB3B 4NM4H 1WICA 1MRDL 3C9NB 3T2PA 3Q3GA 3LS5L 3QA3B 4PGEB 5SWSD 1ZGLM 1BZ7A 1H5BA 1TQCC 1AP2A 3FMGL 4MMZA 1GOGA 3VG9B 3A4EA 5E51A 3MJ6A 2BVQB 3MODL 3V9CA 1IEBB 4P9HH 1MVYA 3HI5L 4WK0B 5EUKB 1QO3B 1JZ3A 3RIKA 3EUDA 3KXFD 4P57B 3QUMB 1I8AA 4H2CA 5IK3B 3T08A 1R0AL 1IL1A 1NGWB 5HY9A 2ZKHH 2VDMB 3MA7A 3CHSA 3TO4B 4E9TA 3GBEA 3HE7D 4JFDD 3SO3C 2KYIA 2OW6A 1OARL 1UA3A 4IIQC 4JY5H 5KSBA 2FDBP 3DHJA 4LCWD 3D51A 3VXSA 2A1WL 2UVFA 1ASQA 4GRWH 2YXVA 5INCA 2XTLA 1Q9LB 3MV9E 4YC2B 3FFDB 4AKPA 2WQUA 4LPWA 2APXA 3L16A 4O5LL 5JLZB 1TZHA 1MFNA 4R0LB 3U4BL 2A4CA 2ESVD 3MRFB 2WO2B 4HIIB 1JMXA 1JRHI 3UGUA 3P4OA 2Y3NA 1QR1A 2EECA 1AXSB 4CBZA 1HOEA 3NACH 2OLDA 4AEIL 4DGIH 5B38B 2ENYA 3N6YA 2YSSA 2PPAA 3D85D 5DUMH 1OTSC 2RGSA 3UBXG 3BZFB 4E9QA 3ARDD 3RX7A 2YAHA 1KUMA 5L88H 1JS4A 2ZSWB 1NGYB 1GY1A 1WITA 3L1OL 3I6KA 3WJLC 1KJVB 4GFXA 5JORA 3CJJA 3LNHA 5LGKA 3MMEB 2DQTL 5DI8A 4N68A 2VSMB 5E9NA 1B0WA 1S7UA 4JCMA 1GW6A 3QVAA 4XPHH 5IFHL 1LDPL 3MO1B 1RIVH 1CI3M 32C2B 2H2PD 5IW3A 5A2IH 1UH4A 1LJMA 2DL9A 2Z7YA 5K9JL 5A16B 3BAIA 3M1OA 2DRUA 4ZRGA 4F8OA 1HH6B 4JM4L 1YA5A 1DFXA 2R2EA 4NRXA 4WW2A 4P4KB 3HBQA 4ZODA 4IS6A 2GYSA 1LE9B 2WV3A 4XVTH 1WIPA 2FX7H 2GSGA 1K4CA 4AUUA 2VDNB 2WP3T 4GH7B 2IGFH 3BSGA 1IBHA 4UT9A 5CD3B 1BQLL 1F1GA 2JKSA 1Q9WA 3IXTA 5FYKE 4CGTA 1GGUA 2FRGP 1C08B 5JIPA 5E6RB 3V4UH 3FO1B 3FNKA 3P0VH 3FQWB 2XACC 3UP6A 2Z31A 5CZVL 1INDH 3OKKA 2RJMA 2G2RB 4XP1L 5AVTB 4G6KL 1ACYH 5I5JA 5B39B 1LP9B 3FQNB 3KPPA 5FEBA 4GW5A 4L9LC 3CQQA 4JX0A 2X9ZA 3VFVA 4P2OD 5C0RL 1OOAA 2VLJE 4TVSa 4WDIB 5DZPA 1D7FA 3ZPDA 2QTVA 4FQ1L 2E7LA 2W38A 3LRSB 3NSYA 3O2WH 4E2OA 1U9KA 4HLZH 1IE4A 2EZ0C 5G4NA 3ROLA 4K5OA 3NSXA 4UOW0 3GSOA 4MB5A 4J4PC 5CZRA 3IMRA 3KYOB 2V5SA 4Y1AD 3IBEA 4TS6A 5LGJB 1YUHB 4O2CB 1WFNA 1FF5A 2YUWA 4HFUH 4NOBA 3T3PE 4KZEH 5D5ME 3BUQA 4OI7A 1KB5B 2ZP0T 3O3EA 2MNJB 5IROD 3EXJA 1ZE3H 5GRXG 4YVUA 1DEEA 4J12A 1IFHL 3LPGA 1YEFL 5HI4D 1J87A 1SXAA 3C5ZB 1UXWA 4HKZA 4DZ8A 4R2GC 3TIDB 3V6OA 1ZSHA 1R47A 2P5EA 5SX5K 3L1FA 4KNUA 3SDCD 1BQKA 1XF4A 4PP2A 4ZMZA 4KFMA 2JB5L 1ETB1 1ETJA 2AK4D 3GFUA 5C2UB 4AYGA 1S2EA 4XE5B 1QRKA 3HKFA 4WCYL 2Y5QA 3QXUA 5D7JD 2EE6A 3MBED 4XAKE 5GRZA 2Y72A 4H8WH 4MA8H 4O58L 3BP7A 5I0WA 1A6UL 2IQ9L 3HZKB 5HTSA 5JHDB 3US9A 5CLYA 4BDVA 4HMEA 3MBWB 3C2AH 1HC1A 4F57H 4LOUD 3L5HA 3FOMB 3LVEA 1BD2D 5JW3H 2E7LC 4RAVA 4LKCA 1MFMA 2KH2B 4S2SA 4HWBH 4U7MA 3VB9A 2EIJB 2AQPA 1U3YA 1XB6A 1G7MB 4M7LL 3MRMA 3T0EA 4F57L 5J06A 3HG5A 1A1OB 4X9IA 1MCNA 3S2CA 4EI6A 4IRSA 1Q8MA 5DEZA 5CU5A 1AE6H 2JV6A 3HC0B 4S1QH 5JHDE 3EFDL 3WNJA 1LMKA 4OZFG 4QRSA 2XJKA 5FUZH 5KS9E 3IN2A 1U8OB 2CLVB 1CS6A 1A3ZA 1RZKH 2ICEB 4C58B 1ITBB 2HWZL 3B9KB 2EEBA 1GYCA 2BMKA 2YGOA 4W1TA 5IF0A 4M5ZH 2WB1A 1WIUA 4M61A 3BGAA 3MREB 5GRYA 3HS0A 4QR7A 2K6YA 1QLEB 2H1XA 2XIIA 5AOJA 2G60H 1E6OL 5FGCB 1TTUA 4MNQD 4GSXA 3OLGA 3PDOB 1GC1H 5IM7B 2BERA 3NCYP 3L3KB 1KYFA 3A6CH 1YMME 4YAQB 4YDIH 5ACZA 3W9DB 2A2QT 4DVBA 2X4PA 2VZOA 2JI3A 4P46B 3S5LA 4MRBA 2APTA 2EE2A 1MXGA 1EUUA 3ETSA 4ZMXA 2E86A 4GRWF 1JVLA 1K2DA 4D3CH 4ONFL 5CGMA 2VRAA 1JZ7A 3HPLB 5GZOA 3EGXA 2CQVA 2UWEF 3FQTA 4LDCA 4ALAL 5DS8A 5ITBH 2JWYA 2FO8A 4HKBA 3L13A 1P4UA 1SDDA 3AWFA 3TA3B 4AV4A 2MH4A 2Q0ZX 4ZNEE 1FPTL 2CIKB 3BH9A 4HJJL 2KPWA 2BSRB 2DQJH 2GJ6A 1YPZB 1F58H 1I1AC 2ZF9A 4MMZC 1BJ1J 1U8NB 4QOKA 3ENEA 4ANWA 4AXWA 1UZ8A 1FO0H 3Q0HA 2BNUB 5EOCJ 4OCWH 3IAGC 1A66A 2X89D 2GABA 2UY7B 3FSOA 3DDFA 1IE5A 4AGPA 3KCPB 2IO5A 3SQRA 3WU1A 3AB0C 3MV8E 1RY7B 3OAYH 3POCA 4LAJH 2K70A 1A7NH 5D8JL 1P5VA 5GGRA 2IC2A 2JF1A 1VFMA 3VFWA 2ZCKH 3V52L 1SEBA 5IBTL 1BV8A 3VXSB 3LQAH 3AT0A 3IFOA 4OSUH 1SN0A 1A65A 1OCZB 2MTAA 1A6AB 2BX5A 3N44F 3P2TA 2BK8A 2NZ9C 2HLAA 1ZLUH 4BGLA 5GGTL 1D5MA 3CK0H 4I0KA 1RUPL 4XHJC 4ODTH 2FE0A 5I1AB 3P11H 1J1OL 1JPEA 1RJZB 2FL5B 3ZE1F 1QLFA 3F5WB 1MN4A 4MNHB 1UQSB 2EUXA 1QFOA 5ID0A 4YHMH 2TRYA 3I6LE 5HI3C 2DLGA 1Q0YL 4OFDA 3UOAB 1B2WH 3LRHA 4RWYH 5KBMA 3UAAA 3TNMB 4NQVA 4I3RL 4XNDA 3US1A 3ATFA 5IOKA 1WEJH 1YEHL 3FQYA 1UB6A 1TVBA 2HSIA 3LXAA 3UTOA 2YJQA 3OMZA 4HC1A 4PMEA 4NZUL 4OV6F 2P5WA 3D0LB 1RUAL 5CHNB 5E1HB 4CMMA 5I66B 1SXNA 1HIML 3GXUB 3KM1A 3FXIC 4OZ4A 4NN7B 1FUNA 4MFHA 2PCFB 4M8QA 1ZLDA 4NNPL 5I8KH 4H88L 2VXVH 3ZU8A 5AB0A 1SDAB 3WDHA 2P28B 3VXMA 1YNLH 1EXHA 4RBPH 4IKLA 3CDZB 4OH2A 5IVXE 4BH8B 1CYXA 1VIWA 4YIQB 5GJTL 2QFPA 4HKXB 3VG0H 1FAKT 5L0QB 1JZFA 2YR3A 4JVWA 4XMVA 2DBLH 1EHLL 1N26A 3HCVA 5BVPL 2GG1A 1I1FA 2BVPA 4HUMB 4IDLA 3D2TA 3QULB 4J1UB 3LZFL 1N64H 2Z92B 2B9AA 1C1EH 4Y19D 1GGIH 1UWXH 4HPOH 4L1LA 4MD5A 5E8PA 4F91B 4DF9A 2ATPA 2HFEB 3EYFB 4IRJC 1BHGA 1X7TA 4ZUWB 4L8BB 4QGYA 2EEDA 1AHWA 1WS7A 2CBMA 4G7QB 4OUOA 1P4IL 4OU3A 4YEEA 5FYJU 1TQUA 3DMMC 3QXDB 4HBQA 4O02B 2VSCA 2RD0A 4GO9A 4X0KA 4AQOA 4WWKB 3ZDYB 5DJYA 8CGTA 3L9YA 5FHBL 3HNVL 5ELIA 5HHOA 1BWMA 3SDAA 3PV6B 4I0CC 1V27A 2HYMA 4MYWB 2XQYG 3EYSL 3MROB 2ZXWB 4TRPL 3H4HA 4NAMA 5BOPA 2J7LA 4EN3A 4MXVE 3QFGA 1ORSA 3GIVA 4YL9A 5JO5B 3RWFB 2DMKA 1JK9B 3MACH 3P3UA 1JHTA 5IBLD 1KF9B 5E4EB 3RPIA 1ROCA 3OF6A 3ULVE 1QKZL 4FG2A 1MDTA 3RGVA 4GKNB 5ADPH 4XMUA 3F58L 1T03H 4J39A 4L8CA 3GBNH 2IF7A 2IOMA 3B2VH 4MJIB 1AHMA 1JHKH 2YPVL 3ELAT 5I9QB 2E6JA 2PR4H 1R5WA 4F7EB 2TSBA 4HHAA 4LLQA 4UQ9A 3FUKA 2J56A 3RVTC 4NO0B 2ZCHH 3TIDA 4ADJA 5DFVD 2PNDA 1YJDC 2AEQH 5I6KA 3CH1A 4LNRA 5DRNB 3UJJH 4A04A 3PXHA 3ASWA 4JFDB 4QNPE 3JT2A 2VDPH 2IWGA 4F2ME 5I15H 1G9HA 4L1SA 4DPCX 1A4CA 3IETA 2VXUH 4QMEA 2VN7A 4Y9BA 4L2YA 1CXFA 1HNYA 8FABA 1SVBA 2C4FT 3KR3H 3QJRB 2HG0A 5I76A 5F0PB 2ZUTA 2QDVA 4ABQA 4NQDA 1M9SA 3DUSA 1FFPA 1S5IL 5JPNC 5CGBA 3P9MA 4DGVL 3GT6A 1WBYB 1TUPA 4JFZH 1QFUH 4OF0A 2X70A 1IAKB 3LKRB 4KX8A 4OCNC 2LE9A 2IBZY 1AQDB 2IFFL 1DQVA 1PD1A 3DJZA 4DTGL 5HGDB 2V3EA 1W72H 3WY2A 5LDSA 2J8HA 1F86A 5C0DA 2VZTA 5GSRA 4W81A 2J21A 2ATKA 2MQCA 1I85A 4PJGA 4HQQL 5DMGC 1FE8H 2WW8A 4ZOBA 3O3UN 2BNQB 5IB2B 5FCUH 3GXMA 2AJZB 2WZ6A 1G5AA 4NKMB 4O2EB 1UJ3C 4F93B 2D73A 4FFZL 4MJHA 4BE5A 3ZTNL 3DTUB 3ESMA 2WZ5A 1XGUA 3MRRA 5AEAA 3BQUD 3EO0B 3V0JA 5HXMA 4U49A 1RZJH 1E9OA 5C07A 1P69B 1RZQA 5TE7H 5TQ0H 3S4SG 4B9FA 3LB6C 2ZUSA 2DQEH 2FLMA 1U21A 2KMWA 4M7ZC 5D1XB 3MNWB 2XZAH 4G8FA 3HHRB 1OLLA 2BNRD 2BIOA 3BIKB 3STZB 3ZYIA 4ZMPA 5BVJB 2DLTA 1IVLA 4KO9A 3SDDC 5IESL 4HHWA 2M83A 4RSVA 4NKDA 1ACZA 1I3UA 4DUXA 3SE3A 3OTTA 4F92B 4DQOH 3HPJB 2D3JA 4LU5H 3UTQB 4ELMF 5FKPA 2VDOB 5B4MD 2L7QA 3RWJA 4W9FC 5ANMB 4YPJA 1HXMB 3PWJB 3I3EA 5A2AA 3AQZA 1MQKH 3VSQA 3S48A 4BELD 1XR8A 2K0RA 1D7BA 5GSVB 5DJ8B 3PDGA 1PL3A 5DS8B 1VACA 2ID5A 1QRND 3CTTA 4IS6B 1RJLB 2O30A 5DWUH 5DHMC 5CJXA 1MXDA 3FYEB 2BSCA 1PQZA 1X5YA 1I8IA 2Z35A 1G9NC 1DANU 5JPMC 5FK9A 4DPRA 2CJSA 1YPZA 2E56A 4GKOA 5FOJA 4ZD3L 2B1HH 4HK3J 5EU3B 1FNGA 2C9PA 1WV7T 4PJIA 1GZQA 4OGZA 2RMNA 3NA9L 4WQOA 3PDDA 3PQYA 3HNSL 3SE8H 2IAMD 4ZMVA 3U0WH 1ILUA 4GSQA 2R23B 4N2NA 1E8XA 2WVUA 3HOGA 3KCPA 3HBZA 3U7WL 1JRHH 3CMOH 3VXRB 5EULV 3GLAA 3RWHA 2HT2C 1U58B 2Q8AL 3PWLA 1KIQA 5G55A 1G7PB 4PM1A 2DQUL 1KYOK 1MI5E 3EYQD 1I7ZB 2AJUL 4DO4A 4FL4C 3VMNA 3IFOB 5KW9H 4NQXB 4GIPD 4P3WA 2QKIC 3KYOA 1EJOH 3WFBL 4ZO6A 4BFIB 2RTTA 3H2PA 2E59A 4UU9B 1XL4A 2D03L 2XPZA 1HHJA 4JNXA 2DTML 5IESH 5F7EL 3BUBA 5D1QC 2XZAL 1OANA 2OMXA 2WLNA 4GW4A 1FZKB 4YZWA 1I8LC 4NQVB 3QJFB 2ADFL 2BC4A 1IC1A 1T20B 4HJ0D 4YDVA 1AH1A 4IU2B 3D0VB 1PJ9A 4JO3H 4Y4KD 1GC1C 5BV7H 1CLYH 4TUUA 4X6DF 5B1AB 1XR9A 2GFBA 1R3LA 1J1XL 1VENA 1BMGA 1LO0L 4ZTOH 1J8KA 4JFFD 4P5TC 3RY6A 1A21A 2VTFA 4OGAC 5EZIL 4X9HA 2GI7A 4KUZH 3H56A 2RACA 2WQAA 4JLRA 1BM7A 4QJ3B 3KAAA 1MJJA 1BIHA 1JPSL 2CO6B 2YK1L 2GEQA 4IHBA 5IQMA 1ZS8B 2UZXA 5JXAH 5MI0C 5D7SH 1G7QB 1GYVA 1MUJA 3CU7A 3PGCB 3GBMH 1XSOA 2VGLM 3MNVA 3BT0A 4FLSA 3QDGD 1DE4A 4OT1H 2R2CA 1QBAA 5CILH 3RWGB 3DROB 4QPEA 3ARFD 2F54E 3VRIA 1BWWA 2AITA 2EDRA 4B53A 2BRQA 4DTGH 3KG5A 1ECYA 1WUNT 3HZVA 1KJMA 1D5ZA 3KR3L 3V4VL 2E4FA 5IB3A 1GHFL 2Q76A 4AKOA 4BQ6A 4J8QA 4JUTA 5J6HA 4ETYA 3VG9C 5I6OA 2HPOA 3SSGA 5F1NB 3VUAA 4YR6A 5DVMA 3HFML 3ZTJG 1N0LB 5J4MA 5TH2B 4NOFA 4UANA 5CWSA 1HI6B 3HS0B 3GIZL 1DSYA 1H3WM 3RIFF 3NUKA 1KJ2A 1PNCA 2QQLH 2LTQB 1C5CL 4JM2F 4YHZH 3IBOA 3NIDF 4R5VA 1YEGH 2XRAH 3DTDA 1KYUA 1I53A 1V3JA 3BFWA 1M6UA 1MFCH 1NIFA 2VMFA 1R5IB 3D87B 4WKZB 2OL3L 3IRPX 4D2NA 3VWJC 3E80A 2I60L 2Y7MA 4D0DA 4PUBL 5J1AB 4IBVA 3RU8H 4OLXL 3F84A 1H3GA 3N40F 4FFTA 3O2WL 4Y19A 1N8OE 1WAEA 1NBCA 2OI9C 5FKAB 1KXQE 2IG2L 4K9JA 2WHVA 5KBNC 1E4WH 1VFBB 3MI6A 1ONQB 1A7BA 3BPCB 4H1LG 4HAFA 3H7LA 4OB5H 2DMCA 2AXWA 3MJGX 1RK1A 5DRNA 5DD5L 2O6CA 3NP3A 3O6FD 1I7TB 3RFZA 3ARXA 3UO1L 3HG3A 2UWEB 1X7SA 4MCYA 4PRPD 3QHTC 2FB4H 4AJWA 3QQ9D 3GUTA 1SY6L 1JXGA 4PWKA 1GGIL 4HPOL 1HINL 3V0DA 2L0DA 1GS7A 5BUGA 1WA0X 2FT7A 1CXHA 3DYOA 4L8SC 1KGWA 3DBSA 4Y1AB 5SWQB 3FB8B 5EU6B 4Z7VF 1RXLA 4JJ5A 3CXFA 3AU1A 1DJYA 1OGAA 2OJZL 3BP6B 3LPPA 4DGYH 4Z7AA 2NR6C 5CP3H 3D25B 1USZA 2H4EA 5EBLB 4Z77A 3DX0A 4DPBX 1MIEL 2Q7YA 4LVNB 5DUPL 3QUZC 4Y8DC 1ED3A 3ATEA 3BD5A 4XVUC 5IJKC 1P0SE 1TO5A 4S1DD 1L7TL 4KO6A 2WD0A 3ME0A 4NQEA 3BMWA 1N67A 3TA3D 4R5TA 3NSJA 4DGYL 4J4PA 3A22A 1E9QA 4HH9B 5FO9B 3QDJE 1QWUA 1T22B 3SE6A 3U36A 2AQSA 2FWSA 2Y4SA 4RAUB 5F1KC 3S3JA 4K8RL 1RJZA 5I19L 4UDTA 5DRZA 1JZHA 2OI9B 3P9LB 5FYKU 4KI5E 3F58H 5EOTA 2H2PC 4UQDA 5KSAA 4NP9A 3QDGA 3TH3T 2JQZA 4KNQA 3DX6B 2OJ1A 3EJZD 3HR5B 4JFEA 1A6WL 2E7MA 2G5RA 4LHUA 5GIRB 3B6SA 5C09B 2IFGA 2ZCHL 3UERA 4IJ3C 3PV7A 2F7QA 3IDYC 2E75C 1XZ0A 3FU6A 3NN8A 1J0ZA 5DEGB 4IKKA 5IHUL 4PTTA 1UTDA 1CGYA 1FG2B 1ET7A 5C09D 5JW4Q 3WLWC 2XY2A 1SYSA 2ENPA 4ANKA 4XNZC 1LP9F 3RWCA 1TETL 1IMHC 5DO2C 3QEHA 1PZUB 4YDLB 4RFNC 5C0ND 3VXUA 4TUJB 4G5AA 5IP4A 1F8TH 3EAKA 1UZGA 1S3KH 2VUYA 1B9ZA 4XC3H 3QFDB 5MEND 2Y2WA 4LEBA 4OVUA 5FO2A 5IHLB 1QEWB 3OKLA 3WJMB 3Q9PA 3QULA 3RL1A 5EU3A 2YMTA 2A9NL 2AQQA 1IZJA 2XNAA 1BEYL 1X5AA 3I6SA 1CICC 2O61A 1V3KA 3TCLA 1EHLH 4P2YA 4GUPB 2AEWA 5EO0B 1GIGL 1BM3H 3L7FB 4XB7A 5E9DD 4YXHL 4U1IA 3AAZA 3B7YA 1O9VA 1XO8A 1SJHB 2OULB 2IMNA 2W65B 2HVKB 3MUZ1 3QYNA 4F15B 4UAOC 4OV5A 2O5XL 3ZE1E 1DCLA 5IZ7A 2KHAA 4YXLH 3FTUA 4HUXB 5C0AB 3L3GA 4KTYA 1IGCL 2DQ6A 3FYIB 4G80B 4L4TA 1RU9H 1MQ8A 4MDRA 4HCRA 1MIMH 3S97C 3CFTA 4L8DA 2Y6TE 1CGXA 3V0EA 5LB1A 3KLHD 1MZZA 1V7MH 1S7VA 2JKLA 3F62A 5F7EH 1NAKL 4C83A 4LRIC 1HHJB 3HFMH 1I3GH 4K8RC 1BGXH 2Z65C 3MFFA 5D1XE 3RGVB 5KG9A 3ZKND 2JCCA 5JW5B 2FR4A 2IIJA 1IFRA 4C56B 4B96A 1BZ9B 3WKPA 1T20A 4YDVB 2R1WA 1J0IA 3ABLB 3VGAC 2EDYA 4EN2A 4HWEH 3QUXD 2PWGA 5F97E 5DQDH 2I7SA 4YXLL 4F5CE 1PFOA 2DICA 5E7FA 2QVMA 3ZDZB 5F7BA 1ZSDA 3Q8CA 3SBPA 4HPYL 1A9EB 3NIGE 2VAAA 3KBEA 3GZOA 2LLNA 3HI1B 1CDGA 2ZUWA 2IJ0C 4IJTA 5EIIG 1U93A 3FPXA 3PJLA 2ZX9A 4N3TA 3KPSB 4NBZB 5IG7A 2MCMA 1WFMA 5FYJE 3FH7A 3DTXB 1AACA 3C6LD 3NCBB 2HH0H 4ODVH 4ENZA 1PW3A 3BKML 3VCLB 4NQDD 5G2NA 1S9VB 2P5ED 1R24A 1QPXA 4FQCL 4RFOL 3MRIB 2J73A 2EXSA 1MCPH 4M62H 4P3DA 3WS6C 3EBAA 2YPLE 1FYHB 2QKIA 1TVHA 3MRBB 4ZW3A 2EXWC 4ZS7L 1UENA 2GJRA 1H6EA 4K94H 1EK3A 3M8OL 2I32A 5AZ2H 2DIAA 4OAWA 4NKIL 4FQ2L 5E8DL 3S3BB 4NO5B 5DK2B 1A9VA 2WYZA 4K07A 3BT2H 4ODVL 2YRBA 4YHOL 3MRJA 3Q5TA 5FYKL 4HG4J 4J6IA 3LZLA 5KW9L 1KTLB 1Y18A 2Y7NA 1QW9A 4PY8I 3H3PH 3JV6B 1JG9A 3ULUH 1JZJA 2ZJSL 4XBGA 4WWID 5B38A 2W94A 2X2IA 3BLPX 5CCKH 5E1QA 5FHAH 3K81A 3WE1A 4JB9H 5EUOF 1PU0A 3FBQA 4YO0B 3KEHA 4JDEA 4I7ZC 3UTSB 4XNMA 4GRLC 3BEVA 3L3JB 4HCFA 4HCRH 5F7KC 3RWDA 4HWEL 3IVKB 3GSXB 1SOKA 3QWOB 2K4WA 4JDVB 4A55A 3TWCL 2Z91B 3BEWA 3VFRA 1MHEA 4N1CA 1JL8A 5CJXC 1KBWA 3MLPA 2MIZA 5TK2A 1ZIAA 1JV5A 4JDZA 4R9HA 4MDIA 4OQTA 4X5LA 3RVVC 2WXNA 4G1MA 3BX7C 4XPBH 1IBZA 4KZEL 2VISB 2P24B 2VO8A 5F9AC 3UBXA 2YGPA 4BKLB 4DGUA 2H32B 5D4QA 3OGCA 1ZHNB 3L2MA 4QRRB 5DQJA 1GC1L 1NBYB 3D30A 4P59L 2ADGB 3ILPB 3LNEA 5LXVA 4GAGL 2OMUB 2XV2A 4F33A 5BO1H 2X9XA 2HKHH 1WBZB 5I6XB 1Q38A 2BHFA 2J71A 2GCYA 3NFNB 3TIEA 4A37A 4M3KB 4XE0A 5E2UH 3S7GA 3GDCA 5LJYH 4ZD3H 2W60B 4KRLB 1MQKL 5FYJH 1D9KC 2H26B 4ZMNA 4BQBA 5F3FA 3JWOH 1GOFA 2WIIB 1WBXB 4H1LH 2LLLA 3AU1B 3LVTA 2H9GB 4D9RE 4M1DL 4Y5XC 2IVFC 3K4ZA 3S4SA 3QXVA 4LBAA 4HS3A 5KBPA 4C4KO 1EMTL 5I71B 3LKNB 5ID1A 2J5WA 3W37A 1EAOA 1DBAH 2Q9OA 3FQXB 4LSVL 5GS0D 2FQDA 2UZIH 3MUY1 3CLEH 4DVRH 4QOKE 4F58L 1ITCA 3HS9A 2R1YB 4BK4A 3P9WB 1A7RL 1B4RA 4S1DC 3G6AB 3DGGB 2JB6B 2ROXA 3N85H 2DWSA 3J2PA 3LZPA 5DF0A 1KZYA 2PXYD 1NGXA 4MMXA 2X3AA 1RURH 1ULVA 1FE8L 1EXUB 1KEGH 4YSOA 5HYQB 5JHMA 3OMIB 3VWKB 5GIRA 1GH7A 4P2CG 4WFGD 4UOJA 4NKOB 5IB5B 2DI7A 1E5CA 1Q90A 1MFCL 2HTLD 1YEJH 2PABA 3VFMA 4DK5A 4WFHE 2CUAA 3LNDA 5D1XD 4RMUA 3LH2H 2P5EB 3IDGA 4TNVK 1V05A 4JVUA 2EUZA 4AQ1C 4L3AA 2I27N 1G1CA 3PAZA 3KYAA 3ABKB 1NDMB 5C0BD 2AABL 3UYRL 1Z5LA 4UI2A 3L1EA 5EPMB 5DJZB 3PYCA 4WFHD 5AYTA 1SPDA 1N64L 1L7IL 4WFFD 5JHDA 1ZPUA 2D7TL 5DDHB 2HRLA 5TE4L 4F1SA 3NIFB 4PJ9A 3DIFB 3FSZA 3ZYOA 2Y5TB 4N8PA 3PJSA 4TN9A 1MJ7L 4S2SB 2BW5A 4NPYB 1EJ6A 2WBJB 4RSYA 1AKJB 2ZZUT 2XWTA 3I9IA 4M6OH 1TZGL 1CGTA 3V52H 3TFKD 2F5BL 5JQHC 3EOAB 4NNPH 5I8KL 1X5LA 4AYBA 3H0TA 2VABB 1AOHA 1AMYA 4OLEA 5PCYA 1OAKH 2H3KA 4FQXD 5EB9A 1EO8L 2F53A 5F8QC 4DQAA 1A02N 3SDXF 3HAEA 1D9KA 1IGIH 3CQPA 4O9HH 4OFPA 5JZ7C 1OSZB 4GP5B 1RAMA 3EYOA 5DC2A 1IEAB 2DKMA 1T0MA 4HUXA 5C0AA 1DN0A 4X8XA 2FYYB 4JZNB 5DJXA 1D5BA 2QGDA 4Y4HB 1X44A 1CBVL 3OR6B 4QO1B 1KCSH 1JERA 4X9BA 5K1JA 3WO4C 5JYMA 4L05A 4YAQA 4K3JL 2CJ3A 2Y3AA 2V7HA 3VXQB 5LVEA 1TF4A 3QIWD 1UATA 2X4UA 2ZUQC 1R33A 5GGTH 4B9ZA 4CN4A 1BLIA 2P43B 4KY1H 2PCPA 5KYNA 1BPVA 4M02A 5C6PB 4FJ6A 1A7QH 5L88L 5GS0C 3MVSA 1A1MA 3GJFB 3GMPB 1DCEA 5AW9B 2BOBA 2EICA 2XX1A 4LGPB 5DUML 2EDEA 4L9LB 3LKOB 3VGEA 1RLBA 3EO1B 2RFXA 3S5LG 3QG6B 4DP4X 2I24N 4DGWC 3LEXA 5E00A 4JY4A 1MCRA 1G5GA 3LSOA 4LLVA 4X99B 5FF6B 4R6UA 4UZSA 2CIKA 4Y2DD 2BVQA 4NFCA 1U93B 3GBLA 1AXIB 1Q0EA 1ZA6B 2EO1A 3REWA 4TVPE 5H37G 1NC2B 1FYTE 4HIJA 4ZAKA 1D5IL 5J9PB 2K4AA 1FYTA 5F1OB 1I8KA 2AJSH 1RERA 2G0KA 1CE1H 3EW3B 2VDQL 3SO5A 5B3JE 3K8KA 2A74A 3DX1A 4Z77B 1NLDL 4HOMA 1U33A 4E0RA 2HRPH 2Z8SA 3VRLF 1F6LL 3O4OB 3V6FB 3ULUD 2A0LC 4AJYV 2X7LB 5J57B 4N2OA 2FHCA 1AQ8A 4OY9A 4JFPA 1CXKA 2N7AA 4JN2B 3WFEH 2W91A 1E9QB 1GY2A 1KBGH 4AV5A 1MVUA 3WY4A 4P5TD 5HYSA 1JXJA 5B1JC 4Y19E 3EJCA 1QR1B 3GM0A 2Y1ZA 3AS1A 3FO0L 3VNZA 5LUMA 2MFNA 4X6CE 2CHWA 1AO7A 2LFEA 1BVLA 2BJMH 3DO7B 2VQ1B 3EJYD 4LXFA 4M7LT 1OE1A 1A6TB 1Y07A 3AQDA 3ALPA 1DEDA 4YO0A 1NZRA 4PJGE 4GOSA 4L3ED 2V7NB 3R4DA 3T8XA 2ALWA 4WSJA 1IFGA 1WWBX 5I6LA 2H1PH 4RGMC 3BISA 3E9UA 2B1AL 3ZSTA 4QHNB 3TT1L 6CGTA 3HN3A 3PGFH 2ADFH 1YJDH 2LU4A 2ORBH 4E9LA 1ZVNA 2OCFD 3FSAA 1RFDH 3DX9A 1JV5B 1TSHA 4JDZB 3ZGIA 2CLZA 4ZSOA 1TMQA 2V3DA 3VX0A 5GGTA 3BPOC 3LAFA 3NEXA 4Z0BL 3ZBMA 2DTMH 3ZN6A 1FG9C 4UV4L 3QPQC 3QDMB 1KB9K 1DJIA 3D07A 4PLKC 2ZSVA 3CLWA 4AVJA 4KROC 3O6FB 1F4AA 1Q0XL 3QIBC 2OMUA 4JCWA 3ZMRA 3FOLB 1LD9A 1O75A 2DLEA 3P0GB 4JN1H 5C08A 1F56A 1C08A 2B1OA 1CF8H 2D0FA 4K3HA 1IM9B 4GAAA 2EYTB 3E3QE 3FCTA 3LQAC 1CXEA 2L3BA 4H8QA 1MFEL 3GGWA 4G70B 3NIDB 3B9EA 4MA7H 2VQUA 1Y6NR 1JPGB 4Z7NB 1RK0B 2X53A 5D7LB 1JNLL 1ICTA 2JMRA 3QO0A 3UIYA 1JZ2A 4V2CB 4ZXBD 3V9FA 1LQSR 3CCHA 2YQBA 5HPOA 3B9AA 3PF2A 5JIDA 2EIEA 3RKDD 2L7EA 4NRYA 2H1LM 5BZWA 2YRZA 3SOTA 3QDAA 1U8QB 3WMSA 2IPKA 2NY5L 4LASH 4OJYA 2R1YA 1OO2A 35C8L 2VXQA 4G59C 1WZ1H 2R56H 1TEYA 2VDLH 2H6PA 4L3CA 1E8WA 4XN2A 5E2WL 1P6AB 2JCCB 4U1HA 1MCDA 1BOGB 4UUJA 5J12C 1MPAL 4UT6H 2NYYC 1W8OA 5HYQA 4B0MM 1UXWB 4XNUH 1QSEE 2A9MH 1P53A 4D9QD 4EZLA 2K9FB 2VXSH 3GMNA 4KMTH 3BRFA 3DLQR 3KGTA 5JNYB 5A43C 2C8NA 4DKEL 5JW4M 2ENSA 3ESVF 4JAMB 1ZGLP 1QD0A 1R5WB 3VFMB 4F7EA 3U46A 3WI9A 4ZUVB 5E8OB 2IADB 1EZUA 1H0DA 4GP4B 1KCWA 2IGLA 1SHXA 2W81C 5ALBH 3VWJB 4PJGF 2WSKA 5DURB 35C8H 3QGVA 4HLJA 4C4BA 5F9JA 1E9PA 1YVLA 2B4CC 4U1MB 1BFOB 2ZICA 2R1XA 3T9WA 3LN5A 4AW4A 3LH8A 4U1GC 4XPGH 5K5YA 2ED7A 2ZPKH 1Y0LB 2FATH 2IGFL 2EH7L 3F05A 3WTVA 4GT0A 4HGWA 5AG8A 3BSZH 1J8RA 4W93A 2PO6A 3B9VA 3GZQA 4W70A 4P3DB 4R2GD 4GQ9L 4O2FB 1CFBA 3ELQA 3ILEA 1PX4A 3JT0A 5EEYA 3MUGB 5F0LB 2PWEA 1DSFH 2UYLA 2FZ3A 1FZJA 4ZX6A 1AKJA 3RL2A 2WLIA 4ODXB 5AVZB 2VSDA 5FFLA 1BD2B 1U36A 5IF0B 2N7SA 4E36A 4W4OA 4PAZA 3QXWA 4TM9A 3WFCL 4JQXC 1DP0A 1P7KB 4OLWH 3OC8A 1U3ZA 4FQLL 4YDZA 3O3DB 5BJTA 1HYRC 5A6MA 1ZV5A 3O0RH 4B27A 1Z6JT 3QR1A 3TT1H 3RTQC 1XGUB 3NCFB 4OZGA 2XQYA 4JVPA 5DJXB 4PJBA 3X2QB 4I1NB 5AKVA 4BHUA 4XBPB 2MRYA 5AENA 3OJDA 1AXTH 1HZHH 4KXAA 5H2BB 3UTSA 5C0FB 1J8HA 4LCVA 4F9LA 1OP4A 3BEVB 2ZOKA 4HC1H 3DUHA 1MNUH 3CZGA 3OZ9L 2GHWB 1PD6A 4YSEA 5LBSL 3QJOA 3QFJD 4PJHA 4GKSA 1N18A 4OJDH 2GTWA 1WT5A 5E4IA 1TKWA 3U9UA 1E40A 3GSQA 3FF7A 4FABH 4OCSH 1YN7A 1IGFH 1IBGH 1NDGA 4WHTB 4M6ML 1T1YA 1D6EB 3MA9L 2ZOLB 2J55A 3GXTA 1FVDB 2V2XB 3SPIA 5E6UB 1XCQB 1HH9B 4L4VD 2EE9A 3RTQD 5JQ6H 3CN2A 4G3YH 3RKPA 3RBGA 2VLKD 3MRPB 1SN5A 4H44C 1Y1UA 2W60A 4R7NB 1HYSC 1AIFA 3TBWA 1JMZA 2N4IA 1FFNB 3GSRB 5ECGA 2I26N 5C3IA 1MRCH 3KEDA 4OLYL 1QWNA 4RETB 4JHAL 4FI7A 1PYWB 2ZX6A 3KLAB 5DGRA 2MTPA 4RESB 4WGWB 5EEUA 2F19H 2X1WL 2AJ3A 2DBLL 4C55A 4HDIA 2ZT9C 5C6TH 5AVQB 1F58L 1ZHLA 4D94A 1BX2B 3L1OH 2YRLA 3S88L 2BXZA 4XMPL 2HVJB 5DTFB 2CNZA 3QCUL 4JFPB 5B3NA 2DQHH 2W0KA 3BO8A 1IT9L 5GGQH 5HPMA 1A6AA 5H37H 2DQCL 1VGEH 2ZWLT 4QLWA 4G6FD 1MWAH 2AJXL 3RUGA 1KIUB 1VRSA 4Y2OA 1Q1JL 1ILSA 1FGVL 2OSXA 3MR9A 4V1DA 1TCMA 1JWUA 2HA1A 4R7VA 1NMAH 4TOYL 1HEZA 4NPKA 5K9QG 2DQCH 1QA9A 2P42B 1WEJL 4AGLA 1IGYB 1QABA 3CXHK 4FADA 4N2CA 4YLCA 5T1MA 1NMAL 4TOYH 2B3IA 4ELMA 4AM0Q 3SIKA 4W9GC 2V7NA 4RH4A 3T8XB 1RH8A 2ETWA 4P07A 2M8XA 1F11B 3HN5A 2LHAA 2FVNA 5K1NA 4YGVA 3U83A 2DM3A 1MRFH 2GTZB 2D2CC 2ZWSA 1DTUA 1FIEA 2HN7B 1XH3B 2JIXB 2OYMA 4K23L 3PL6C 1BVZA 3FMGH 1I9JH 4JFFE 1Q1PA 2WXOA 1HN1A 4UMSA 4YIQA 1HXYB 1IGFL 5JQ6L 4F7KA 5CP7A 3O11A 2AEPH 4AK1A 3ZYZA 2XWXA 2FT8A 3VSVA 2W80C 4ORZC 3VH8G 1CL7L 1I9EA 1J8HD 5IQ9A 2IBZX 4RNRA 4XMTA 4Z8FH 4U2ZA 2VERA 5DA4A 3X3GH 3M7FB 3IFNL 1VADB 1MCBA 5SX5H 3FFOA 3R7RA 4YMPA 1ZGLA 3NDZE 4XWOC 5GQBA 1X5GA 3HNTH 4APXB 2X4QB 3PP3H 2V5TA 4OBSA 3O3BB 4R3SB 4QTHA 1KFGA 3B2PA 3DX8B 1EEZB 5BRPA 2ZX8A 5F3BA 5IFJA 1WYJA 5I8EB 3DPBB 1LK3H 1HL5A 1OQOA 5E6IA 2HPTA 4N1HB 4FQJL 4OLWL 2KKQA 2WANA 4BZ1H 4R26L 2WVSA 4GSDH 4JFYA 3KVDD 3SYCA 4KKZA 2VIRB 2NW2A 5ESAA 3MLVH 1BP3B 3T0AA 3OWRA 2G2NA 1PY4A 4Y4HA 4CNIA 3HB3D 3HRZC 4I0PD 3PREA 4J23A 3C8HA 2WXRA 1KENH 2AQRA 3MLXH 3HVDA 4QRPA 4Y5YA 3HJEA 1KYOJ 2XQBH 5F21B 4D7PA 3H8NA 3FO9B 5H35B 2G9HA 1IBDA 1EIBA 1U8HA 3V0GA 3DO3A 2DWEA 2PCPB 4ANXA 2Z4QB 4PJCF 4Y19B 5HHNB 1UACH 4XB3A 2J43A 1THAA 2ZUUA 3WN6A 2A7BA 5AWNH 5FKAA 1TQWA 3BLKA 1E6OH 4NQTA 2CKBA 5SV3A 2B1AH 4ETQA 2VXSL 4KMTL 1P84J 1JFQH 2FJUB 5FO8B 1RURL 5C07E 1N5YL 1DBBH 1BAFL 3TVMA 2ZPKL 4OD2A 2HX7A 3ULUL 1H0DB 4Z7UB 5EO1B 1TJGH 5FUZL 1NIDA 5H94A 3T5WA 5FECB 3AG4B 5GS1C 5C0GA 4GAFB 4U1MA 1J10A 3MYJB 5E6IC 4NQEE 3U0TB 4AMXA 5E08H 2JTYA 1T80A 2IALB 5FUCC 1FYTB 4OCRL 4FI6A 4RZCB 3VI4A 5I1KH 4GO8A 4QHMB 1P2CB 3BZ4A 1GAFL 4PJ6A 2B16A 4OTXH 1M7IA 4HMDA 5I75B 5EU6A 2VDKB 5JHLA 2FGWL 4RGOL 3ISYA 3QB7C 1YQ2A 2D0GA 1EDHA 1XIWB 1MCJA 1UKTA 2WLYA 2DWXA 5DEJA 1NH6A 4LSPL 3VXOB 1KN4H 1S7TA 4P4KC 3Q13A 3FTWA 4HIHB 5E0QA 3EGDA 1XSJA 1IAOB 3WY3A 1ES0A 4JCLA 3WCYA 3QCTL 5KSBF 1PX3A 3IU3A 4RISH 4L37A 1WZ1L 5EU7E 1VDGA 4X80L 4E42B 1HTYA 3NVQA 5KVDH 1ETZB 1J18A 4RMRA 3BXNA 1J88A 1JNLH 3WDIA 2R9HD 4NJ9H 2F7IA 2XWZA 3N2JA 3RVWC 1NGZA 3P4MA 2Z34A 3LX9A 3TP4A 2AQ1A 2WCSA 4IJ3B 5ABZA 5EHFA 1YEFH 2FEDD 4PVNA 4JG0L 3ULUC 1RMFL 1D2PA 2A9AA 2W88A 4XNYL 3ZK0A 5CCKL 2DM2A 4MA7L 3V5DB 3F7QA 2CUHA 1MCCA 3SQOL 4L0ZA 2X1XR 4WJKB 5JMRA 4LBEB 4HXBH 2XWJA 1A7QL 2F2HA 1AXSA 4R97B 2X3CA 3GKZA 1EFXB 4IRJD 1DYZA 1C5BH 1X9QA 1YEDA 1R46A 4YBQC 4AL8C 1E4XL 2DTSA 1SF5A 4Q9RH 4UF7C 5F1SA 1H8SA 4KBPA 5I5IA 4OZIF 4CU7A 1JIBA 2R83A 1XCQA 3QI9A 3GRGA 4EN3C 3KPRD 1A4KB 3K8MA 1FIGL 1B0RA 4FFWC 4AYDC 1JJUA 5F3HA 1R3HB 4F8PA 3FUHA 4H0IA 5J3HD 1MFAL 5HHPB 3O2DH 1QI3A 1H8OA 2ZCZA 3ZQWA 4B0MB 4LSDA 1ZXQA 5KTEL 4FNPA 2NQ3A 2R2EB 2MCPL 5EU5A 2A4EA 2X1QA 3GMQB 3WUWG 43CAB 4F15C 3OLIA 5LBSA 2GQHA 3MV7A 3VWKD 1W0WB 4R7XA 3DOSA 4I77H 4PBVC 3KL0A 1TZGH 4F7TA 3RB5A 1C7SA 2FH6A 2O6DA 3HC3L 4DK6A 4Z8FL 2OTUA 2PPCA 3ZRCC 1MHHA 1R3IH 1VESA 3RJOA 4AK2A 1WP6A 5CEYA 3AREA 4AVKA 1KEML 3RYMA 4HX1B 4XMKL 4MAYB 5I2IB 4W9DC 4Y16B 4FAAB 5I30L 4I9XA 3APDA 4HULB 4JKMA 4F5CA 1J0HA 4X8JB 3DK2A 1KDIA 1RULL 4GW4B 1S7QA 5DLMH 3L5JA 3DRTB 2XTJB 1KYAA 5IMOB 1AC6A 4LEOB 4GXVH 4XPFH 4XP9H 1S5HA 4LHUG 2G75B 4QHUB 3VO0A 4L18A 4KZDH 4BK5C 1UWGH 2ZUVA 1OSYA 3AS0A 2J2ZA 3FB7B 5DT1L 4PS7A 3S3CB 3AABA 1EGJA 2ZYIA 1JYVA 3OPZH 3T71A 4MJ6B 4PJ8B 2BOCA 1QLRA 1R17A 3DV4A 3FAWA 4NFBA 4V1DD 2KQNA 1RV6X 5KANG 1QNZL 4YLQT 4AC4A 4GG6E 4E68A 1HXYA 4E9WA 1X5JA 5A6LA 3T0ED 4XN1A 5TQ2H 4IBUA 1C16A 1F4XL 4QXWA 3WNMA 3APFA 3QPXL 3SDCB 1IC5H 3IFNH 2PKDA 2YA1A 4HIXL 2OX5A 1G7HB 4LEXL 3G6JE 5T1DH 2ZYSA 1TQBB 3FAXA 3MODH 1FNLA 5FW8A 4N2HA 3NSFA 1KB5H 2P3YA 3HZKA 5JXEC 1FDLH 1MJUH 2NXYB 1NANI 1JGIA 2HTKD 4JR9H 4DCQA 3ZVVA 4N2BA 2XKSA 3BZEA 1AGEA 1NFIA 3IWUA 3HC0A 3V4PL 4AT6B 3DPBA 1GZPB 1C8PA 3BH8A 4Z7WA 1S7XB 5DQ9A 5EZPA 1X9RA 4X5RA 2GT9B 3H3BC 4HK0B 3VI3B 3WNOA 4Z76B 1K3ZA 2ZXGA 3WHXA 2H0FA 4LIQL 3IGAB 4G43A 3GRWL 3BAXA 3BDYH 3FRPB 3OGOE 3SKNB 2BOLA 1NBZB 2CCVA 3I2CL 4KKLC 1JWSA 4PPTA 3WFDH 4LF3A 1BJ8A 4LP4A 3WUZA 1ND0B 1RHHB 4FLQA 1JPFB 4JANB 4XVSH 3ZGHA 3TU6A 4FLRA 4Y5YB 4KITB 2C9XA 4WUUD 1TEGA 4YUEH 4WO4D 1L6ZA 1XHHA 2WVVB 1E28A 2ZKMX 3U6XS 4XCFL 3SDYH 1DQDH 2QVTA 3SGEH 1MREH 2RQ8A 2ZG1A 3B43A 4JRWA 4OZHA 4X6CB 3UFIA 3V5HB 2DYRB 2A0LD 1YN7B 4HLZG 4LRIA 5FAAA 3VFRB 1OXYA 1LEGB 3ZMNA 3JQOB 4PREA 3VGBA 3S3SA 4AG4L 1J9SA 1RK1B 3G9AB 4LLMA 5SWSE 2KI6A 2P44B 3OAZK 2V2WA 3UJIH 4LCIH 1TJIH 4DHLA 5IJKA 1AD9B 3G6JB 4JM2D 2WUCH 2LT9A 5E4OA 3VXSE 4FCAA 4P06A 4EUPH 5M94B 1SVZA 4Z7UA 2CHZA 1I7UB 2VDQH 5I6NA 3GDBA 3IPFA 1NCBL 1JZ4A 1OY3B 3UC0H 1UXLA 1CO1A 4RVBA 2FJFB 2IWFA 1KXTB 3GPEA 3GXDA 1WBZA 5F2FA 3IDJA 4WGKA 4GBXB 4K2UL 3RURA 5K59F 4G8GE 5E4AA 4EDXB 4XP6H 3FT2B 3FCSB 2XFXA 2V9UA 4P2RE 1P2CA 3GHBH 1II4E 4R4BA 2P4AB 3WL9B 5KYYA 2VH5H 3CBKB 3DURB 3SGEI 1ORQA 2G3NA 2E7HA 4ERSL 1HOCA 1TQCB 4M1GH 4GKLA 3VFUB 3ML8A 5GRUL 3E3QC 4WTZA 2OQJB 3SKOB 1XIWA 1ASOA 3ABGA 4RGNE 5E99H 1E30A 4L48A 3BO8B 4LQFL 1EZVY 4UIKL 4AYMC 2AF2A 1KJ2H 3C60A 4NQSA 2JQMA 1UM5H 2WXGA 1O5DT 4BRJA 4B6ZA 4HJTA 4X4ZA 4K71C 2WCGA 2B2XL 3CVHA 3E6FB 3I85A 4JEGB 1UWEH 3IJHB 5DRZB 4ACPA 2W0LA 3H9SA 1NJ9B 1G9NH 1W0YT 3BZ5A 5I0XA 2O6FA 5FYJD 5FIEA 4GB9A 3IDUA 3ECUA 4TKWA 5BRZA 3ZTEA 3ZQ9A 4B50A 1NC4A 2WQVA 1TIUA 3PFUA 2B59B 4X0NA 1KCSL 4XN8A 3B34A 5KOVC 3W82A 1XIWC 4O4YH 5EC1B 4LCWB 2IQAA 5CR1A 1CMOA 5EEXA 1VCAA 4I87A 5MEOB 2EXTA 2R51A 2XV3A 3E8VA 1OAZL 3I84A 3FO2B 4ZFFB 1UA7A 4UTBL 5HVFB 3WN5A 4QYOA 1CD1A 3TONA 4LCYA 3TO4D 3HMWL 1J05B 4L4TE 2V9QA 3PWUB 3ZE2E 1QLFB 2F1EA 4PJEA 4MJJA 1OCRB 2XVBA 3TEZA 2MPVA 3O8XB 3VXUB 1ZHKB 2ICWI 3GEWB 4LKXA 3WNPA 1YEDB 1KWGA 1T5WA 2VC2H 4AX3A 2RCSH 4XPBL 2D9QB 4QT5A 4FJYA 3VFNA 4MMYA 1QBLL 4KRPD 4R96A 5K9KA 5I26A 5KVFL 3H42L 1NCCL 2EYRA 3BKCL 3HUJE 4FYRA 3PNWA 2GBUA 2CJUH 4PJFE 1JTTA 3SJVD 2C9QA 3MU3A 2Q3ZA 3FHAA 3ARFA 4FYQA 1WIOA 2EDJA 2VN3A 1CLVA 1M1XA 1UZ6E 1XGRB 4WZ9A 1MHCA 1ZV2A 3AXIA 4A68A 2G2RA 2FBJL 4DKFL 3GMMA 5DC0A 3S36H 3U0WL 1UT9A 3AAZB 2GSIA 5C7ZA 2HJFB 4N6RB 3T2LA 4R4FH 3CFJA 5HVHB 4WGVB 1GTFA 3UXFA 3TBYA 4ONGL 5TFSH 4YJZL 3Q8FA 2HT3D 5AYUL 1TNMA 1IM3A 3GHPA 1BEYH 1XAKA 4APQB 2QSCL 3PXLA 1K5NB 5DVPA 3HG1D 4XAWH 4PW3A 2ZKWA 3U1QA 1VERA 4BFNA 3M8OH 4F2FA 1C9SA 1KPRA 4XH2B 2ATPB 2HFEA 3EYFA 4JHZA 2LU3A 3G04B 4HUUB 3H85A 4U1NA 4ILDA 1QW8A 4M48H 3UZVA 5B8CB 3O8XC 1JUFB 1PAZA 4KAQH 4XO5A 4OGXH 3V2AR 4L4JA 1T6WA 1R1CA 5IB4B 2QSTA 4FXGB 3BWZA 3VU1A 1NM9A 4ZFOL 2R8SL 3TPUB 2LU5A 2ERJB 1MH5A 2D7NA 3C6SA 2P8LB 3QCVH 3A6BH 3BC9A 4NO3A 2WWKO 1G1OA 1KT2B 1QI4A 1WA1X 4JM2B 2BVOA 4OD2B 4QIRA 3ZHLA 3L8QA 1A1MB 3GJFA 3GMPA 5IWLC 1JHTB 2ADJB 2BHYA 4ZMOA 3RPIB 1ZLEA 3GSVB 2A6IB 4G7VL 1I9RH 4LL4A 4EI5C 1IQWH 3KWXA 2ZOTA 4PRPB 1IM9D 4ANVA 5FR3A 2BCMA 1XGTB 3OB0H 4OI8A 3NSDA 2GB2A 1M7UA 3QJZA 1S78D 3CVBA 3V6ZA 1JZ8A 1ZA6A 2MPAH 3IDNA 4LLQB 1MCWW 3BW9A 4LZKA 5D1QA 1NC2A 3HA0A 2HXAA 4I3SH 3QXAA 5B1JA 1SF3A 2ZE0A 3OZLA 4PBXA 1ANUA 4Y88A 4ODBD 1H15A 1A1OA 3AT8A 3JVGA 3QI9C 3VXOA 2X70B 3G6DL 3TPKA 3WS3B 4FLOA 4JM0A 3V0WH 3QUYC 2ESVA 4XODA 1WC7A 5D7IB 3WTSA 2ESVE 1XGPB 3BQUA 4NQED 4A7UA 3OKOA 7PAZA 2O5XH 1SLWA 4GS7B 1OCOB 3K2KA 1CD0A 3TBBA 3FPYA 3RX9A 3HHMA 5DQ9B 4Z7WB 2JKIS 5IVNA 4JJOA 4MJ5A 3KYKL 2WLKA 5IB1A 3QQNA 3OXRB 3QK0A 4ODHH 5F7FA 3M46A 1ZVSA 1NAKH 1KCLA 3CDGA 3GO1L 4W68A 5HGBA 2L4OA 1FO0B 4WI8A 1GSKA 3QJVB 1QSFE 1XGYH 2APBA 1NPJA 3PUUA 3QCVL 3QDMD 2Z91A 3BEWB 3MJWA 4WSKA 4PYHA 3NAAH 3FZUC 3FN0H 3Q1EA 5DR5L 4FFVC 5HDQH 4J3WA 4QRTB 5ADPL 2IPTH 2YN3A 4G1MB 4MMXC 4M1CC 4MS8C 1TSRA 4KAQL 3VFGH 4ZJ9A 1ZLWH 4ZMTA 1LXMA 2OMWB 1W0VA 3NBNA 4N8CL 4DNLA 4QRUB 3LD8C 5J1TC 4ZO7A 3ISWA 3UTSE 2CIIA 5EIIA 1S7SB 1NAMA 1KPVA 2CM6A 4XNQA 4JO1H 4NQUA 3KYNA 2NNCA 4AQAA 1O6VA 2DS4A 2BW4A 4ZZKA 4ZOAA 5F3HB 4HUKB 3TGXA 3UAEA 4JG9A 3AXHA 5I17A 3KPRA 5F88B 5L2KE 4JPWL 3OXSB 5TGBB 1QBBA 4GEJA 5CEXA 1U8JA 3KVPA 2P49B 4ABUA 5EFIB 1HXMA 5IJCC 2VE6B 2W07A 4EXKA 3ULSA 3MGOB 4P3CH 1X4YA 4NN6C 5FUCE 4BSVA 3TBSB 3I9GH 4DOHB 2A99A 3GMQA 3GXPA 1IGTA 1QYGH 43CAA 3U7YH 1INQA 1ORQB 4XHJD 5EEWA 5E1AB 1BQHA 1DQLL 3OWEA 4LL1A 4X5XA 1E4KA 3GXFA 4HALA 4HS6A 4NT6B 1JPGA 1NIBA 2AQTA 2IH1B 2MKWA 3OKYA 5ERWA 4EJ1C 4MA1C 3QBTB 2DQMA 3DIVA 2XVKA 1I9IH 4LLWA 1F3DJ 1RUKH 1FN4A 2XN9B 3EFOB 5CJQH 5EU4A 3CZSA 4TUKH 1LVEA 1CIUA 3Q5YA 1JGVH 5CF3A 5GJTH 2X42A 3DXAE 3EHBC 4LLAA 4PJ9C 2C1PA 4CDHA 5L0QC 3IJHA 4RMBA 4JPWH 2J25A 3QUKA 4N86A 4RGMB 3UPRB 4AENB 5SWZE 3GUFA 1IVTA 4RDBA 5GZNC 4RWHA 2DJUA 3SYPA 1EXUA 1T7YA 4PRDB 4UNTA 5DC9B 4TSAL 2YEZA 4U6VL 1RK7A 2XCMC 1HAWA 5CZXC 2Y36L 4U1HB 2C7UB 4N9GA 2FD6H 2XPGA 4I2XB 3JWNG 3LIZA 3CHQA 1DFBH 2UXTA 1Z66A 4KHXH 3D0VA 1EA9C 1NUNB 3B2MA 1T2XA 3PWPA 4I3RH 1XR9B 2GFBB 4L0YA 1FFOB 2HFGL 1YN6A 3HNVH 4P9ML 1KGIA 4IRZA 5CGTA 3ZHNA 1P7HL 3TFKC 1U8PA 4UQAA 1KGYE 2B3RA 4QHLA 5E8EB 1YMHA 5I1GL 2X1PA 4LKXB 2G5BB 3ARWA 3MV9B 4JO2H 1C12B 3VNYA 1LM8V 1E4WL 4ODTL 1MKFA 1FFTB 3MV9D 3CZJA 2R1XB 3IU4L 2B5IB 2D03H 3FF8A 2YAQA 2X4NB 3C6LA 5CKAA 4RQQA 3PGCA 3VQMA 3UEZA 4IRSD 4PJ7B 4ZYKB 1U3NA 4BSWB 4F7CB 5F71A 4ORGB 3WIAA 1BVOA 1L0QA 4K8RD 2IMMA 4EMZA 4F27A 4PUBH 3FB5B 2RALA 1NGPH 2OL3B 4QXUL 4JLRB 4O2FA 1HK6A 1NA8A 4RIRA 5FO7A 4M43H 4M1DH 2BP3A 2BSDA 2HKHL 3S98A 5GS1B 4WK4B 4XN7A 1RZFL 4K7FB 1R3KA 5LN4A 4HIXH 3HLAB 3FFCD 4AGNA 1JRHL 3CMOL 3C8DA 1WG3A 3EBHA 3AFLA 3BJLA 3ZZLA 4UIMA 4H8HA 3SPJA 2ZAGA 3I9GL 3UTTA 1DE4B 1UYWL 2W1NA 3DMMA 4G9FD 2GVYA 4OFKA 3K6SA 3MCKB 5CWSB 1KULA 1FL6A 2Y7SA 3FN0L 3SKNA 3GI8H 3R0MA 4HKJA 3HRPA 1PPIA 4JGJA 1GHFH 4JPSA 5D7KD 2IBBA 1FAIL 3B83A 3BCFA 3FQ4A 2ZWYA 3HZYB 2D7QA 2YGVA 5ENWB 3AQYA 4JZOA 1LE5A 5FOBA 3SBWC 2M26A 2F7PA 4QGTA 1UD5A 4JB9L 3IKCB 5J1AA 4UAHA 3HZ3A 1CJYA 5HD8C 1CVRA 2NTSP 1X9LA 2OSWA 1KXQA 3BD3A 4U1JA 1HHIA 1EH9A 3X3FH 1IQWL 1CLYL 1JVKA 5AKRA 5JZ7D 4NN5C 5BMFH 3KBFA 2BP0A 3O45B 4OSUL 4GG6F 2GITB 1ZT7B 3CFUA 3H9HA 3G6JA 1N7ML 2WXHA 1XGYL 1YYCA 3U6RB 4DP2X 4X99A 4K7PL 3CFDA 4M93B 5IW1B 4XVUD 1HH9A 1P9MA 2OMZB 5HI4C 3TZVB 4LOVA 4MLIA 3VE0B 3WSQL 3QRGH 2MPAL 2X6AA 4LDLB 1NSNL 5FGRA 3V7AE 2P8MB 4X7TA 4G8GB 1JZ5A 2PW2B 3EDDA 4TNFA 3AMKA 4HIEA 4KJQD 3K2IA 5FYJL 1IL1B 1NGWA 2CKNA 2R0WL 5HY9B 1YDPB 1KCVL 3BSHA 4J4PD 5C0DB 1OGPA 2BSSB 3K0WA 3QZBA 4Y4KA 2HTLC 1KBPA 3HVNA 5IT2H 4M8RA 5L6YH 4JUSA 4F7MA 4WEEA 3CV5A 2D3VA 4ZS6C 2QHRH 2MWCA 2IFFH 3C5ZD 3J27A 1U92B 1A2YB 3OKOB 4PGBB 3TCXA 4UQ3B 3TNNB 3VXTA 3QUYA 4Q2ZA 1T1ZB 1V7NL 3KXFA 4U7KA 1QP1A 4XB8A 3W57A 2UUDH 4PJ5A 3AADB 1VLXA 1G9EA 2B59A 1B3JA 4ESKA 1XZWA 2KQMA 5IY5B 2EIBA 4Z7OF 1NCDL 2PYED 4YZFF 4NQEB 4GUQA 3MLTA 2DQIH 3O3AA 4YSQA 1DN2A 4XRCA 4YNYA 1VA9A 5C9KA 3Q43A 4BCZA 1I1AA 1BF8A 1NCHA 2WLLB 3GS7A 3MBEB 4IOFD 1CI5A 2CU9A 2YWZA 3CZKA 2PR9A 4QYOB 5I6MA 3H3PL 3QUZD 3VXMD 1SNRA 3MRFA 4KXCA 2UXFA 5KYWA 5ISZD 5KJ7E 4FEIA 3P9LA 5F7NC 3K6IA 3NDYE 3PQYE 5IGXL 3L7EB 4IMLB 4MZ2A 3L4VA 2VDPB 1TQTA 4V33A 1IBBA 2ZOWA 2P5WD 4BV1A 5D2LB 3D9AH 3UAJD 3IPEA 2WKGA 5ESVA 2G30A 3RTLA 1JN6A 3ARSA 4W9KC 3P30H 3GF8A 2BP8A 4ZFZB 1CFNA 1CDUA 3CN4A 2V17H 1T6BX 5TE7L 5TQ0L 3UABA 1CD8A 2N1TE 1WZLA 4HP5A 2QMJA 1MCPL 3PWVA 1UYWH 4CL7A 5E9DA 1UKSA 5FYKD 2NR6A 3MOBL 2JH2A 2XVLA 5IT2L 1BECA 4LVHC 2Q86B 5BRZE 1KLGA 5BV7B 3FQWA 3QQDA 1A4AA 3CFJB 1IIIA 1G4RA 1WD8A 4I48A 4L8SA 1T04B 3V0FA 3SDXE 3KPSE 1G7PA 4MNQA 4TMPA 2F6AA 3U7AA 6FABL 1DQJB 1LWRA 3SKMB 2YXMA 2GJ6D 1A4JA 1TFHA 3CC5A 1FORH 5D72L 5DJ6B 1U8QA 3VFVB 2IDFA 1QACA 1SMDA 2OSLB 3RP1A 3U79A 3NFSH 1KPRB 1OW0C 1IBFA 4FNSA 3HE7C 2Q8BL 4GPVA 3C08L 4XC3L 2VMJA 1UOKA 3TV3L 2FT6A 4G80A 3HZMB 3BYYA 1I4FA 3ET9F 3OKKB 3L6FB 4HHGA 4YFLI 5KSVB 2PN5A 1N8ZA 5EA0L 2JJWA 4AENA 2OMXB 5JMOC 4YHYC 3IGKA 2W65A 4AH2B 4JRXD 4CU6A 1DZ0A 2XQYK 3HC2A 4ELDA 3MLUL 3CVCA 1SN2A 5CIPH 3RGBA 1OGAD 4C56A 4MASA 3O6LL 2V8MA 4HKZB 1MLCB 3FQUB 3T09A 1LNUB 4HF5H 4G7YH 5F7HA 1U42A 4FTVB 4CSSA 5FB8B 5A1AA 4XCYA 5HI3D 3MRKA 4KKPA 3V0IA 2YRPA 1Z9LA 2A4ZA 3UJJL 3GNML 3C5JA 4RWYL 1MELA 5EZLA 4DAGH 2Z31C 1J1PL 1ADWA 3E2HC 3INOA 3OX8B 2EIKB 3QEUA 3V4PA 4EPSA 3KLLA 1DQDL 3QXAB 1JTOA 3ARBB 4CA4A 3SGJC 1S9XB 3MCYA 4L1DA 3UC0L 3VCLA 2YD2A 1PLGL 1C5DA 1L6PA 4MWFB 1MG2C 2W95A 1A7OL 4E9RA 2RCSL 3MRQB 4GNKB 3BVDB 5IOPA 2HLFD 1EUTA 1G94A 1QKZH 3G5ZB 1TVHB 3B1TA 1BLNB 4AWJC 4EUPA 5DHYB 4CMHB 1HI6A 5FS5A 4JRLA 5DD1L 5DURD 5CP3A 5GPRA 3VI3F 3FOMA 3UPAA 1OHQA 5F9DC 2PR4L 4NRZB 4GBXC 2R59A 3MTXA 3UTTB 2NY7H 3MRCB 3MZTA 2P5WE 1LDPH 4XX1E 2WZ0A 1FH2A 3SJVA 4OZGB 1TTAA 3FCUB 3MLZL 4YUEL 2ED8A 2PTVA 3D5OF 2CXKA 5TQ2L 1BZQK 5E94B 1WUZA 5EDXA 3UACA 1ZVSB 5BVPH 1GL4B 3CDGB 3LKPB 1UXSB 4K9EH 2E9GA 1DO5A 1I8UA 3B9KD 2WQRA 5MEQB 2O6PA 2N01B 2N3JA 5ENWA 2E27H 4FQXA 5D2NE 1OAYH 3JV4A 4GKSB 3RE0A 3V5KB 5JOPE 2WC7A 3RPBA 4M61B 2VR3A 3GMRA 1FLRL 3DBXA 1WFIA 4WW2C 2HTKC 4MA3A 3GM8A 1HESA 4LLDA 4PJ8C 3PS6A 1PIGA 2XWJB 3VQLA 2IDTA 4U1JB 3LMJH 4PB0L 2BFGA 4PSRA 1KGCE 3B3IB 1F6FB 3HG4A 4FJZA 3T04D 3UBXB 4BKLA 2YMXL 1DVTA 2H32A 2PW1A 3L4XA 3Q1SL 4LOUC 4LSTH 4ZXBB 3NACL 3W0WA 1QSVA 2XWBA 3FHEA 2VB5A 3QUGA 4J28A 4BIKA 1HWWA 4G9DB 5F7WC 3GHEL 4ZPTA 3IJ7A 3MV7E 3NEEA 1RZ8B 2LR4A 3LZQA 1Z32X 2NY6B 1H3PL 1OCWH 4JHAH 5CJ5A 3FZUD 2BSBA 2EJ1A 3TH2T 1PLAA 4XO4A 5D6CB 3APMA 3CNKA 2ZD0A 4G7SB 3BP6A 4PJAA 3GXIA 2HVBA 1HDMA 3E7JA 1MNNA 4TULL 3ZSSA 4N0UE 3IFPB 4PJAE 4B95C 2K7QA 1DHKA 5BZDB 1CTOA 1G4MA 2BIPA 3P77A 4U1KB 3V4PH 1O6SA 4DIXA 2IAMA 4JR9L 4F33B 1LO4L 5B7EA 3ROOA 1Q0YH 1ZXKA 4AYFA 1B2YA 3EFOA 3LKNA 5EU4B 1UUSA 5IR1A 4AXWB 5FGSA 4OJCA 3CFNA 3BGMB 3MOBH 4Q56A 4Y1TA 3UYPA 1JGDB 3QNZB 4OCWL 5CEYB 2ED6A 1ZDQA 1KCRL 3A6OA 4GT7A 4JW3A 4MGXA 3TT3L 5H4ZA 5JXAL 1I8MB 5DYOB 3NIFF 4N9OB 3DX6A 4F2MA 3G6AA 3CVDA 3BPOB 1YEWA 3B6SB 3EZJB 3NZHH 4Z5RB 4KX9A 4OIFA 4OCYL 1ASPA 1G9MC 4HEPG 2GBVA 3BDXA 4ELMB 3PP4L 3NH7L 5D2NB 3DRTA 5LLIC 4PJXA 4L23A 3NABH 3O3AB 4PMFA 4OLUH 3FRUA 2ZF8A 2DD8H 1FG2A 1A6ZA 3HMXL 4P5RA 3OKEB 5L2KA 4UT9H 3S8GB 4QLRA 4KKAD 1ZTXE 3WXVL 1RL1A 1Z9PA 2OXGA 1PX8A 1IC4H 4U3SA 1DJXA 3MJ8A 1IC0A 1QQDB 4MB1A 4DERA 4Y16D 4JRYA 3LIZL 1L6XA 4KKCC 1NDMA 3EYVA 1VPOH 4JG0H 2IEPA 1HSBB 5CAYB 4URTB 5EPMA 1IILE 2LVCA 4BUHA 4PV9A 2I5YH 3IRCA 1QEWA 2P1YA 4NHCL 1FBIH 4ONFH 3T4AA 1KLFA 1AD0B 3QO1A 2EDHA 1TQVA 1OTUC 1XGZA 3MDJA 4POZD 2WZPA 5DRWB 5MENA 1D5XA 1P4BH 4EBQL 5E03A 3EOBB 1T0NA 3K6NA 5JIIA 4RIRB 1E5AA 2IANE 5DJ2A 4KK5D 5LCVH 3CPLB 5IROC 2E9BA 3CDZA 1CG9A 2Q86A 5F7AA 5JUEL 1RIUH 3C5SA 3RQ3A 2DQFB 3QQDB 5FGBC 4JFFB 4L8SB 4OCXH 1AHWB 1TTGA 2VC2L 4YFEA 3ARDB 4M3HA 3FFCA 4KDTA 4LK4A 5HYIA 1KV7A 4L29A 4R0LA 4DH2A 4XO9A 2B1HL 2WPGA 4Z78B 4AQEB 1J9QA 1S7XA 1U6AH 2B4CH 5IJVA 1XCXA 4Z76A 2Z92A 2OSLA 4QJ5B 2WLMA 1WAAF 2WXIA 3WEAA 1H3VA 3KH4A 4OCRH 4UTAH 2B0SH 4PY7A 5AAWC 3OSKA 4MHHG 3CFKB 4OUUB 3BWAA 2JJVA 4QXVA 3PIQB 3HC4L 1XFPA 5IVXB 1RHHA 5JW5A 3I6KB 2WYHA 5F93C 3M17A 3QRFM 1XT5A 4G8EA 1Z0MA 3Q2CA 3GJEA 1IU1A 1JGUL 2VWEC 3WBDA 4G9FB 1D9KB 2XDHA 1KIRB 4TTDD 1RP9A 5DD3H 5KVDL 4G6JH 1FL5A 2HUHA 4KXBA 4C59B 2NY5H 3FT0A 1RZKL 2VLRD 4GFTB 4LASL 1EJOL 4NN7C 5IREA 1TJGL 4J3BA 4EKXA 5D8JH 3VFPA 4OF6A 3PWNA 3QUXA 3L08A 4M03A 1T2QL 2UZPA 5HHME 3MRKB 2NXZB 4HOZA 2OMZA 2VYRE 4Q9CA 1WFUA 4FQPA 4HFUL 2DAVA 3SDXB 2OK0L 3LSOB 2YQ3A 4LLVB 4MJIA 1XDTT 4I85A 1URLA 4M4RB 3QEUB 3V4PB 2AVFA 1FIGH 3N43F 4RRPA 3MBXH 2ICWJ 2Y5EA 1G7JB 3KVQA 1ZLSL 1RIUL 4NLAA 4NNYB 4X42A 3RWIB 3UBHA 1FZMA 5JHLL 3LXUX 4K15A 1NQBA 4P04A 2APVA 3S36L 5I73C 3O9WB 1IAOA 3FQNA 5DVOA 3IGUA 4EBQH 3SE4C 4KROB 3V7MA 3LHPH 4XMZA 3G7TA 4EIZC 2AK1L 4NGHL 3P3SA 4CVZA 2I69A 4XOBA 3C8KA 1XMWA 3ZY7A 1U91A 4D3CL 3BP4B 2AEQL 1NGPL 4NXKA 1R0AH 2E4TA 1BQLH 3ARQA 3CSGA 4P57A 1M53A 3QNYA 5ANME 3MRRB 4MQXD 1JYNA 4H7VA 1GXEA 4BQ8A 2YS4A 3N06B 1QZ1A 4L0PB 2Y23A 3WFHB 5CCJA 3ZMEA 1EDQA 4ZFQA 3CN0A 1YEIH 3FS9A 4H8UA 3VW3H 3S3PA 2HKFL 2CRIA 5D1XA 5F6HI 1BQRA 1XF5B 2PCXA 2JELL 4OFYA 5HYSB 3QORA 2WOBA 4LBEA 3O9WD 1INDL 3K5SA 3P02A 4NJAL 4XXDA 3V5KA 3VFSA 5TDOA 1Q9LA 1KPUB 4YOKA 5K9OA 4P2QD 3K4DA 3KPLA 1E3FA 4IMLA 4TRPH 5DMGD 3GRWH 4KU1A 3E38A 3RWJB 4X7FC 3NZHL 3EOYG 2OW7A 5MEPB 4IKNA 5A2CA 4ISVB 3BN3B 5JOFB 2JKXA 3HEIB 5ESVB 3HE6B 1CGSH 2BCKB 3K71A 5JA8B 4TQEL 1BYNA 3II1A 3GSNA 3QNXB 5K33A 2AXHA 4S0TD 2F8IA 2Q2LA 3EBGA 4JL2A 1G6RH 2APWA 3T3PB 5F7UA 3QDMA 3IS1X 4MX7B 4Z7VB 4A1RA 1KWKA 5CBEB 3PWVB 2RR3A 1NOFA 3UTQA 4ZFGL 3M07A 1N59A 2J20A 2DQGL 2NTFA 1FNGB 2W9EH 4EN3D 5D6DC 3VJ6B 1S7UB 4W9ZA 1FLTX 3RZCB 2VDMH 1L3NA 1MLBA 2GK0A 5GISL 1VF5C 1I9IL 5DGQA 1E4KC 1BYOA 4WCYH 2WO4A 1PQZB 4RDQF 1E3XA 2CMRL 5CMAA 2BNQD 1W0WA 4TULH 5IW6A 3QH3A 1M42A 3O6FA 2VNCA 2HJFA 4N6RA 2VDKH 4XN9A 3OM3B 4WVRA 3B8SA 3I9AA 1AMXA 3F83A 2ZTBA 4YE4L 5INDB 2FWOA 2K8MA 4I0PB 1O6TA 4UOW1 2I9LB 5AL0A 5EV7A 5CCGE 4FQHA 4H40A 4PJCA 4WJ5B 4D8OA 1KLUA 2ZX5A 1Q9WB 3V7AG 1ZLVK 1JOIA 4X8JA 5IEKA 1P6WA 3U9WA 3HAEH 1UOLA 1RIHH 1BEXA 4GRMB 2IXQB 2AAVA 2HG5B 2VDML 2A6KB 3QO0B 4K5NA 2GTQA 2ZIDA 1AC0A 2JKNA 4P05A 3VD1A 4JKPL 4W9EC 3QDHA 3QDJB 4ZOCA 1AZBA 5IB4A 3WFDL 5J0BA 2HJLB 4M6MH 4JJHA 4YK4C 4WDIA 2WMPB 3NABL 5IHWA 4XCFH 4XNBA 5B3SB 2VITA 2JQAA 5FGCE 4X6FA 5E2VL 2N1KA 3QQXA 4K3JH 1T4WA 4FXKA 5K93A 1J5IA 1SDDB 3RVXD 4PR5B 2F8OA 4NC2B 1L3WA 1OAXH 1YLBB 1NEPA 2NY3C 4CBPA 1QOKA 4ONHB 4TV3A 5KSAD 3SYAA 2ZNWA 1A1NA 2H0PA 5E2VH 1MAML 4FX5A 2NCMA 1XCTB 4IYKA 5CIPA 4NS0A 1MJ7H 4OZHE 2VDNH 4N0FB 3JUYA 4ABVA 2DZEA 3LN4A 2IADA 4G3YL 1MAMH 3KWWA 4NZTH 5DRWA 2F5BH 1WHPA 3D39B 2W9LA 4JO4L 2IOOA 1EXGA 4NHUA 2VDKL 3IJ8A 1I1RA 2X09A 4K23H 4U3XA 2F54B 1BLNA 3MUGA 5KSBE 4ZNEA 3CPLA 4FTDA 3KNBB 3T0BA 1OTSD 2MQGA 4BZ2A 5CINL 3J07A 1IBGL 1H8LA 4YHNA 3ZYJA 2B15A 4GKZB 4XOEA 3H2QA 4RMQA 5B8CC 3WEMA 4YE4H 2DYPD 3PG2A 3LXBA 4JO5A 3W2DH 2ZWNA 1JNHA 2ARJA 4F37F 4QEGA 3ZT7A 4YHKH 5D7IF 3NJHA 3VDCA 4I88A 1JNNL 2VKWA 1MY7A 4NIYE 3D4GA 4NZUH 2YUZA 3HZVB 3SCMC 1N5AB 2AMUA 1WWWX 1P84K 5KAQG 2C3VA 2UX6A 3EUUA 4GMTL 5FM5O 5DRXA 4WI3A 2QL1A 1T89C 3HG1B 2CALA 1QUNA 2X4UB 3CBRA 5IWLA 1UB6B 1A14H 2Z0UA 4PRHB 1EEQA 1OV8A 4YN3A 3LNGA 5I0YA 3C2SA 3DMMD 25C8L 3AU0A 5L8KB 5F96L 3VXPB 2EVGA 5KVEE 2KDGA 3T3MF 3BFOA 1VJSA 4A38A 3SQOH 4PEEA 5DD6A 4KK6C 4QRTA 4P4KD 1RUPH 4NUQA 4A2FA 2ZNXA 1M6OB 5DD3L 3UAFA 3D48R 4A6YH 4QRPD 5GS2H 3EO1A 4ZXBA 4YQXH 4YDIL 1UM4H 1CB4A 2X4TA 3OHXC 2ZOKB 1T4KA 4KK9C 2IGTA 2IWKA 1SBSL 4G9DA 1PLBA 4L4VB 3W9DA 5IVOA 4APQC 2CIIB 3O4LE 2FJFA 5EIIB 2J6EL 2VZVA 5KAQF 1AY1H 2G60L 3AY2A 5AALA 4DO6A 2H5UA 3OKNA 1S6NA 4C56D 1JDDA 1I8KB 1AIFB 3N3EA 1AR1C 5DLLA 1VFBA 4BZ2H 1BFVH 4JFVA 1QFWL 5AKTA 3EF7A 1P7QA 1MFAH 3UYOD 1HOCB 5ECJE 3FONB 1MRDH 5KVDE 1WAAE 3QAQA 2V2XA 4TQEH 3EDEA 5E08L 1XMEB 1T21A 2NUTB 1YC8A 2IANB 3EJRA 1WAAA 3TBSA 5LGYA 1RZ7H 1Y7VA 3LIUA 3O4LB 3M45A 4RGOH 4O02A 1HQ4B 2IWEA 3ROOB 4YHLL 3GUTB 4JQXA 5IR1B 1ZMYA 1HCYA 1IEBA 4N90D 2AS5M 3ARFC 2LABA 2NY4B 3LEYH 1CFMA 3T2NH 5IK3A 4ALAH 3HUJA 3RNKA 4LLWB 3OHXA 4NO2B 5ABAA 1XTLA 1CF8L 2BVUA 3BSZL 2BY2A 3QZPA 1AO7B 4IGBD 3DO7A 5I1IH 3D25A 3K74B 2CWRA 4EI5B 1PEWA 4N90E 4PH8A 1M71A 2P80D 2ZWKA 4TSBH 3Q9QA 4OVVA 3V6BR 3QWNA 4Y89A 2I7OA 3FQ2A 1W16A 4PG2A 5AW3B 2Y9RT 1AO7D 2EEAA 3T1FA 2ZG2A 4U1SB 3HHSB 2Q6WA 5KVGE 1KG0B 4FFYH 3DVIA 4B9PA 3GKWH 3DX7A 4W9HC 3W39B 4BCXA 2XVGA 2ODIA 2KC0A 3BKYL 4ODUA 2JE8A 3PHSA 4P2QA 4G6JL 1CDCA 2VM3A 3Q2WA 4XNYH 5E8DH 1LO2L 4BCYA 2XUWA 2ZJSH 3R8QA 1B4JH 1XH3A 2JIXA 4WUKL 3SODB 1CGWA 1U0QA 3TYGH 2G5BA 4DT2A 3GSNB 2OV0A 3A67H 4AV0A 2BM3A 1UJ3B 3HMXH 4UZGA 4XP1H 4F58H 4PJDA 2N0MA 4IBLT 5T5FH 5BNXD 1NCIA 3N43B 1WGOA 4PJXF 4HCIA 4XNXH 4N1EA 4WI5A 1DDTA 2WM0A 4PRBA 4LSUH 3TL5A 1QFWH 5FM4A 1OWWA 4CMMB 1SJXA 5JHDD 1BA9A 1AQDA 3JWDC 4UM8B 3RI5K 4QWWD 4Z95L 2WTOA 1F1AA 4KK6D 4NRXB 1NCTA 4RDQG 5IQ7L 3FDWA 1CDHA 4XVTL 2WUBH 4G42A 3OV6A 4UIKH 2J12B 1EEZA 2BNQA 1RFDL 4MZRA 5F3BB 1P1ZB 1T1XA 4WUKH 1H5BC 1GYWA 3X3GL 2CGZA 5E2UL 1FVCA 4HKXA 1K3IA 3QJTB 4M56A 1TO4A 2VH5L 3DMMB 5E95B 1OAQH 4XXCC 4HSAC 4WI0B 5BQ7B 4K3DL 2EADA 3WIHL 4G8IA 4O02H 4XWGL 1ZPLA 1A4BA 1GGYA 3ETBF 1KLUB 1IARB 1P9MC 4XPTH 4YZFE 3U25A 3JUZA 1WO2A 2HRPL 3TN0C 4YSPA 2Q7AA 5E8PB 1X5ZA 5CINH 1NCAL 2EINB 1JUFA 2AV1B 4MD5B 4POUB 1AS7A 4FKKA 1CE1L 1J0YA 1EFXD 2DEWX 4ZPVB 1L9MA 4Y4FB 3NQKA 3QIUA 5DHDA 3SKUD 4QKTA 4WSGA 3TPUA 4TSBL 5M95B 3ZHFA 2F5AL 1LEKB 1AFVL 5HHXH 1J48A 5E24E 4XPAL 2KZKA 2K45A 2XU9A 3GSOB 2K8QA 3TO2B 2B5IC 4UBDC 4ZUVA 1AGDB 1FGVH 5GRJH 5I74B 4Q6KA 3FT4B 3QEQE 2HAZA 4R84A 4C8XA 3AGVA 1ID5I 3S34H 3BVUA 2Y24A 5F8RC 4BZ1L 1UWFA 4HJGA 2EXYC 5FO8A 4W9IC 5FWRA 3KM2A 3NH7H 3K5RA 3MFFB 3QCUH 3AREC 1MFEH 2FR4B 2QZQA 5EZJA 1WWAX 1BJ1H 1JVOA 3IMTA 2GC7C 2NSMA 2XLLA 3NJVA 1W72A 5HHNA 4Y9CA 3M1BB 2Y25A 1SJVA 1XCTA 1QSEB 2PWHA 4EDWH 3WTTA 1G7IB 4JL1A 4K3EL 1ZVHA 3B9KC 4MAUH 3VDBA 3FW6A 4FYTA 3VI4B 2BSTA 1AHKA 1OE2A 3L5XH 2DIEA 1FI8C 4PJFB 3UP1A 5EO1A 3VQ1C 1CFQA 1WC7B 1YDPA 3QUZB 2APSA 4WEMB 5IJBC 3U0PA 1TR7A 3FSWA 2J6EH 1S3KL 1QFHA 3M88A 4OZFB 3PAVA 3WMQA 3RVTD 3UPCA 4PJ7E 1MCEA 2ZXDA 1TCRA 1CYGA 1CFTB 4QHKJ 2H32H 4AQ8C 2HX9A 2KT6A 4GXFA 3QZNA 2EVFA 1KDJA 4U1GB 4XOCA 2XTJD 3P4LA 1Q9OA 9CGTA 3NMEA 1DVXA 1JF1A 1MFBH 2QVIA 4B3EA 4ACTA 5ALCH 1SXSA 3L3KA 2YA0A 4I18B 3CSFA 1YZZA 1PAMA 1FP5A 4BA0A 4PRHE 3F65A 4A2LA 4WNJA 5GSRB 5I71C 4DVBB 5KVGL 4IU2A 4QAMB 4P49A 3V5DA 3VB8A 4J3OG 3HG0A 3I9PA 5I8CB 4IU3A 4POYA 3K7UA 3OPZL 4X5QA 1EBAA 5ITFB 1G7LA 1SUHA 4GI8A 1HQRA 3P73B 2WCPA 3GSUA 2FQEA 2YAMA 1MNUL 3OZ9H 4YHPB 4Q58C 3U4BH 5F44A 3LHAA 3L7EA 4BFEA 1JD7A 5ACZB 1PNDA 3D3VE 2NPLX 4BFOA 3TWYA 4HJEA 1DDHB 2XTJC 4KTDL 3K1DA 2JLPA 4XNMB 3T6XA 1LP9E 1UEYA 3VWKC 3CBJB 4KTEH 5BPPA 4YE0A 4MNQE 2KLTA 5FFGA 4Z7QE 1GA2A 5FW6A 5EFIA 3V95A 4J7RA 5KSUA 3VJ6A 1Y6MR 2L7JA 3VRIB 2XBZA 2W9EL 4WTXA 3L45A 2VISA 5T5NF 3TJEH 4PCYA 4AQ1A 4DP9X 2EUWA 5D1ZD 3IF1A 3OGCB 3QG7L 2QTEA 2XY1A 3QFJE 1ZLVH 5EO9B 1KTKE 1P7QD 1OP3H 5CMAB 1H8NA 1XR8B 3QFJA 2WTRA 4MKTA 5EOQH 3C5XA 2X0VA 5C0EA 1NCUA 2WXKA 5E7BA 4I48B 4I18C 5SX4H 3SQBB 3WE6A 4I0PA 4QF1A 3VXNB 2WGNB 4GG8B 4E9XA 5FK9B 3DX2A 2AZAA 3CVHH 3IAPA 5EBMB 3SKMA 2OTUB 1FV1B 2A6DA 2J1WA 3IU4H 4PV8A 3I50L 3OVUB 4JO1L 4ZT1A 3T3ME 3TVMC 3EJJX 1BBJA 1R5IA 4BZ1A 4MNGE