2LLGA

Nmr structure of the protein np_814968.1 from enterococcus faecalis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein NP_814968.1 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2llgA00
4LESA 1LMIA 3CFUA 3QFGA 2LLGA
chains in the Genus database with same CATH superfamily
1MRDL 2FQDA 2Y72A 5T3XH 4EI5B 1A6UH 1D5XA 1RZGB 3BO8B 1ZTMA 3IWVA 1FNSH 1GL4B 4GW1B 3FQTB 4M9OA 2UY7A 3KLQA 2J57A 3DTXB 4PP1D 5GGSB 3N40F 5CR1A 2Y7NA 2XACC 3RU8H 4S1SH 2DTML 1NFDA 3F12B 3QIUC 2XZQH 3NFNB 4NWTL 3HPJB 3QYMA 4JN2A 3UBHA 2O6EA 5DRNB 5EBWA 2LFEA 4AEHH 4JHWH 2APTA 3NK4A 3KYAA 1Z9OA 1N7ML 1N59A 1RURH 4P4KD 2M1KA 1QP1A 3OGCA 5IF0A 1P69B 1WT5C 3V5KB 1BGXH 1Z5YD 4AYMC 2UZYB 4ELMF 1LWRA 3II2A 4M7ZC 5DMGC 4EOWH 1T03H 4Q9RL 1BIIA 4QHNB 4IYKA 1Q94A 2EIZA 2YK1L 2I07A 1TENA 4KK9D 5GZND 1IGIH 4JO3H 1J0YA 5E5LA 1SHXA 3EFDH 4K3GA 3RBGA 1MAJA 3HBZA 3MSPA 1L9QA 5I6XC 2PUQT 2G2RA 4TSAH 4ZMAT 2IQ9L 4E42A 4QHUB 1BYOA 2WB1A 4G9FA 4K23H 3IT8D 4GSQA 4TM9A 4FNRA 5DJ0B 4PCSA 1DVFD 1MKFA 2XTJB 3TT1L 1TITA 3NRPA 1UEYA 2XG5B 3SJVB 3TBCA 3WFCL 2CBTA 2NCEA 2Y7QA 4B3VA 4ES9A 4Z7AA 4LBEA 1XSOA 3CN3A 4PYGA 1S9WA 5LAPA 4MNQD 4ZS6C 2BC4B 4Q56A 3ZBMA 1PLGH 2GT9A 4FNQA 5K33A 5LQBH 1HEZA 1CBVL 2AZUA 2EDLA 1A0QL 1MIMH 4GO9A 4G8IB 4F7MB 4I87A 1MFBH 2ERJB 2W60B 4YDNA 4YSEA 4B9GA 2ZP0T 4DH2A 1H8SA 3VXUE 3ZU8A 3LXCA 4XGZB 1W0WB 4BQ6A 1HCYA 4JFEE 2UWEA 4OLVH 3SYQA 3PP4L 2R8SL 2WXOA 7TAAA 4DFHA 4ADJA 2WTRA 1WC7A 5J13B 1JNNH 2KH2B 3IJHA 2RA1A 3WUZA 1OP3H 1VLXA 3HRZA 3EJRA 3QDMD 4XHJC 3C5SB 3PGFH 3US1A 1D9KB 1ECYA 3VFVB 2EC8A 4HHAA 1U8LA 2A6IA 2YEVB 5EZIH 3MJ9A 5T3ZH 3S36H 5DD3H 1PFOA 2QT6A 3W9EA 1CGVA 2G4GA 2OL3B 1BOGB 5CEXB 3JWNC 2AQNA 5J11B 2ZT9C 2CAKA 2VH5H 1E27A 2K6YA 3NIFE 1IC4H 1KG0A 4YPJA 5MEQA 3B2DC 3GNML 1CE1H 2HLFD 3SEPA 4A7VA 1PS3A 1CF8L 2FB4L 5FHAH 5C8JA 4G7VH 3E3QC 1Y7VA 4ZUVB 2X6UA 4PJBB 2YMOA 3BH8A 4X5XA 3ABGA 2MOQA 5FXCH 3G6AA 1PKQE 3NT0A 1R0AL 1QSFA 2AQSA 1G9MH 2JKJA 1XT5A 2CLZB 2NXZB 2V2TB 2XZAL 5E6UB 1TJIH 3EKCA 1VADA 5I73B 3D7PA 1NPNA 1AGBA 1HT6A 5DJXB 2CRIA 3LPGA 4LEOA 1U6AL 3GSQA 3B9KC 5EH1A 3MV8E 4HKJB 2NNAA 2EE0A 4PAZA 1WK0A 4ZJ9A 2EIDA 2DDQH 1TQUA 3ESVF 3LJ3A 1A9BA 4YBLB 1A3LH 3S2AA 3MROB 3ZKND 1C5CL 1JV2B 1SVZA 3D39A 4UDTB 3WV0A 2NY4C 4AK2A 2VDNL 2AXGA 1CDHA 2CO4A 2FWUA 4XMLL 4YWGL 2F2HA 3MRKB 3P02A 5D7LD 1DUYA 2JKSA 5JIIA 3RTQB 3OZ9H 1NCOA 3P4OA 1GXEA 2AJYL 4M7KH 3FRUB 4WTXA 1I1FA 1CLZH 4O4YH 2ZF8A 4JFDE 4WV1A 4FQXD 1H3WM 5CD3A 1C5DA 3VG9B 3C6SA 4OIIL 4XP6H 3MZGB 2HX8A 4DAGL 2VN3A 5DJYB 4HHGA 3P11L 3EYQD 3C75A 4PJIF 5DK3A 1JPTH 1TIUA 1IM9D 3F5WB 3U7WL 4ZO7A 1A4BA 1F97A 2NY0C 3CCHA 5D1QB 2J1ZA 3K0YA 3LZNA 4Y5VA 2D8KA 3G08B 2Y6SD 3AAZB 5EPMA 2EVJA 1MPAL 3OC5A 3QO0B 3T71A 4FXKB 2VXVH 3IBOA 2QSCH 1JFQH 3O0RH 1K4CB 4JDEB 5IWLC 2QQLL 2VUYA 3SOTA 3VFOB 4OFYD 1AR2A 1SXSA 2CCWA 4M7LH 3VVWA 1JGLH 2AABH 3QYCA 2Q8AH 1NSNL 4DFIA 4J4PD 5C92A 2H1LM 5AW1B 4HZLB 4RMUA 3UAJD 3HE6A 2WKGA 5A2KH 3CHOA 3UGUA 3PQYE 3TU6A 1OGPA 1JS4A 2QFRA 1KJ3H 25C8L 4ZW6A 4CVXB 4XMKL 4XNAA 4LF3A 3OF6D 4E5XA 4APQB 1PY4A 3DSNB 1IAKA 3L3DA 4GG8A 4NHCH 4UAOB 1URZA 4PJ8C 2KZ1B 4H8UA 1DQQB 1FO0L 4HCRA 2WW8A 3HZVB 4I0PC 3CXHK 4QRRB 4FA7B 1WAAF 2BOBA 4XP1L 2N7SA 3C8DA 3V7MA 1OGAE 2N7AA 3O2VH 4TS6A 2R1WB 1IQDA 3IB4A 1YA5A 4WKZB 2A1WL 4PWEA 1HKFA 5M94B 4N2OA 1UACH 4MJ2A 4ZI8A 2CO3A 3ZMEA 2X6MA 3MOBH 4HVBA 2JQMA 2IQAB 3WNJA 1FFOB 4Q14A 1HHHA 1S9VA 2RH0A 3VXQA 1B0WA 3I84A 2C9PA 3SE8H 5CILL 3JTSB 3RUGB 4DVBA 1U8PA 4KXDA 2NY1D 2NNXA 1EZSA 4P46B 3S3BB 5C0CE 4ORGB 3D07A 3SBWA 4Y4FB 4O58L 1G7IB 1KBVA 1IBDA 1TU2B 3TZVA 3Q8CA 4JW3A 4PJCF 2D9CA 2W59A 3QZOA 3W56A 1T1ZA 1NFIA 3VTTA 4N87A 4ZQKA 1FNEB 1OW0C 3A4DA 4NM4L 1CT8A 2VZUA 3NCMA 4GRWH 2C1PA 5E00A 4I9XA 1EDYA 5ICXA 3S37L 4DW2H 2OTUB 4GXUN 4R7DA 2MWCA 3RILA 2IFGA 5HHNB 3SDCB 3MRIA 3DVFA 1OP4A 3KHQA 2LV4A 3WIFA 3FUDA 1JNJA 3UYPB 5DFVC 4FFWC 1BQLH 4MMZA 4NO5B 4ZFGL 2HX9A 4B5EA 4HJJH 1E9PB 3QCVL 4OFDA 1FORH 1G1YA 4TNEA 4QJ4B 4WHCA 3UZEA 2ALWA 4MA3B 1LMKA 2QQKH 4NFDA 4PV8A 4J8RB 1MFMA 4X2UA 1ECZA 4P49A 2ZSWB 5IQ7H 3ZZ1A 4PI2A 5F9OH 1BAGA 1NCAL 2NX5D 4IHBA 5D1ZD 5IROA 5EO9B 5D55A 4CADA 1DE4B 4PYHA 4X5PA 4JY4B 5GPRA 1JZHA 2FL5A 3DX9B 1W15A 5C0AD 3VACA 3A4AA 1N3NA 3D0AA 5LGKA 4AQ1C 2CIKA 4HSCX 4OF5A 4IGBA 1XGRA 3GMLA 4HIQA 1U92B 5CZKA 2HRPH 1J7VR 1TVBA 4LHQB 3B1UA 4Y1AB 1LVEA 4OZHF 3QJHA 3WJLC 4M7JL 2Q5BA 3DIFA 3IXTA 1NAML 3ULVC 4Z7OB 3QXDB 5KVGE 1CFMA 3ULVL 3DGGB 4OD2B 1E67A 2XWRA 3U0WL 5TDPB 4KI5C 2BLFA 5HGBA 4W6WB 5HYSG 3BVDB 2ITDB 3OMNB 4PG9B 3IFOA 2UUDK 3OX8A 2WWOA 3P0YL 1WCBB 3FXIC 5D72H 1CD0A 1FBIL 3FBQA 3R06A 4OQTA 4NS0A 4IOSD 2YQ2A 4MQ7A 4K7PL 2XN2A 5TQ0H 3VGBA 3MKGA 4KRPB 3TYGH 1T6BX 5JOEA 2H47C 3GXMA 1N19A 1HIMH 2AI0H 1HILA 1JWUB 1KCKA 1MVUA 4N0YL 1EBAA 3KPOA 4NZ8A 1THAA 2K8MA 2H3XC 2OCFD 4C56E 4WI9A 3VQ2C 4H5SB 1XZ0A 4H1LB 2YMXL 5FO2A 3TCLB 2UVEA 3BD3A 2GUOB 3RPIB 1F4XL 3ILDA 3IGLA 1ZHKB 1EEZB 1DCLA 2MOGA 3VM5A 3ES6B 3UO1L 3LAFA 3X3GL 1V3LA 1OE1A 1U2CA 1DBML 5INDA 5DCCA 4DUWA 2Q7NA 3QFJE 3AADB 3S2CA 4X9FA 4P99A 4RA0C 4O02A 5D96C 5IIEB 4PGBA 1T5XB 5BZDB 3G04A 3LHPH 2X70B 4ZS6D 4AVIA 4QD2E 3G5ZB 4YHKH 4EI5A 4J3WA 4NQVA 3VD4A 3V4VB 1RZGA 3JTTB 1LP9F 4F37K 1S8DB 3IGUA 3NABH 3S3CB 4GW1A 3FQTA 5AB9A 1VFBB 4XWOD 2XY2A 4NJ9L 3DTXA 3WDJA 5JPNB 2W8CA 5GGSA 5TE7L 4KI1A 2I25N 3F12A 5DLML 3NFNA 1JTPA 3HPJA 5FFGA 5DS8B 2HG0A 5ETUB 4NNPL 1ACYL 2BSED 5DRNA 3PHOA 3RWGB 3DXAE 2FR4B 1BXVA 4DQOL 2GJ6D 1Z9NA 3HB3B 4IDJL 4XHJD 4E9XA 4P3CH 4XHQA 4F8PA 5J1TC 5FW8A 4X6CE 1XSIA 1QW8A 2VLRE 4YMPA 3MO1B 1JDCA 4G7QB 1KYUA 2UZYA 4GKLA 1UM6L 4YHPB 4QHPA 2F58L 1A2YB 3CZNA 3ZY7A 3TFKC 1XAKA 1SDYA 2ATPB 2EH8L 2GC7C 2R9HC 4OFQA 4QJ3B 4ECNA 2F6AA 1EO8H 2VXSH 3APCA 5I8CB 2IG2H 3FQ1A 4HFWA 3K6FA 2LLNA 5A6IA 3D9AH 4QCIB 1N6QH 1SOKA 3ASOB 1VFUA 2WB7A 3IRPX 4M43H 2YO3A 3GSUB 4RLDA 2PF6A 4QHUA 1QVOB 4QOKD 4ZMPA 4OGAC 3KLDA 2VSCA 4WUUE 2BP0B 4QXVA 3QRGL 5KSBE 4MNGE 3SJVA 2XG5A 3VGAB 1WITA 3OKEB 1JZEA 3DUSA 4FFVC 1I1CA 1JK8B 1K8DB 3PPEA 5HGDB 4QRBA 3TX4A 3S97C 1P4LB 4KZEH 3N3EA 4U1JB 2BC4A 1EEYB 3Q6GL 5JUEH 3B9KD 2VABB 4EEEA 4XN2A 1MHCB 5LXVA 3VX0A 3RJOA 1JMZA 2HP4A 4G8IA 4F7MA 1JV5B 2CMRH 2W60A 4A2DA 4AYEC 4M1GL 3ZDYB 2PCYA 1HINH 1TPXC 1W0WA 2I7OA 3BUBA 3LZFH 2NY4D 3NK3A 5DC9B 4DTGH 4PJ5A 2ED6A 4LPXA 3PCYA 4X8XA 4XCFH 4M5YL 5DURD 3V6FB 3BDYL 1NJ9B 1J1XL 2B59B 1KIQB 1TVHB 2WGXA 3C5SA 3GIZL 4MA1C 3V4PB 1D9KA 1FH5H 2A9NL 3O11B 2F8IA 2DYSB 2FLRT 3EGXB 3VFVA 2D7QA 4BRJA 2YN5A 4F15C 4PWFA 2NY3C 5I15L 2MSPA 2R1XB 1MW2A 3CX5J 5KSAD 4AGPA 5D6CA 1S7WB 1OB0A 3JV6B 2OL3A 4AYDC 1BOGA 5L2KB 1DQIA 3MRPB 5DRWB 5GRJL 1AKPA 1E65A 1RUQH 2NY0D 1RZ7H 3EOTL 4FKEA 4N5UA 5F72S 1EHLL 1CR9H 4I3GA 1YYML 4ZUVA 1EDHA 4PJBA 2OXHB 1QQDB 1FC1A 1L9TA 3N41B 3C5JB 3IKKA 5JIHA 2VDKL 1CZ8L 5BVPL 1DDTA 4YHYC 4XNDA 2CLZA 2V2TA 3IE4A 2EIJB 2W9DL 1BBDH 2Y7SA 4PJ7F 4YBHA 3I6KB 1I9JL 4PS7A 4JFQB 3DO4A 3LS4H 4RIRB 1EHAA 5B7FA 1CICC 5DJXA 5T5FH 4IBWA 2FO1A 1MG3C 4WTZA 1BQHA 5HHOD 5BVJB 3LH2H 1N4XH 1UGKA 2V5RA 3R1GL 3O3EB 2WLIB 1EV2E 3HMXA 4L5FL 2OAAA 3DJSA 4NO2B 4MAUH 2HKAA 3E1ZA 4YHOL 4QAMB 3MROA 1JV2A 2AEWA 4UDTA 2ZKYA 3GS7A 4I0PD 2NR6A 1YYCA 2VR8A 3BRFA 4NUGH 3RPKA 2DB8A 4D0BB 4QUOA 1OTTD 5F7EH 1KDJA 1IBGL 3N2JA 2YPVH 1J8HE 1OGTB 3RTQA 4FQJH 3VFSB 5MHSD 2R0KL 3FRUA 2Y2YA 2XCMC 3TC9A 1SMOA 1UYWH 1ZGLM 3MV11 4AUYA 6FABL 5CIPB 1F1AA 2IBBA 4OIBA 1J0ZA 4YSDA 2WZPA 3FF8A 5DJYA 2EINB 1B9ZA 1U8JA 1EGJL 5HHME 2FJUB 3KCPB 3AU1B 1GTNA 3EZJB 3F5WA 2DKUA 4K07A 5D1QA 4P04A 3IDMB 1S7RB 3EUUA 2F8XC 3G08A 1IBBA 3AAZA 5KVEL 4HUXB 4E9WA 1MQKH 4Z3TA 5EU7E 4FXKA 2YFOA 1K4CA 2ZONA 4JDEA 4RNRB 4LQFH 1UCBH 4NQEE 3VFOA 1X5FA 4X5RA 4XO3A 4ZK8A 2PPAA 4A63A 2APBA 1NCTA 3PLYA 4GIOA 4F2FA 1MH5B 1AGEB 4HFUH 3RG1C 3I9GH 4HZLA 4XC3L 2F0CA 5DFVD 4FFWD 1HOEA 1T1XB 4HUKB 1SJMA 4JFHE 4CVXA 2WXFA 4XMXA 4APQA 4CU8A 3PXJA 2BP8A 3DSNA 2X0UA 4FI6A 2CHDA 4L8SC 4LPVA 4TVPE 3Q05A 4X50A 3REWB 1DQQA 4K4KA 4AYGA 3TXAA 4QRRA 4A2FA 3IK2A 3IU4L 1UUSA 3U9PH 2CXKA 4WO4C 4ZUWB 2GI0A 2R1WA 3JWOC 3S88H 1FNFA 2DIJA 2BSRB 4U4BA 5IJKA 1M1XB 4YXHH 2Z64C 2APFA 4MHHI 3JZYA 2IQAA 1FFOA 2AJXH 1YPZB 3BKYL 1HH6B 4GRLB 4Z5RB 1H9DA 3JTSA 2BNQE 3RUGA 5F7NC 3LQZB 3ZXAC 3ULVD 2YIHA 4XPBH 4P46A 1GKEA 4ORGA 4XE0A 4Y4FA 2F7RA 1UOKA 4ZTEA 1G7IA 1TU2A 1E0OB 2WC7A 5EBGA 1AQHA 4J2QA 3NAAH 4XMZA 4AL8C 3OJDB 1FNEA 3GXIA 5IMKB 4LKXB 2DMBA 4GY4A 3TIDB 1P9MC 2E7BA 3D6GA 4AL8L 4N86A 4PRPB 1UFGA 3KWUA 5LNEA 2OTUA 4G72B 3F58L 4ATWA 1EO5A 3HS0C 2FJGB 5HHNA 3QUYB 4JUSA 3SDCA 3UYPA 2R2HB 1MCCA 3GMPB 4M4RB 4NO5A 3TGXA 1F11B 3UJJL 5D2NC 1HK6A 3GO1H 1E9PA 5FS5A 2OK0H 2DAVA 1CDJA 1F4YH 1AZRA 3BWAB 4Z7WB 5E0FA 3VSTA 4MA3A 4J8RA 4PB0H 5D7JB 2ZSWA 3T65B 4ZTOH 4UIKH 4X4XB 3AGWA 3SKMB 3DMMB 5EO9A 5AVYB 3RVVC 1WZKA 4GXVL 3WXVL 1DE4A 5IUCA 1S7SB 3GB7A 4TSCH 4JY4A 5AYQA 4BSWA 1WUZA 2BW4A 2JCWA 3FS9A 1KEMH 3JVGC 4MBRA 4PGEB 2DYPB 3IXAB 3IGFA 4BUQA 3M17B 5EOQL 3KGSA 4ZOBA 5C0IB 1U92A 3FB7B 4OD3H 3NCEB 5DUBB 4X8JB 4Y1AA 1Z9PA 1FYTD 3T6XA 2YUWA 3H9HB 4EN3C 5B4MC 4NUMA 5CHNB 2IAMB 1IGFH 3QXDA 3VYOA 1T2QL 4GBXB 4AJVA 2PR9A 3DGGA 4OD2A 4PREB 1BREA 4Y7OC 5TDPA 4W81A 1TO5A 2ITDA 2J8UB 2VN6A 2HJFB 3MLUH 4IW4C 4XMWA 3N1FC 1WCBA 2BO0A 3NJGA 4BFGA 1G43A 3GXDA 2IBGA 2CSPA 3ZKQD 4KK6C 4F9PC 5KANG 3B6SB 4HJSA 4P23B 4Y8AA 2E76C 2WWNA 4ODVH 4OJFL 1JWUA 2H2PC 3ZKMC 3O6KL 3QDJB 4ZUUB 43CAB 3DHPA 3GMQB 1NUNB 1QACA 2ZOWA 5AZ2L 3ZHKA 3B3BA 2QZ5A 2R9HD 2GIYA 4RMVA 3M1BB 3CGTA 4PU2A 2ESVE 4ZSOB 2DQCL 1IM3A 4H1LA 4NQSB 4QLWA 3FC8A 3NZUA 3TCLA 2GUOA 3RPIA 1NGQH 2V6HA 3TN0C 2PW2B 2R15A 1ZHKA 1EEZA 1AZVA 3QP3A 3Q7JA 3ES6A 4XNZC 4PP2B 4R2GB 2G0LA 5SX5K 3UJIH 5MEOB 2VDMB 3CE1A 1U95B 2R0WH 5DHMC 4GMSL 3HRZC 3KWTA 1ZANH 2WCGA 2XOTA 5HDBF 4X7FC 3TLRA 4A7TA 5CCJA 5IIEA 5M7QA 1A6VH 5K39B 4YSAA 1T5XA 5BZDA 1NL0L 4KTDH 2V8LA 1VPOL 2HAZA 2X70A 1J8KA 1G6RH 4X5WB 2F8VA 5I1AB 3MBWB 1RJZB 3V4VA 3JTTA 4HC1H 3AVEA 3MJ9L 4UQ3A 4J3OF 2MEJB 4ENED 1TJXA 4NZJA 1VFBA 4AYFB 5JPNA 4KOBA 3GXNA 3EH1A 1NCIA 2OS7A 5TF1L 4QTIH 4P2RB 3JTBA 1T2JA 1B90A 4YC2B 5DS8A 5IVNA 1U91B 1NCNA 3RWGA 4Z7UF 2XWTB 5HSFA 2VL5B 3WMQA 2FR4A 4YDKL 5FLVA 3MN8A 1F3DH 3X17A 4I88A 3COOA 4Z78A 5SWSA 5AB2A 3MO1A 3NIFB 3VWKB 4XCCL 4YHPA 1NGYA 3L1GA 3DI3B 1PZSA 3GM0A 1ZV9A 2ATPA 4J6RL 1JOIA 3X11B 3FQ2A 5DJCA 2CLRB 5I8CA 1LYQA 1A6WH 2V5TA 4X7CC 4KRNA 1AZCA 1PKQB 4EPSA 1SHSA 4QCIA 3RLSA 1CFBA 3VA6A 1OY3B 1PG7W 4BSJA 3GSUA 4M6OH 1HNYA 4CVZB 4H0LC 3GSOB 5JMOC 3MJ6A 4OCXH 1QVOA 3P73B 3OAZH 3S5YA 3OPZL 2BP0A 2DLHA 4PGJA 2A77H 4L4VD 1AZBA 4JG1H 1YZZA 4QO1B 3D08A 2VXTH 3EO0B 1OVZA 3H9SE 4X7SH 4Z7QE 5C0BD 4FCHA 4LCCB 2KUTA 1JK8A 2XNAB 1K8DA 5DD5L 2AJUL 1HDMB 1JGEB 5ACMA 1QZNA 3H0TB 1P4LA 3B7TA 4KO7A 5I6OA 1CICD 1JTOA 1LE5B 1EEYA 1GPOH 2DBLH 2V7NB 3JSSA 3LEXB 4HWBH 1BCIA 4ZS7H 3WFEH 1FIGH 3QQDB 2VABA 2WXQA 3NCJL 2PCXA 4P2CG 2K45A 3U4EB 1L9OA 4ANXA 1AC6A 5IBLD 1B0GB 1RZFH 1XEUA 1JV5A 3Q8BA 1A7BA 1L0QA 3KBEA 3GHBL 5GXBB 2VDOH 1EUUA 5HVWA 4Y5VC 5KVGH 2NY5H 4LHUG 4JCMA 3L95B 1T7ZA 4F91B 1FPTH 2WQ8A 1UADC 4IM8A 2IDSA 5D2LF 3V6FA 3B2XA 3QUZB 4JGMA 1KEGH 2Z1PA 4GG6F 1NJ9A 2VAAB 2VLKD 5T1JA 2B59A 1KIQA 1NM9A 1TVHA 2LU7A 5DVPA 1ZLEA 3KBPA 5AOLA 1N5YL 4LFHD 3V4PA 4D9LL 3LH8A 3QRLA 5A16B 1BZQK 2HT4D 4FADA 5I71C 2EDHA 4NQDB 2VN5A 3PWVA 4I9WD 5BS0A 2CHXA 3HE6C 3QEUB 1LO4H 4L4TD 2ZPKL 3QFDB 1S7WA 3HAEB 4Z95L 3JV6A 1A3RL 2C4FU 4NLHA 1TZGL 2YEQA 5L2KA 3MRPA 1ODAA 5DRWA 1ZJBA 2FH8A 4XVOA 2VDPB 4GI8A 2DIBA 4YSCA 4RDBA 2FQEA 3PAVA 4UTBA 4MB3A 3IKCB 4GP5B 3HI5H 1YMMB 3I6SA 2VNCA 4PJAF 2OXHA 1QQDA 3WEOA 4HCRL 5TDNB 3C5JA 4LDOB 1T7YA 2BZCA 2CXGA 4JDTL 2DMHA 3H55A 4F5CE 2PYEE 1OF2B 4QF1B 4PJ9B 1X4ZA 2AV7B 2OR7A 3I6KA 5HVFB 5EIIG 2WNWA 3ZDXF 3EDJA 2BVYA 2CO6B 4GQRA 1A47A 2EABA 2H26B 4JFQA 4RIRA 1KJMB 1QTSA 4NN7B 4NKDB 1E9QB 1TTGA 2IWGA 4QGTA 5G4MA 4WWPA 3HNSL 2V0AA 4B9IA 5BVJA 1AO7B 1RIUL 4YO0A 2XQBH 1OAQL 4K5LA 4FA8A 4YQXL 5LGHL 3CZGA 2PETA 1HOCB 1MDTA 1UWXH 2WLIA 3O3EA 4LGSB 1OGAB 4TNWK 3G7TA 4NO2A 4ZFZA 2IAAC 2P7TB 3OAYK 3ZE0F 1GZHA 4WW2A 4KGJA 1MFAH 1Z2KA 4OVUA 5C7XL 3RY6A 4HCGA 1CYWA 3UXFA 4ZD3L 4K7FB 4U4IA 4D0BA 2WBXA 4TQEH 1DTUA 4I3SL 1A7PH 1OGTA 3VXRD 4Q0XL 1KBBA 3VFSA 4HV8B 2BS9A 2H4EA 2NY2C 2KZBA 3ASNB 1GHFL 1JGUH 5EA0L 4GRMB 4PG2A 3I50L 3TV8A 3HCVB 1A4CA 5CIPA 5E2TL 5LUMA 5C0CB 5F1IB 3HR5B 4D0CB 1NAKH 2C34A 1CGXA 4AQ8A 4MMZC 1SDAB 1RPKA 3I2CH 5FOJA 2N7BA 4FI8A 4JFXA 1P5VB 2AK1H 3KCPA 4WFED 2X1WL 2X42A 1QI4A 2WNXA 5A2BA 3IDMA 1S7RA 3SQOH 3OV6A 4TPRH 5CP7A 5ABAA 1NWOA 1VJSA 4HUXA 1K3IA 3C09C 5IT2L 5E99H 4K94C 3QPXL 4RNRA 1IGJB 4GH7B 1CVRA 4BFBD 3AB0C 3NPZB 3T3MF 1WFTA 2HT2C 2Z0UA 2OXGB 1U8HB 3QEGL 5JOFB 4NUJB 3RWJB 3WTWA 1BFTA 3I75B 1MH5A 1AGEA 1NIDA 2IFFL 4IGBC 4JPSA 2HRHA 3MCYA 1BF2A 1GR7A 2WV3A 3KYKH 4KQ3L 4LSRL 1T1XA 2E0PA 2MNWA 3B37A 4FXGB 1VFAB 1QNZL 2XXFA 3PG2A 1M71A 4NKOA 4LEEA 3ZDWA 2BSSB 3ARWA 3REWA 2PYFB 1DJWA 2MCAA 2CPUA 2XICA 2WQWA 2D3JA 2OP4H 3BGAA 3GXUB 4LPTA 4BA0A 1B9KA 2KHAA 3LD8C 4ZUWA 2X9YA 2R2CA 3GLDA 1N9PA 1KSRA 2BSRA 3CFNA 3O8XB 5CCKL 3X14B 4OQTL 5IJBC 3BKMH 5F89B 3IFLH 2O61B 2RIKA 3CFEB 3KDPB 3CDZB 3ZDYF 1ZLSL 1YPZA 1HH6A 2J8HA 4GRLA 4Z5RA 1ZLDA 2X05A 5B3JF 2PP9A 3CVBA 3S4SB 3TA3B 5B4MD 2ENQA 5EFIB 1WYJA 4XT1C 2XWJB 4O2EB 3TV3H 4DK6A 5IMOB 2WO2B 4MJ6B 3MACL 3D25A 1EBPA 5DFAA 5KTEH 1W0VB 3OJDA 4DGVL 2DQJH 5GSRB 4OCWH 4OLWH 5IMKA 1GOGA 4G9FD 3VXNB 1SUHA 4PRPA 4NAMA 5ESVB 4C56B 4KX9A 3ZRSA 3C08L 1B4JH 2FJGA 2ILLA 3QUYA 2ITCB 2Y5QA 3N85L 4JKNA 1L5GB 4L18A 4O02L 1NDMB 3ZKMD 2R2HA 2Q3AA 3GMPA 1BIHA 1F11A 4U6TA 4L3FA 2X4RB 4EI5C 1OARL 4HJGB 3VH8B 1GCYA 5T33H 4J1UB 3WJMB 1DSFH 5DD0H 2YXWA 4ZMNA 1AIZA 3BWAA 4Z7WA 2Q86B 2EXSA 3FHEA 4EQ2A 5D7JA 4S10A 3T65A 1KCRH 1RFDH 1PX4A 2K3HA 2NQ3A 2CK0L 2H9GB 3CZJA 4X4XA 4N5EC 1J12A 4XP5L 4PJDF 3DMMA 4G6KH 4UT6A 1S7SA 1BZEA 1I9RH 4PGEA 4GLRI 2DYPA 3IXAA 4P9MH 1R3LB 5C0IA 3FB7A 3LQAC 4U0RC 1WD9A 1W2KT 5DUBA 3GC3A 2YOCA 4X8JA 3QNZB 1U2YA 3MLYL 1X5HA 3UBXB 2X12A 4OF7A 5KBMA 1JXFA 3DIVA 2A9BA 3F85A 1F58L 1BZOA 3L3GB 4NQUA 1BAWA 5CHNA 5D1XE 4ZBJA 5J0BA 1NTDA 1DQDH 2C9UA 1WFIA 3SKJH 4GBXA 4PREA 5C6TL 1V7MH 1U21A 2WIMA 1EXUA 4X6CB 2EEDA 3EGDA 4YBQC 2OR9H 1XWVA 2HJFA 4ISVB 1A3QA 4LVNB 4AEIH 4W9KC 5DUML 15C8H 4Y2OA 2B1HL 1QSFD 3T2NL 3JV5A 2MTPA 2XTJC 4DSYA 3B6SA 4P23A 1T0NA 3SCMB 1U8QB 1AMYA 4P2QE 4ZUUA 3QDJA 43CAA 1E4HA 3GMQA 3FTVA 4OCNC 5IW6B 2ADGB 3M1BA 4XPGL 4WVRA 1RU9L 2VR7A 4HISA 5FUCC 4ZSOA 1BAFH 3ZYZA 2ZXAA 4NQSA 4NN5B 5EZJB 1OAUH 2Z92B 4WUUB 4WY7H 1LE9B 3FN0L 1FN4B 1PKOA 2ERJC 3NFSH 3O3BA 2OLDA 1KN4H 4DKFL 3D39D 3B3IA 4WFGD 1LO2H 5FF6A 2EEXA 2CJUH 5FFLA 3AS3A 2YGQA 2LW3A 3CZKA 2F74B 3MBXH 4K9JA 4PP2A 4UQAA 5IB4B 5KJ7E 5MEOA 2EDRA 1U95A 5I1EH 5H35B 3MRLB 5K39A 2DM2A 2DL9A 3FUNA 1WIOA 1XGYH 3DX3A 4AMKL 1V8HA 1Y18B 3HS8A 2F7OA 4X5WA 5I1AA 3MBWA 1GC1C 1RJZA 1OD7A 3DSFL 1P7QB 1IZKA 5FGSA 1OSZA 4XXWA 3GPEA 5IJCC 3HC3L 1XH3B 5J11C 4ZFOB 4AYFA 2OL3L 5JIPA 5AW0B 3U1SH 1HSAB 4UOZA 4AM0B 4P2RA 1P1ZB 3RNKB 3QAZC 2Q8BH 1A5FL 3UACA 5DEFB 1QYGH 1U91A 2XWTA 2VL5A 3QWNA 4YXKH 1A25A 5E2UL 3L13A 4LSPL 2NXZC 6PAZA 4HLEA 1KCBA 1CQYA 1A6PA 1WF5A 3V0HA 2DI9A 4BFKA 3TPKA 5I73C 3VWKA 3D4GA 4NGHL 3ABZA 3ARTA 3HE6D 3OHMB 2OPCA 2A83B 4FQCH 3X11A 1TTUA 1GY2A 1ZXQA 3OPUA 4GW4A 2GQHA 2CLRA 4GAYA 4LVOB 3X2QB 1GW6A 3ATAA 1PKQA 2EYRB 3HZKB 1QLRB 4U1MB 2WKOF 3VFWB 3A4FA 4YBLC 3HMXL 4KKRA 4XO8A 1YAIA 4B3EA 4JQIH 4CJ0A 4ZMVA 4CVZA 5CFAA 3GSOA 3ZO9A 3P73A 1MFUA 3FTUA 2L7JA 4KAQH 1NCBH 1FG9C 1X5GA 4N2LA 4OF3A 2H3KA 3RTQC 4KKBC 1BD2B 4QO1A 3EO0A 5K9OB 1KV3A 1A6UL 4LCCA 2XNAA 1FNSL 4JDZB 1Q8MA 2IGTA 1HDMA 2NSMA 1JGEA 3FRPB 3QWRA 3H0TA 4MJIE 5LLIC 1G7PB 1UJTA 3AG3B 2ARJQ 5I74B 1LE5A 5C0GB 1TT6A 2V7NA 4LNVA 3LEXA 3RU8L 4S1SL 1AFVL 4YFLF 4NYLB 3QQDA 2DQUH 3U4EA 2XZQL 1TQBB 2GCYA 1B0GA 1WAAE 1J8HB 5DJ6B 4NPKA 4JHWL 4Z7VE 5D1QC 4XMPH 4AV0A 3L4XA 3ARGA 3AM8A 3TZVD 3IWUA 3L95A 4N85A 1BGXL 3GT6A 3K46A 1WFNA 4MA7H 3QUZA 3GBMH 4FXKC 4U05A 5CKAA 2VAAA 3BSHA 4A2EA 2NY2D 5CSZB 1C7TA 3GMMB 5A16A 3HOGA 4OM1L 2ZUTA 3CLEH 2CHWA 4QHLB 1P4IH 4MCMA 3GTNA 2JCCB 4NQDA 1F6FB 4JO3L 5AOIA 3QEUA 3EFDL 3QFDA 4L0YA 5GGQH 1JGIA 3EO9L 5IB3B 1UD8A 2F1AA 4PS3A 1URLA 4TSAL 3HA0A 1O7VA 3MCLH 3OM3B 4KROB 1D6VH 4PJCE 3ZMNA 4APQC 5CLXA 1KYOK 3ZTNL 3IMUA 1KGWA 4K23L 4DQAA 3LHAA 4NQEB 4UAOC 3DO3A 1KACB 3IKCA 4HCFA 2PPCA 1NUGA 3TT3L 1YMMA 1OLLA 4HKZB 4Y5YB 1J1PH 1JWMA 5TDNA 5IROD 4Z7IA 5I0ZA 1OPGH 3ZT7A 3F6LA 3PQYA 2J2ZB 1LO3H 4MJ5B 4JREB 4QF1A 5LQBL 4PJ9A 2AV7A 2DOCA 1UM5H 5IJKC 3NSYA 4RWYL 2QDVA 2CO6A 4IGBD 1MIML 4X8CA 2H26A 1KJMA 3ZVVA 3NJIA 4NKDA 1E9QA 2CGRH 2EILB 2DLEA 4OCSH 4AQAA 4Y4HB 1AO7A 4PCKA 1FYHB 2WGNB 4KUCD 3QJOA 1E28B 2H5UA 1AACA 4QHKI 1HOCA 4PB9H 1OGAA 2JVUA 3I3BA 3NCXA 3QIWB 1F4WH 4WZ9A 2P7TA 1JZ2A 4P46C 3NCWA 5A2LH 4Y4FC 5DJAB 3PGFL 3K80A 4A1RA 1UG9A 4HBQA 3KS0J 2NZ9C 4HC1A 4K3EH 5EZIL 1FSKC 2JQZA 3S36L 3SY0A 5DD3L 4HV8A 2B39A 5JYMA 1EVUA 3HVNA 3N6YA 4P48A 3N55A 3LYRA 4GRMA 5KVDL 1DL7L 2DEYX 1I1YA 3HCVA 2H8PB 4OZHE 5AW7B 5KBPA 5C0CA 1IC4L 5F1IA 3HR5A 1F2QA 2KYIA 4D0CA 1CE1L 1CURA 5FHAL 2OTWB 3ATFA 3EFOB 2O93L 1N6UA 1RVFH 4JDVB 4Z6AT 1A9EA 2DH3A 1P5VA 4L1LA 4RMTA 4HU8A 1JYNA 3FQYA 4OLZH 1S7QB 3MGOB 1G9ML 2X88A 3QORC 2VC2B 1WZLA 4X80H 2BWDA 2OW6A 5L7XL 4NRYB 1TJIL 1JE6A 1NIEA 1IGJA 3RIAK 1CLVA 3U7AA 4ADIA 2VZ1A 1NOLA 3ZIMA 1I31A 4PGDB 2MKLC 3RIFK 2OXGA 3KR3H 1U8HA 1M53A 1PIGA 5JOFA 4IOIB 4NUJA 3RWJA 3I75A 3FCTA 4F7TB 4JE4B 1U4EA 4WHYG 5DJDB 5FYJH 4G8FB 2CZNA 3ZE1B 3I6LD 2WXGA 5C3LD 4K3JL 2OKMA 3CHRA 4EI5D 1VFAA 1LDSA 3NJKA 4KKCC 4N9OB 2YD6A 1FZOB 1T21B 1XGPB 3KM1A 3OZ9L 4PJHF 3NACH 2PYFA 5DVLA 4QRPE 3BUIA 3FZUD 1HAUA 1AD0B 5GQBA 3PS6A 1AMXA 4JKMA 1CLZL 1JXKA 4N5ED 3UAFA 5DWPA 4W9ZA 4L0PB 4DKTA 2JH2A 5EEVA 2KPWA 1EFXB 1VEMA 4MFHA 2DQGH 2Y24A 2OYMA 3O8XA 5I8KH 3X14A 2G4EA 4B7LA 2X7LB 4G7YH 1H6TA 4IMLB 2X4SB 4DHLA 1JPTL 4S1DC 1AG0A 1IJNA 4OUOA 3AQXA 2QTVA 3CFEA 3CDZA 3MJ8B 4PW9A 4FMKA 5ADOH 4FFZA 3FPYA 2VWEC 4E9SA 3TA3A 3ARDB 3F7PC 4XTRC 3NBNA 5EFIA 1AP2A 2VXVL 1DLFL 2QSCL 3AW5A 3O0RL 2W5PA 2XWJA 4O2EA 5IMOA 5F70A 5C9JB 3LNFA 3WFHB 4GKSA 4M7LL 3FAWA 4MJ6A 3D69B 1JGLL 4FDWA 3PHQB 4YBQD 4U2ZA 3U30C 3RFZB 3CH8A 3S8WA 2BINA 4KXCA 2EXWC 4CC1A 5GSRA 3IE9A 3ZHFA 5LO7A 1M1SA 3VXNA 1KJ3L 2X4PB 2ESVB 5ESVA 4C56A 2XTJD 2DKMA 2DQFB 2G5BB 2J7LA 3SJVD 5L6YH 3EF4A 1N2RA 2QPUA 1L5GA 2YKLH 2ITCA 3L5IA 3CUPB 4PH8A 3WNKA 5EMYA 1RJLB 4LCUB 3AS2A 4F20A 4UT9H 1NDMA 3RX5A 4NHCL 1PSKH 4OGQC 4X7DC 3SE9L 3FSVA 3U82B 4K3HA 2X4RA 1KYFA 4HJGA 3BZFA 3VH8A 3L9YA 3HZYB 4J1UA 3C60B 4BYHA 3OQ3B 3PP3H 3NIDF 3V4VL 3DNKA 3DX2A 3O2VL 2XJLA 4U1LB 2Q86A 3QFJA 5JPNC 3UOAB 4PY8J 3BPLB 1UACL 1YO4A 2H9GA 1FIEA 4YUEH 4PJ5D 3CXHJ 2X28A 1JWSB 1I7UB 5HD8C 4ZW3A 5DMYA 5IFAH 4XMTA 3SE8L 5LGJB 3DJZA 3L2NA 1BVNP 4LARH 1D9KD 5CZXC 1YEWA 2E27H 3K3QA 4Y88A 2OZNA 1R3LA 1PBYA 1C5BH 4KK5C 3KZ8A 3VFMB 2VW7A 3DURB 5AVUB 1IAIM 5F2FA 1WFOA 2QPDB 1KFAH 3QNZA 1GOHA 1VEPA 2KLRA 3UBXA 3AWGA 3L3GA 1TJGH 3PWPE 4GQPH 5CGTA 3W37A 2EDWA 1I8KB 3EBGA 5E6RB 2WTPA 3DK2A 1GVIA 2DMKA 3G3LA 5K9KB 3QHZH 4LOFA 4X6CA 3NJVA 4DW2L 3FQRB 3OG4B 4ISVA 1GGTA 3C5ZB 1FFTB 3L4UA 5D70L 5LBSA 2YSSB 4NCDA 3QJTB 1BQLL 5BRPA 5A1AA 2NXZD 4HJJL 3CHPA 4KDTA 2UX7A 5DZ9A 1QO3B 3VGAC 2P5WB 4CN1A 4Z3HA 3SCMA 4ACPA 1U8QA 5CN1A 1TFPA 4PJEF 3U4BH 1OWRM 3CZSA 3ATDA 3KPQB 5IW6A 3UTTE 2DPKA 5IQ7L 5FAAA 4MXQC 4JFWA 4XX5A 5F9OL 3IDGB 4Y9CA 1H5BC 4PWKA 3TEXA 5EZJA 2Z92A 2P3YA 4WUUA 1VF5C 1LE9A 1FN4A 5EU4B 1T22B 1UD5A 3H9SB 4MNGA 5HYFA 4P5TB 4Z7QB 4JS7A 3AJ7A 2DWTA 5I6NA 1ZTXH 1OHQA 2NR6D 4Q2ZB 3OSKA 2GUYA 1MHPH 2FBRA 4LVHB 4PJ7E 3ZJAA 2HWZH 2F74A 4RZKA 2E9JA 5IB4A 5JA9A 4JRXE 4B60A 1MAMH 4NLAA 3BIAX 2HRPL 4LCIH 3RTQD 4KKBD 3OLIA 3D85B 2C7FA 4IMKA 5ALBH 4AKQA 4LASH 4DP4X 1E3ZA 2PO6B 5H35A 3MRLA 1Z3GH 2B1AH 1XIWB 1MI5E 3V4PL 1Y18A 1QBMH 2WZPD 5BO1H 1P7QA 3L3HB 5TH2B 3LSOA 2V5SA 4M48H 4ZFOA 5D72L 1X6LA 3FFCE 1FFRA 3NTCH 2E8ZA 4HPYH 1HSAA 3VMPA 5D1QD 3BLKA 1QEWB 3ULSB 4AM0A 4BA8A 4CBZA 2I60L 2TSBA 3RNKA 2YRPA 3VVVA 3TYGL 5C86A 4UTBL 2AI0L 1HIML 5DEFA 1ITCA 3ZTJH 3Q1SL 2GW5A 3GXPA 4N0CD 2A6JB 4DN3H 1RK1B 2OSLB 3FW6A 4OGYH 5K59F 3QDAA 4PPTA 3ZZQA 1F2XK 1BJ1J 3FFDB 2F8OA 2XWCA 5E5MB 5J5EA 5PCYA 4PJGF 2ED8A 2DLFH 3MOAH 5HI4C 4FFYA 2A3TA 4LCYB 1MWOA 4CU6A 4APQD 1VESA 1NKGA 1QLRA 2RQ8A 3HZKA 4U1MA 3ZT5A 4EUPG 1OT2A 2IADB 1XF3B 4HJ0D 2MPAL 4UILH 4B9JA 1MQ8A 4UYPA 2BOCB 4QRRD 3G5YB 4N2NA 4RBPK 1LDPH 1ZDQA 2A9CA 3PJLA 4FI7A 4R7VA 3OQRA 4YHKL 2PNDA 2VDLH 1BD2A 4AZUA 4I1RA 4PLKC 5K9OA 4PVBA 4JDZA 3NABL 3RVWC 1J87A 4UV4L 3Q13A 1G7PA 1SF5A 3EBAA 4BFFA 2ALAA 5AQ0A 1R3KB 2WLLB 5JOPD 2FEEL 1ODUA 3WS3B 4NYLA 4TVUA 1L3NA 3GSWB 1DJZA 3VI3E 2VZVA 2BDNH 3ZO0A 2CRMA 1JTTA 1J8HA 1UHVA 3LNHA 2VR6A 1U8KB 5DJ6A 2GTWB 5DT1H 4P46D 1OO2A 2DQ6A 4Y4FD 1JPFB 4P3CL 3QBTB 3CFMA 1D6EB 3DI2B 3FOLA 2NZ9D 2PPFA 5B22A 3WGUB 5BNXD 5G2NA 3UFIA 4PTTB 3HZ3A 3GMMA 1T6WA 2DQHH 5DVNA 2D31B 2IG2L 2VZOA 4LPUA 3JT0A 4QHLA 3D9AL 1AKJB 3SDCD 1N6QL 4LBAA 3BT2H 3NPSB 3SDAB 4M43L 5GHWH 5IB3A 3NZ8B 5CP3H 1BFVH 2BVTA 2DL2A 2XVBA 4ZRGA 4X7TA 3TO4B 1A14L 4RX4A 2VM4A 1TLMA 4NQEA 2K6WA 4ACTA 4AKOA 1FGNH 3I3DA 1TSHA 3HBPA 3MUY1 1CXIA 4Y5YA 2XJKA 3FH5A 1YNLH 2DQMA 4KZEL 4NZFA 3V7AE 2J2ZA 4MJ5A 2FAUA 4ZOAA 5IQMA 5JUEL 5CCHE 5HPMB 1E2VA 5HJGA 1B0IA 4OZFG 4WI0B 4HDIB 4C58B 1T6VN 2R0ZH 1HI6B 2I69A 4PY8I 2ZAHA 3OJVC 4NB7A 2XQ0A 3W38A 2V33A 4XAKE 4NI3A 3B7UX 2FUQA 3H4FA 2WJ7A 4Y4HA 1ZLWH 1WA2X 1BVNT 4HMCA 1HL4A 4P5SA 4Y1AD 1XAUA 3TASA 4IQHA 4DTGL 4KKCD 1LEGB 4GRLC 4UWQB 5CGMA 1ZGLP 4ZFFB 4CKVX 5I2IB 3ZW3A 2HYMA 3Q9PA 3QIWA 1R34A 2IWKA 4TRPL 2B4CH 4XCFL 1YCSA 2AFNA 4G3YL 3K1DA 4K5PA 4LLWB 1A7NL 3DOSB 3L3OB 5DJAA 1OTUC 1PYWA 1DANT 4S1RL 1FH5L 2V2XA 2VE6B 3AY4C 4GLRH 4OLYH 5IEKB 1ET5A 1A1OB 4LSSH 1RZJH 3FB6B 4YLQT 2QGCA 3K6NA 2CKNA 1TYRA 5BRQA 1M05B 2BNQA 5B1JA 1YQ2A 3BESR 1S3KL 4GOSA 3SO5A 1OP5K 4GSRA 4RFOH 4KRPD 4S1DD 1LEKB 3QUYC 1RUQL 4D9RE 4MBOA 1L7IH 1RZ7L 3RVTD 5IUSA 4LSVH 4ANKA 1T0MB 3EFOA 2IWEA 3MKKA 1CR9L 5FCUH 1S6NA 2EO9A 4P5RA 4Q9CA 4MVBD 4XTRD 1SLVA 2XZZA 3BUYB 4G8GE 3UIYA 1JGDB 1M7IB 1ZA3A 5BMFL 1S7QA 4KFMA 3MGOA 3VRLF 1RUAL 4ELMB 4NRYA 4QRAA 1BBDL 5D7JC 4U6XB 1YEJH 4NP9A 4QRFA 2EXWD 3U25A 2ETWA 1AHWB 4GRWF 2X40A 4PGDA 5FK9B 2APSA 4K15A 1H6EA 5EV7A 4IOIA 3H8NA 5DJDA 5BUGA 4P59H 4MAUL 5BJTB 4G8FA 3MXVL 3GK8L 3N42F 5J6GB 1CG9B 4RA3A 2K3TA 2YBGA 1Q1JH 3GQFA 4WHTB 3SPHA 3EFFB 3H9ZA 4Z0BH 4WJKB 5DTFA 3VSQA 2GK2A 4DETA 2VDLB 1FZOA 1T21A 4B9CA 1XGPA 2IAMC 3BWSA 4FQJL 4K5NA 3FK3A 4JO4L 1AD0A 2PCPB 2YD7A 4QGYA 2D2CC 5C1MB 8CGTA 3FMGL 3T0XA 3GBEA 2YAQA 5H8DA 4L4JA 2QGEA 3GBNH 3LV3B 1EFXA 4KI5F 3UC2A 3PXLA 4OT1H 4DOHE 1S7VB 3HB3D 3V5DB 2X7LA 2VLME 2B3IA 2DJSA 4IMLA 2X4SA 5CZXD 5D1XB 5SWSD 4P23C 1DP0A 4KK5D 1CLYH 1GTFA 4DP7X 3LN4B 4JB9L 8FABB 4TKWA 1MCRA 4OGXH 1E42A 2AW2A 3M45A 4J3UA 3ARDA 4ODTL 1FNAA 1MQKL 5LJYH 1GYAA 2GSGB 5C9JA 3WFHA 2GVYA 5GRYA 1YVLA 2XQYG 3D69A 3R18A 4Z7UE 1CI3M 4UV7H 3PHQA 3A3YB 3BYTA 3RFZA 2AAVA 2A2QT 2WZ0A 5DHYB 4P2QB 3FO1B 1AQMA 2NY6B 1CD9B 4LK4A 4R2GC 5DQDL 4LLVB 4HMDA 1HAWA 1IEHA 2X4PA 2ESVA 2DQFA 2G5BA 2VDML 1WBYB 2X5PA 3CUPA 1RJLA 4LCUA 2EYSA 2EDDA 4QXGH 1WBXB 4FEMA 2JKWA 1EJOH 4WWKA 3ZOAA 4P2OC 1H15B 4MXQD 3KL5A 3G6DH 3HZYA 3C60A 4OSUL 4XXWC 5GS0H 4Z8FH 3U9PL 3J7HA 4U1LA 43C9B 1JK9B 1H6FA 3S88L 1DQKA 5ISZB 5IK3B 1OXYA 4YXHL 4A68A 5F3BB 1PNCA 4YC2C 3VXME 1AOZA 2F19H 4I13B 1JWSA 1I7UA 2AJXL 4OVVA 3OHXB 5B1BB 1ETZB 3DDFA 5DI8B 3SKNB 2RCSH 4WW2F 4ZAKB 5LGJA 1UC6A 2ADYA 1QSEE 4KJPC 4BCZA 2G60H 3AGVA 2NT1A 4K9EC 3WUWG 1GSMA 2CDEB 1OV8A 4HIEB 1BW8A 4LSUL 1LQSR 3VFMA 3VWKC 4D8OA 3DURA 3U7YH 4AI7A 4FXLA 3EYVB 5FDWB 2ZG2A 1AS6A 4NIKB 1AI1H 5L2KD 3NAAL 1R33A 3CN1A 5HDRA 4ONGH 4J8QA 4PWGA 2ZOOA 3IJ8A 5D2LE 3U46B 5K9KA 5KJRL 1KELH 3FQRA 3QPQD 3QNFA 3C5ZA 1QBLH 3QWQB 5CEZD 1CE6A 1JCKA 2ZYSA 4PJIB 1XF2A 2YSSA 3LKRA 4WEBH 4PRHE 4KZDL 5EC2B 1KIPA 5DJ2B 2Y23A 4HOWA 1ZOXA 3GO1L 3IMBA 1V3MA 3BVNB 4Q9BA 1QO3A 5K5YA 2OK0L 3R0MA 4LCCC 5L4FA 4MZ3A 1CVSC 4JZJA 3DX1A 2HLEB 4FFTA 5HDOA 4PB0L 3KPQA 1QOKA 4PJXF 2EIBA 4UIKL 1M3JA 3GDBA 1NBCA 3IDGA 2GTQA 3CLFH 5EOCJ 3PUCA 3CG8A 4TSCL 1FG2B 1KB3A 1WTGT 3P9MB 5EU4A 1KEML 3H9SA 3W11C 4P5TA 2HRGA 4WJ5B 3PWUB 4PJFE 3CN4A 4Q2ZA 3S5LB 4XB8A 3AM8C 4MJIB 1YQVH 2H0JA 2WUBL 4N8VG 4V33A 4TYUA 4CBPA 4OD3L 2AQQA 3BWUF 3QUZC 2CK2A 3D85A 1B2WH 4C4BA 4PLKD 3DARA 3OB0H 3DRQB 2PO6A 2ZOKA 4LAQH 1ZVNA 3RVWD 2JJWA 4G6FB 4OI8A 1XIWA 4JKLA 1ZE3H 1IGFL 2UX6A 3QC6X 3NZHL 1ETB1 4MB1A 3ZUNC 2W94A 4M3HA 4X6DF 3VSVA 3L3HA 2A4EA 1T7XA 2IGFL 5DK0B 7CGTA 5TH2A 3MLUL 4BINA 1DEDA 2GIMA 3UTSE 2EUXA 2QV4A 2VDPL 3LRLA 1FDLH 3SDXF 1QEWA 3ULSA 3ZTEA 3EJPA 1QFWH 1X6NA 3GZKA 4ODVL 3L4WA 3IEAA 1GJIA 2J56A 5AVWB 2ZIDA 1P0SE 3QG6B 2ZKXA 3IJ9A 1QMUA 2A6JA 1B4RA 4BFNA 1RK1A 2L4OA 4PJCB 2HKHH 1A7QH 2OSLA 1U33A 4FZEH 1AHMA 5ICUA 4HIPA 2WYIA 2QKIB 3M88A 3P4MB 1A1MA 3FFDA 3PY9A 3AC0A 4NN7C 5E5MA 3W0WB 1NGQL 35C8H 3PJSB 1ADQH 4KMTL 4Y4KB 4XCNB 1T5WB 3PNWB 4LCYA 4CW1A 1SHWA 4G11A 5I1KH 5IW3A 4F5CA 1E4XI 2PYEA 1XF3A 2R0WL 3GFUA 4UOQA 5DA0B 1KJVB 3LKQA 1H3GA 3LDBB 3MRMB 1DJHA 1ZANL 3GINA 2BOCA 4UT9A 3G5YA 5GZOC 5DF0A 3FU7A 1A6VL 3MA7B 4N0UE 4KTDL 5DZJA 4UNUA 1KXTB 2JQAA 1OCZB 4FTVE 4HC1L 3FTXA 4XN8A 5D8JL 2C3HA 2NLJB 2ZYIA 4X9YA 4OTXH 3CFBB 1LO0H 3ZDZF 2WY3B 5E1GA 1CL7I 2WLLA 1RP9A 1B4LA 2EEBA 1DCEA 1MLBB 2N59A 4W93A 4U3HA 4YDMA 2Z7YA 3WS3A 4ETQB 3FTSA 2BERA 1NIAA 3GSWA 4GRLD 2CBPA 4N90E 2V2WB 1TO4A 4XBPB 1U8KA 1K9TA 1M42A 2GTWA 3DHMA 3JQOB 5HTSA 4EZLA 2J4WL 3FSOA 5FYKE 1JPFA 2KPNA 1OTUD 2XIIA 5C0RH 1OT4A 2HH0H 4GIPD 3B8SA 3EH4B 4OZHB 1D6EA 2QGDA 4C59B 1LWHA 1TQVA 5E9AA 4KWUA 1BYNA 1VFOA 4PRPD 4PTTA 3BJLA 1QATA 3ETBJ 3NVQA 4POZC 2J6EH 4HWEL 2D31A 4IKNA 4XVSH 5D7EA 1A6WL 1OM3H 2IVFC 1AKJA 5B3JE 3QUYD 5D5MF 3SDAA 2VXUH 2XBDA 2VXQH 4WJG3 4I3RL 4M6OL 3NZ8A 3K4ZA 4M5ZH 4X6BB 3Q5TA 5JQ6H 4FXGC 3QW9A 4IKJA 1GJWA 1VKXB 3TO4A 3E0GA 4R83A 4LP8A 1TVDA 1BWWA 2A77L 5D7JD 1A4KB 2EADA 4IJ3C 4MGXA 5SX4I 3DMMD 4O00A 3V6OE 5KVFE 1SXAA 1J11A 3TP4A 3CQPA 1GPOL 3MFFB 3ZT6A 1NCJA 5HPMA 4ZS7L 1BBJB 4RRPG 3O8XC 1J18A 4WI0A 1F0LA 3SD5A 4HDIA 2WNGA 3WN5B 1HI6A 2DYPD 3BAJA 2BIMA 3W9DB 1RZFL 3W1ZA 1N8OE 1ROCA 5KVGL 3KL0A 1LEGA 3RGVB 4HSQA 2B08A 5LCVH 1FPTL 3TA3C 5I2IA 4AY0A 1KEGL 3FCGA 4PJDE 2P42B 4NX0A 3BFOA 3DOSA 4GBXD 3L3OA 4LLWA 4QOKB 3FO9B 4UQ9A 2H0PA 3D52A 5JDSB 4MS6A 5DJ8B 1LP9B 5IEKA 2FHCA 1HFUA 3FB6A 3TJPA 2NUPA 2DEXX 1LO4L 1SBSH 2DQIH 2F18A 2QEJA 3IRZA 4H2AA 4BUGA 5IQ9B 2APXA 3EJYD 2EZ0D 4HXAH 2JXMB 5DQJB 5E8NB 4TF4A 2R27A 1RJYB 4P23D 3O45B 1LEKA 5AW8B 1UWFA 3QDJD 4LPCA 1T0MA 4DP9X 3RI5F 2PTTA 2NY7H 4A37A 4O2FB 2ENPA 4NC1C 2VCOA 2SODB 4UZGA 1M7IA 1GYUA 2R7EB 2P1YA 3V9FA 5IHUH 4O9HL 2E74C 1JNLH 4OJAA 4ELMA 4OLEA 1X5KA 2ZTBA 4KRMB 4NZRH 4U6XA 5DURB 1ND0B 1K5WA 2Z6FA 5ITBH 1T5KA 2VZTA 1AHWA 4R2GD 2H6PB 4MWFB 1MW3A 2CUIA 5FK9A 5L4JA 1B3JA 1OE2A 4HT1H 1FVDB 2XQBL 2HN7B 4KPHH 4NDMB 3WE6B 2W9EH 1UQSB 4PSRA 3IVKB 4E9RA 3KYNA 2FDBP 3GZOA 5DDHB 4WSGA 2NYKA 4BHUI 1SM3L 1MFAL 2F5BH 3DUUB 2WSPA 3DYPA 5E2VH 1G5AA 2QDWA 4WHTA 3VXSE 3EFFA 3QHFH 1TXKA 4LOEA 3RL1B 1E40A 1NDTA 4TQEL 3T9WA 1LL1A 1O5PA 3K1KC 3ECUA 3SQBB 3ABKB 3SYAA 2AEIT 2PCPA 4P2RD 1JGUL 3ECQA 2X9XA 2BY3A 3WFBH 5BZWB 4LVNC 3LV3A 3AQYA 1NAKL 3T6WA 2E7MA 3KPPA 4XPTH 1S7VA 1JERA 3V5DA 3KS0H 3I2CL 1KB9K 1OAKL 4FP8H 1SPDA 4KJPD 5C2BL 4KDTC 2AK1L 5D1XA 4KTEL 1KGYE 1CFVH 3JXAA 1KCVH 3BLBA 3VWKD 4MKMA 1T83A 3L1OH 5HGAA 2O6DA 8FABA 3K72B 3LN4A 5JIDA 3AY2A 4TPRL 1FO0B 1HZKA 5E99L 4DGUA 1SZNA 2IPUG 1N67A 1XF4B 2YAMA 4NN5C 2GSGA 1AYOA 2FECI 3GSVB 1RZQA 1SGKA 5AKVA 1UH4A 3GS0A 1J9TA 5FPIA 5DHYA 2OMZB 1J8RA 4P2QA 2LAGB 3BUTA 3FO1A 3II3A 3OG6B 3KYKL 5FM8A 5CP3A 1NEPA 3GI8L 4LLVA 2JJTC 4XN5A 4C4UA 2WHVA 3UTQB 2ZD0A 2O72A 1WWBX 1Q9LB 1WBYA 1EXGA 3QWRD 2VO8A 3U2IA 4M4PA 1DBBL 1WBXA 3EGSB 3F7YB 3GJFB 1IARB 3CD4A 2CLVB 1H15A 3IFNH 4DWHA 1BPVA 4GP4B 4PJ7B 2OP4L 3ZZSA 3F64A 4YL9A 1PIFA 1RI8A 43C9A 4D3CH 3VFGH 3QWOB 3PXHA 3QQ4B 5ISZA 5IK3A 4R90H 4ZFOL 4HOXA 1KXVA 1XEDA 4KJYB 4MKTA 3MLSH 2ID5A 4GAGH 3ARGD 2ADJA 5EBLB 5F3BA 3IFLL 2F68X 3HG4A 4WU5A 1YN7B 4RMWA 5IMMA 3SKNA 3OHXA 3QUZD 5DI8A 3U9WA 3GYRA 3QDME 2XN0A 4ZAKA 5EF3A 2YD2A 2ZWNA 5DLLA 2CDEA 4XPAH 3FFCB 4HIEA 4NQDD 3TV3L 4OZIF 3FU3A 4N2DA 2DN7A 1ZVHA 5LXGH 5FDWA 2ICWI 5FB8B 3ZTJG 3DGDA 2RR3A 1I3RB 1JI1A 1T3FB 5KTEL 1PD0A 1ZHBB 4LVOC 3ZYOA 3OKMB 1MNUH 2DQJL 4BH7B 4OLWL 4FFYL 3HHMA 5E94B 3TBVB 1DZ0A 3MODH 4H25B 3U46A 1RQ5A 1MFEH 2G2PA 2MNUA 1I3GH 4ZMZA 5MENE 5FUZH 3ZYJA 1B6DA 1YMMD 1B4JL 4UAHA 5IW1B 2IOOA 2V9RA 4PJIA 4WWID 5EB9A 1NZRA 2HFFB 4XP4H 3BYYA 1WV7T 3PQYD 1QI5A 5EC2A 5DJ2A 5L8JB 3UCQA 1Q72H 4PJ9D 3BVNA 4NERA 1OK0A 2VW6A 2BVUA 1DSFL 1RZKC 1TFHA 3TFBA 3ARVA 5DZOA 4CMMB 4EBQH 2NYZA 1RZKL 1XXFC 3G5XB 5IGXH 5I74C 4FLSA 5HY9B 2E8YA 4XP9H 1KCRL 1AO7D 2FX8H 4YR6B 4HUUB 1R46A 3QIBB 4W6XB 2P80A 5EZPA 1PLAA 1Z9MA 4OCYH 1TQBC 2VERA 3U2SB 5FECB 4G6KL 1OGAD 1FG2A 1N64H 1I9RL 3P9MA 1MCKA 2FGWH 2E4FA 2VDRH 3IM1A 3LIUA 4WJ5A 3PWUA 3FT2B 3BKJL 3S5LA 1QG3A 4A2HA 1EUTA 5IR1B 3DTDA 4MJIA 4P9ML 3SKUD 4FEIA 2VR3A 4NZUH 4JKWA 4QEGA 4Q58C 4X6FB 4GPVA 1NBVH 3O6FC 3MYJB 5AENA 2ZX8A 3DRQA 1I9IL 3KE0A 4AGMA 1E5YA 5F1KC 5KUMA 1WAAA 4DP0X 3WG7B 2QLYA 1IGML 5C0CD 3WOVA 5I16B 4NFBA 1Y6KR 5A43C 1V7ML 4HIIB 2D3LA 5DK0A 3MA9H 2ENJA 3QZWG 3VGGA 4JZNB 1PY0A 1JJUA 5E24E 4HK3N 4KROC 1L7TH 4NKQB 4FMVA 5EU7C 1NBYA 2VMDA 15C8L 1QRKA 1JHLH 4LCWE 3MI6A 3ZTDC 4ZOEA 1O9WA 4NOFA 1M7UA 3OWEA 2OMNA 2YXMA 1NCCH 1S7XB 2GBTA 3OTTA 4AXWB 5JIQA 1LLAA 1NPUA 2WXNA 4TNVF 3BUQA 3LRGA 2IEPA 1T89A 4RMSA 2HVKB 2O26U 3CSYB 3QG6A 3HI1B 4P4RB 3V10A 4POZD 5CSBA 4BQCA 5L8KB 1M6OB 3DVNB 3KJ6H 1BAFL 4PJCA 5D1ZI 5K9JL 4MYPA 1FYTB 3LRMA 4AIXA 3P4MA 3K2UL 3MZTA 2IMMA 1NANI 3NFSL 4F9LC 1KN4L 1F6LL 3W0WA 4TVPL 1CXLA 5DHXB 5J3HC 1LO2L 1XSJA 4Y4KA 4XCNA 1T5WA 3PNWA 2N1TE 2CJUL 2NSXA 3QIWC 2N56A 1MCQA 4P3WA 2N0MA 2WSKA 4UQEA 4EDXB 1WO2A 1T66C 3MRMA 4OD1H 4U6HB 5I1EL 1GZQB 2WBJB 5CJ5A 1YNTF 4JEGB 3LX9A 2FEDD 1XGYL 1ZRUA 2GBUA 4Y8DC 1KXTA 2ODHA 2KERA 1XGQB 4G1MB 3T0EE 2NXYB 3O8XD 1MREH 4MZRA 2VDQB 3UPCA 1ILUA 1PG7X 2E7DA 2NLJA 3CFBA 2DLGA 5DWUH 3W2DH 3WS6C 1ZS2A 4MNHA 4DK3A 2Z35B 2L04A 3U1SL 2Z91B 3N44F 1MLBA 4FQ1H 5AVTB 3EG9A 1JFHA 1WZMA 4WF7A 2FK9A 4PJHE 2VR9A 2CIIB 4S2SB 2N0KA 2YD5A 2YOAA 1Y1UA 2EUZA 4QT5B 2AJSH 4JFOB 3TA3D 2RD0A 1U58B 1JRHI 1FI8C 1R6VA 2V2WA 2Y2WA 1CDBA 2Q2LA 4YXKL 3SKOB 1HH9B 2J1XA 4JQVC 4N0RA 1W16A 5EU6B 5DZPA 1YN6B 3VAEA 2VC2L 5E5RB 4JN1H 1GYCA 4OZHA 2J71A 4P5KB 1J5OH 4XNXH 1G84A 2HTLC 5F97E 3X13B 3GDCA 4LEXH 3WO3B 5L8LB 3LMJH 2X3BA 4FQCL 1EK3A 3ELQA 2UUDH 4C56D 1L4IA 2F08A 4MDIB 2VT0A 3SD2A 4JRLA 4WW1A 5GIRB 2Z31B 3D3VB 1DBKL 3A67L 3GBLA 3N1QC 4TNFA 3TH4T 4JHZA 4AVKA 1BZ8A 4E0RB 1BA9A 1K4DB 3A6CL 3TNMB 1QLEH 4F92B 1IBYA 3FTYA 4X6BA 3CN2A 1BJ1H 2WINB 2Y5TA 2H1PH 1VKXA 4UOJA 3AQZA 2X10A 4PCTA 1G7QB 1NCBL 4LNRB 3L5HA 3LPWA 3QFJD 4BK5C 2Q1EA 3VD7A 1Q9KB 3B83A 1A4KA 4NENB 1FLTX 4PRDB 3JWDH 5DEJA 3KW7A 1NOFA 3MFFA 2XZCH 2KI6A 3EZ8A 1BVOA 1BBJA 2A0LC 3J07A 4WGWB 4RDQF 4F1SA 5KSBF 3WN5A 1CLCA 5FYLD 3BEVB 1ED3B 3DKHA 3W9DA 4PGCB 2VDRB 3BSZA 3P2DA 3L2MA 3Q9QA 3IN2A 4MXWH 3CPUA 3NIDE 4QRPA 4P07A 4XMPL 3TBSB 2A6DB 1QUNB 2JK5B 3K8LA 3NQIA 5FUOL 5E7BA 1F1DA 3RGVA 4JO1H 2B16A 1MCWM 4X4ZA 5HDBB 4IHOB 3O0LA 2PWGA 3GBML 5C0DB 4FQHB 4Q9QH 4DOHB 2XWBB 4U1GB 4XX1E 3OVUB 3FO9A 3WNNA 5JDSA 4HJTA 3EOYG 4EF3A 3CLEL 1LP9A 3QI9A 5DJ8A 6TAAA 1P4IL 3RFZC 2IOIA 4TOYL 2J88H 2A74B 5FW7A 3RHWK 1QZ1A 5IQ9A 3TBYB 4X9GA 3H3KA 5T3XE 5T1KB 3UP6A 2JXMA 1TJHH 3MCLL 1D6VL 3BPOB 5DQJA 5B38G 2CA4A 1LK2B 3O45A 3QHTC 3SCMD 4B41A 4ODBD 4Z7UB 4UQ2B 1Y6NR 3FT4A 1DVYA 4O2FA 5AB1A 2HT3D 4YS4A 4UB0H 3ULUC 1MEXH 3B2VH 4WUUD 1LO3L 4DZ8A 4NUQA 5BO0D 5EEWA 1KYOJ 5KW9H 3QRFM 3AROA 1JD9A 3LXBA 1UM5L 3NJHA 1ND0A 4N4YB 4KITB 3V55A 2VLKB 2KL6A 3OKLA 3BE1H 1OQXA 1ADQA 2H6PA 5HJBA 2CGRL 4MWFA 1SXNA 3FBKA 4L1DA 5KS9F 2VYRE 4AEFA 3MLZH 1FVDA 5DZVA 2Q87A 4NDMA 3WE6A 2VRQA 1UQSA 3IVKA 3EYUH 1JNHB 4PB9L 3DROB 2FH6A 5DDHA 3F7LA 4XI5C 3A47A 3KPRE 3DUUA 4DP5X 2P48B 2ISDA 2HUHA 4MQTB 1P7QD 1YYLH 2J1YA 3RL1A 3QXAB 4R97B 4K3EL 4K8RH 3SQBA 2D3NA 2K4WA 3QXUA 1HSBB 1QSEB 4FS0A 4YN3A 1FJ1B 1IC7L 1QAWA 2Y07H 1KLUB 2OSXA 2FX9H 3C5ZC 4X9IA 3SGKC 4X83A 5DMJB 4KVCH 1YEFL 1DSYA 1P6AB 2YAFA 4X4ME 3QS2A 3PL6B 3NFPB 3OAUH 3WEAA 1MHEB 1BG1A 1SJVA 3B43A 4OLZL 1NDGB 4NIYE 2B14A 1MCOL 2ZCZA 4X80L 5D2LB 1TTFA 3K72A 5GSVA 4GG6B 3DVIA 1FO0A 5FKPB 3VFRB 4UYQA 1BMZA 3ZTCC 4ZMYA 1AGCB 1AVAA 3US9A 4NQTA 3D33A 4HX1B 3EXLA 1M2VB 4ZTPH 1EMTH 3HPLB 3GSVA 4L8BA 2G3MA 2HCZX 4P5TC 3KR3L 4LMQI 4Y2LA 3TH3T 2I9TB 1HQRB 2DEWX 2VXQA 1CGTA 4KUZH 4XOEA 3MRQB 3RDJA 1WSST 4I4WB 4IBSA 1Y07A 4JY6B 3HFFA 2Q7AA 4U1SB 3UTQA 5T3ZE 3FOMA 5DRXB 4ZPTB 1BD2D 5KVFH 1U8OA 2KDGA 2PO6C 4YAQB 1Q9LA 3DX6B 3PF2A 1FC2D 4K71B 4D7BA 4PJAB 4WK4B 1ZT7B 4PBXA 3NACL 3EGSA 2Y4SA 3F7YA 3GJFA 3O6MH 2CLVA 5M95B 3NQKA 5I1HH 2VITB 4PJ7A 1CGWA 2EDBA 1A3ZA 2C4XA 1CF1A 3ZDXB 1J8HD 1VHPA 3QWOA 2DQGL 4KZCA 2EDEA 3QQ4A 5LN4A 3TWCH 5I8KL 3FHAA 4KJYA 2DKSA 4XOBA 1BEXA 3CFTA 4G7YL 2VZSA 5EBLA 3AUWB 5L0QB 1MI5A 4PS4H 1YN7A 5IB2B 4GAJH 1KTDA 3OR6A 3ZE0B 4ZPVB 1LK3H 1HXYB 3RQ3A 3CSBA 5F9WB 3UTSB 3FFCA 4UANA 3B4NA 4CRPA 4ODWB 1J9CT 3RYMA 1EHNA 5FB8A 5HDQH 1EPFA 4FABH 5IEHB 1I3RA 1HWGB 2UY7B 1T3FA 3SGDI 4DO4A 1ZHBA 3KNBB 1T1WB 3DGCR 4KROD 3OKMA 1FNGB 3UYOD 4BH7A 3B5HA 5F1NB 4RX4D 5E94A 4NQED 2EIMB 4H25A 1RUPL 3CVIH 2CALA 5E8OB 2V9QA 5IVOA 2GIXA 5L6YL 5IW1A 4ANVA 2YKLL 1QSVA 3V4UH 3O4LB 4UT9L 4P9HH 1PSKL 2HFFA 2RBLA 3PYCA 1IC5H 2X3AA 4WFHE 4XXDA 3WFDL 4JFHD 3ZR5A 2Z7UA 4GB9A 3HI6H 1NBQA 2I9LA 1TEYA 4CMMA 3NIGF 4TVPD 4Z3JA 3G5XA 3TCXA 1E5UI 2VUKA 5HY9A 1UA7A 1AXTH 2EIZB 3MRHB 4Y4HD 4YR6A 3TTSA 5J3HD 4YUEL 4HUUA 3T3MB 3QIBA 3U2SA 4DP1X 4LT7A 5AZEH 5SX4H 1UT1A 4MB4A 5FECA 1CD8A 3QIWD 3IETA 4BIKA 1LNUA 3V0DA 1NIBA 5IFAL 2V17H 1A6AB 4DN4H 4LLDB 3FT2A 5IR1A 4I2XE 4OJCA 2WLKA 2E27L 4M1DH 3EADA 2BH0A 1C5BL 4GP8B 4KQ4H 3BAEH 4M3KB 2ZX7A 4X6FA 3SDDB 3ARBB 2JTYA 1KFAL 2OBGA 3WY1A 3MYJA 3VI3A 4WK0B 2E9BA 1TJGL 3OMZA 4G59C 3TOPA 1G0YR 3KLKA 4GAAA 3SDAC 2KT6A 3KLAB 3NPSC 4GINA 1EAQA 4FNSA 4NKIL 2SEBB 3QHZL 4H0HB 1EZVX 2WXPA 1Z5HA 4JZNA 3MRRB 4PP1C 3KPLB 4HS8H 2ZG3A 4ODSH 1M7DB 1EZVY 2EDQA 2CM5A 3TO4C 1GJUA 3RX9A 3BVWA 4URTB 1IT9H 1UATA 1WC7B 2AQPA 1S7XA 2EH7H 3IJHB 5AALA 1NQBA 4AXWA 3KAAA 2HTLD 2JI2A 4P4KC 3U4BL 5F0PB 5IVZB 3O3UN 1DFBL 3CPLB 4NQCE 2FLBT 2HVKA 3CSYA 3GI9H 1UXLA 1PG7H 3HI1A 4P4RA 1WISA 2GG1A 4OLUH 1M6OA 1GGBL 1OAYH 4YIQB 3S4SG 4DP6X 5J89A 4Y9BA 2VSDA 5A7BA 5BV7C 5JW3H 3T6QC 3BHBB 3BP5B 3CXDH 3K2MC 3D48R 1MHPL 1SQ2N 3T0AA 4BFJA 1NGZB 3BPNB 3VYPA 1TZHB 2F7QA 1MAML 3C6LB 3ESOA 4LCIL 4EDXA 4PIRF 4DUXA 3BH8B 3CFJB 5EOCH 4K2UH 4GRWE 5TK4A 3L3OC 4U6HA 3WD5H 1GZQA 2WBJA 4QRTB 2IV8A 1LO5B 3C8HA 5GGUB 4H88L 2B1AL 5CZRA 3L5XL 4ZNEE 1DVFC 4P06A 1IMHC 1QBML 3ZGIA 3VFUB 1EFXD 1MFCH 5KVMC 2BSBA 5BO1L 4WTWA 2A0LD 4HBCL 4YDZA 1AG6A 2WP3O 5J6HB 3GSQB 4M48L 4PJDB 3FU9A 1BXUA 3STZA 2Z35A 4HPYL 1RIHH 2Z91A 4K5OA 3HW7A 4X0KB 5A2FA 2CIIA 4S2SA 4YVUA 3KVDD 4RZCB 1JZ7A 1A9BB 5EBMB 4JFOA 4Y0GA 3ARDD 2X2HA 3ULVE 5J6SA 3HNVH 3SKOA 1HH9A 5KBLA 2AXGB 4FQQB 5CU5A 4OH2A 4YHLH 5EU6A 4FG2A 3SOBH 1YN6A 4KI5E 4L8DB 5JIMA 4MDJB 1NEZG 5CLYA 5KOVC 5JHLH 3P4OB 4P5KA 4OGYL 1LM8V 3X13A 3BSGA 1XMEB 1I1FB 2W38A 4Q89A 2Y25A 1CN4A 3SE4A 3RX7A 4G82A 1C12B 2B5IB 4WV1B 3A6BL 2DLFL 2ESVD 3CK0L 4BZ2A 4MDIA 1O7DC 2K9FB 4G8GA 1SQMA 2Z31A 3D3VA 3CZLA 4JG5A 4PRAB 1AE6H 4LSTH 5LN8A 2O5ZH 4GEIA 2Y36L 4E0RA 4L3EE 4XXCC 3TNMA 4TN9A 1BMWA 4UILL 4WWKD 3W57A 3GRGA 1KJ2H 2WINA 2ZQKA 2HLFC 3C60D 1YEGH 4KTYA 4HIJB 3UMNA 3ULUD 1G7QA 1J1OH 4WNSA 1FVCB 2Z4QB 3CQQA 1G9NC 4LNRA 5HYSB 1U9KA 2VDLL 2JTDA 3KBHE 1Q9KA 2J1WA 1G9NL 4NENA 4L1HA 4PRDA 2AXHA 3T6VA 2XV0A 3KPSB 2GJZB 3IDYB 1TEFA 4H8HA 5CN3A 5EEXA 3IF1B 3VXSB 4Z18A 2V37A 2BDNL 1JN6A 3BEVA 1ED3A 1MUJB 2CJ3A 4G6JH 4PGCA 5SX5H 5I0XA 2BFVH 3FCSB 4GT0A 2OI9B 2FUTA 1NIFA 2A6DA 4IBUA 3NJLA 4FNPA 1QUNA 2JK5A 1FFNB 4DGIH 2DMCA 2LT9A 3ZKNC 4IHOA 1J88A 5C0DA 4FQHA 2DY2A 4OF8A 4UT7L 2XWBA 5FM4A 1JZ4A 1DN2A 2FSDA 5FM5M 1IQDB 3C5ZD 2E56A 4YFEA 3BT2L 5CU9A 2DWXA 3TBYA 3BVVA 5GHWL 1BFVL 5HHVH 5T1KA 3KYMB 1HHHB 1P7HL 4WWNA 1S9VB 5E1QA 1LK2A 2B3RA 2D7TH 1VGEH 4ZX5A 4MLSA 4Z7UA 4UQ2A 2AVFA 4ZOCA 4MCYB 3S0PA 3MBEB 1KLFB 2FYVA 4XNUH 1YNLL 2O5YH 2JKRM 2YRLA 5I30H 1GZPA 3P3TA 4YSQA 4N8CH 3Q43A 1T7WA 3L1EA 5E1AA 3H9SD 1AOHA 4P5TD 2GFBB 1KXVC 1CT8B 2R0ZL 2A6KB 5F8RC 3CFKB 4W9HC 3CZFB 1PCXA 1LD9B 5H4ZA 4Q6IA 5CBAB 3FJTA 3FT3A 3OHXC 2IDTA 4AVJA 4R7DB 3FO0H 3C2SA 3D85D 2PCFB 1ZV5A 2PO6D 2UXFA 1JNHA 3MJ7A 1MWAH 3DROA 3D1MC 3EOBB 1XIWD 2A9MH 2B4CL 2C9QA 4LGPB 4MX7A 1Y0LB 3MGAA 2YR3A 2E47A 5C09E 3D05A 3CIQA 4XNQA 1IEAA 1NMCC 4NBYB 4OLYL 3QXAA 1EZUA 1W72H 4HEPG 1RZJL 1SEQH 1HHJB 4UNTA 2HFEB 1QBBA 4AVHA 3D34A 1HSBA 1QSEA 3KYOB 1MW1A 1FJ1A 3T2QA 1KLUA 3LS5H 4RFOL 4DZBA 2R4RH 3FRPG 3I74A 1L7IL 1MJJB 2CIKB 4LSVL 4DPCX 1Y1DA 1ZD6A 2OCJA 1GY1A 2AEOA 1NMBH 1RIVL 5FCUL 1MOEA 4F80A 4X6DE 1KCUH 2I27N 3PL6A 3NFPA 3UJTH 3T1WA 2P8PB 4Q6KA 1NDGA 3OAZK 5LDSA 2Y06H 1TTCA 5D2LA 4GG6A 1VZIA 4A7GF 1CGUA 5MENB 3VFRA 2WMPB 1AGCA 3MTRA 1YEJL 2NNRA 4HX1A 1M2VA 5DHEA 2ZICA 4PRHA 1U3ZA 3HPLA 2BHZA 1ROWA 4CL7A 2PYED 4KX7A 3GEFA 4OV5B 1YEHL 2I9TA 2FIRT 4RGOH 1HQRA 2VKWA 4CMHB 1X44A 4XBGB 3MNDA 2XX1A 3MRQA 2WWKT 5J56B 4I4WA 1CXEA 2ZUUA 3NSFA 4L4VE 4U1SA 5DRXA 4ZPTA 1NANH 1Q1JL 3DUHA 4H8WH 1FV1B 4JG9A 4HPOL 4K7PX 4YAQA 3DX6A 1YEEL 2BIOA 4PJAA 4LP5A 1ZT7A 4R4ND 4K7PY 2BRRH 4KY1H 1MRDH 3BQUB 3MAWA 1CU4H 3EO1B 3GRWH 1K85A 2WXHA 3OJMB 9CGTA 4H13C 4IRJB 1ZY9A 1U3NA 5DQ9B 3BCFA 4OT1L 5D1ZC 4KKAC 5CD5C 2FATL 3CSTA 5EWIH 3RPBA 3AS1A 5INDB 2CNYA 5INCA 3N04A 3OAYH 4PW4A 5EF0A 5FW6A 4ZPVA 3ZDZE 2C7UB 3VDBA 2Y6TE 1HXYA 4YPGB 4YHML 1R4XA 3WAKA 2C4FT 3UTSA 3PUUA 4LCWB 1AKJD 4NQVB 4U3XA 4K3DH 1JRHH 2QKIC 4HKBB 3SDAD 4L4TE 3CH1B 4ODWA 1D5RA 4HGMA 4UV7L 1I53A 1USQA 5IEHA 5JW5B 3KNBA 3N1MC 4FE9A 1T1WA 1FNGA 3QJUB 3TO4D 3DV4A 5F1NA 1SJHA 5IVXE 2MKWA 1XDTT 4HD9A 2V4LA 5E8OA 4QRQB 2QHLA 3LDBC 4FKKA 4UUJB 3PHOB 1G87A 4NXSA 3EJZC 4JHAH 5LNGA 2NQCA 4V1DE 1MDAA 3O4LA 4AIEA 3RX8A 5AYUH 3F84A 3VA2C 4V2BA 3MC0A 1EJOL 1NCHA 5JXEA 5D5ME 2NDGA 2F53E 3MYZA 4ZX4A 1IE5A 4G80B 5GS0L 4Z8FL 2D0GA 3CFIC 1VCBC 1BM7A 3MGTB 4FN0A 3X12B 2XV6B 2FQGA 5F7YC 1L9NA 4G8EB 1E5ZA 4HFWB 3MRHA 1JDAA 3H42L 1SMDA 4XMUA 1CBVH 5FKAB 1NC2B 5E7FA 4LSQH 1A0QH 2DLIA 3SZKC 2F19L 4FTVA 2EUWA 3PREA 2RCSL 3CXFA 5LVEA 2X2JA 5DS1A 1A6AA 1OHZA 4LLDA 1I8LA 2W81C 3ZL2A 2Z8VC 2XKSA 2G60L 3PP4H 4H4NA 2V9UA 1P7KB 1ZJAA 4DEPB 3T4AA 3ZKXB 3WTTA 3DUSB 2C8NA 3RB5A 3SDDA 1XB8A 3ARBA 2F1BA 3LZQA 2P8LB 4PJHB 3MPCA 4JPWH 5JW4M 1YAZA 2OM5A 1AI1L 2FHBA 1DUZB 2IGLA 1OTSD 2JB6B 1I7TB 4ONGL 4E9YA 3KLAA 2B0SH 3CVDA 5KWYC 1FP5A 2SEBA 4LVEA 2G2NA 2OMWB 1KELL 4XWOC 4QPEA 3MRRA 3KPLA 4JR9H 4WFEE 3ISRA 1M7DA 2Z65C 2I5YH 5GJTL 5DHDA 1WVZA 4G42B 4WEBL 3JWNH 2CUAA 2R69H 5HI3C 3GNMH 5AVSB 5K9QI 4PJ5B 1U8NB 4RISH 3Q8AA 3LIZA 2OMUA 3FUFA 4UF7C 2MPVA 3FUIA 5IVZA 1R0AH 3CPLA 1SLXA 3O4OC 4OGZA 4F7CB 1S9YA 5F0MB 4N2CA 2XZAH 4CKQA 4D9QE 2FJFB 4G5ZH 5C6PB 1FQ9C 1P4BH 3WN5C 4YIQA 2YA1A 3CLFL 5KSUB 2KZWA 5D6CB 4ADGA 3CHSA 3V4LA 1I7ZB 1U6AH 3BSZL 5D2NE 3MUJA 4Z1PA 3BHBA 1QASA 3BP5A 5F1SA 4PLOB 3RGVC 1FA4A 1YQVL 1NGZA 3TEYA 1TZHA 2RMNA 4HIHB 3C6LA 2D03H 4JM4H 2EDYA 3CFJA 2D7NA 2Z4TA 4QRTA 4F8QA 1KGUA 2VDNH 4GS7B 1LO5A 1NFDE 1IZJA 2R59A 3DLQR 5GGRB 5GGUA 4YSTA 3KEDA 4XMLH 2DYRB 1H3PH 3NIDB 1F90H 5F44A 3VFUA 3VG0H 3CDYA 4GI9A 4R8WH 2AJYH 4Z9KB 4ALAC 5J6HA 5FV1L 3BP4B 4N2GA 4B6ZA 5ACLA 4PLNC 4ALAL 3JUZA 4HU2A 1BQHB 4XNMB 4CGTA 2OCCB 1JF6A 5D1XD 3EW3B 4PJDA 1OAZH 4L48A 1PAZA 4EZJA 1EANA 1WGVA 4X0KA 3WJJC 1FDLL 2WKLA 5BOZG 1AAJA 2EECA 1F6AB 2BM3A 3QIUB 2DV6A 3LOWA 4XNYL 3S5ZA 3P11H 2VISB 1QFWL 3Q2WA 1EWHA 4RZCA 4V11A 5EBMA 4KTGA 2D73A 1F42A 3U7WH 3T2OA 4FQQA 4L3CB 5EUKB 2YFNA 4L8DA 1N18A 4MDJA 3IBEA 1P6WA 2EKSB 3CWGA 1A7QL 2WVTA 1BZ9B 1PPIA 3AXHA 3MUZ1 4M7ZB 4P2QD 2NY6D 2QQLH 5EU3B 1C12A 1EAOA 35C8L 1ADQL 2WQUA 1X9RA 4JO2H 4OZGF 4PRAA 5KSAC 1NSNH 5I5RA 2AGJH 4ZO8A 3QZNA 5MI0B 1U8JB 4YOKA 5CF3A 4HH8A 3DVGB 3EOAB 4GKOA 25C8H 2QVTA 3FFOA 2V3FA 3NGBB 4KKQA 4JMNA 4XMKH 3GKWH 4F58H 2L7EA 3ZQ9A 1UKSA 5L88H 4HIJA 4FGMA 2VSKB 1FVCA 2Z4QA 2EIEA 3MHZA 5HYSA 4PJEB 4XB7A 2Q6WB 2ZAIA 1QWHA 3MRNB 5ISZD 1QA9B 1PFCA 2ZF9A 5BQ7B 2UWEE 4HLJA 4IKLA 1LO0L 4M93B 3K8MA 3KPSA 1SMAA 2XA3A 2GJZA 3RVUC 3IF1A 2H7WA 5GISL 3VXSA 2A1WH 3D2UB 4ZAKD 4YZFF 3OWRA 1MUJA 3HMWL 3RWFB 2WJ5A 4L37B 3FCSA 4N8UA 5D6DC 2BP8B 3O6LH 1YEDB 4AW4A 5CILH 5C0RL 4M7LT 4CSTA 1FFNA 3LKNB 3TBWB 4EIZC 3PAZA 1MCDA 3KJ4B