2LLGA

Nmr structure of the protein np_814968.1 from enterococcus faecalis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
b'MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein NP_814968.1 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2llgA00
2LLGA 1LMIA 3QFGA 3CFUA 4LESA
chains in the Genus database with same CATH superfamily
4TUJB 4JDEA 3HRZB 2BMKB 1H15B 1FAIH 1E8XA 4HBCH 3T1FA 2BCMA 1T1WA 1UWXH 3QUGA 4BZ2L 2O93L 1C16A 5D8JH 5IW6A 3SDXE 1IE4A 3WNMA 2XG4A 3FH7A 4MAUL 2I07A 1KTJA 2BDNL 1IBDA 4EQ3A 2WANA 4D7BA 5ICYA 4MXQC 2R83A 4GB9A 5F88B 2JE8A 5JW3H 5EBGA 1BFVH 2ZKWA 4L5FH 3WNPA 4G8FB 3APMA 4ALAC 1EVTC 2V5TA 3L7FA 4EOWH 2A73B 5ESQB 2V0AA 1DFXA 3CGTA 1P69B 3L3HB 2RIKA 1ZVSA 1ZDQA 2AEPH 1OGAE 3EO1A 1S9VA 4LKXA 2OJZL 4F57L 5JIIA 1GC1H 2QSCH 4Q2ZA 4J3XA 4B50A 3OXRB 4S11A 2K70A 1JGLH 2W81C 5TDNB 1E9PB 3VXUD 1NBVL 3BKCL 1MELA 1UJ3B 3JV6B 3HMXH 3CVIL 4R26H 4MMZB 1A3ZA 2JKSA 4UNTA 5JZ7C 3OZKA 4G9DA 5CXPA 4BDVB 5CJXA 1Z6JT 1IGFL 1YEDA 5IVOA 4G11A 3CFCH 3QIUC 5JHDD 3AREB 2WJ5A 1YN6A 3BWAA 2XSKA 3MOQA 1LXMA 3TO4C 4LEOB 3LN5A 5J6HB 3Q9QA 4DKEH 1CFVL 1E6JH 4MD4B 4TRPH 1UADC 3ARDA 3TP4A 3LIUA 5DUJA 2C1PB 3QNZA 4L8BB 4MHHG 4PJHE 1MAMH 1E9QB 4MD0A 2GEEA 4LLMA 1UOLA 1V7ML 3C5ZB 3NIGF 5C0AE 5EG6C 4UM8B 4BFGA 2A74B 2I5YL 2C3HA 3EO0A 2YD1A 2YD0A 4F2MA 1AOZA 2VUYA 2K4AA 4AQ8A 3QI9D 4N4YB 1MCRA 1U91B 5SWQB 2FZ3B 1R3KB 4MJ4A 4O2FB 1MOEA 2BIQA 2CIKA 1J1PL 3RDTD 3TT3H 3ZX1A 1I9IL 2PWFA 3D2UA 4OD2A 4G82A 4P06A 3ZL4L 4FQ1L 2VC2L 4NSKA 5EBMA 2XNAA 2WP3O 5KSUA 1F4YL 4MXQD 2BNUB 4Q9CA 2OSXA 1PBYA 5JHBA 2XFXB 5D5ME 3FN0H 1WZ1H 4QI3A 2ADGA 5T3ZD 4UQDA 3HC0B 4RETB 1L0PA 3CZFB 3GZOA 5J12C 4G5ZH 1OAUL 3R19A 1NLDL 3K5RA 1A6VL 4UZGA 2NNAB 3HI1B 4XBPB 1CLCA 4CKVX 1USQA 3CZGA 3OR6B 1J12A 4PRIE 2EUZA 3O2DH 3PHOB 4A7GA 4P2QA 3HZMB 4LIQE 4PJ8B 3VJ6A 2VXQL 3I2CH 3L3KB 3QORA 1T2XA 4WDIA 5F7DB 5TE7L 3IDJA 2X3AA 4LKCB 3M07A 1BXAA 4U6VL 2J72A 2ICEC 4PP2A 3TOPA 4BD4A 3F12B 4DQOH 3MRIB 4G6MH 4IKIA 3IXTB 1PIFA 1CZ8L 1LEKA 5I82A 2DBLH 3MTRA 2NLJA 5B1BB 1N3NB 4WW2B 2RJMA 3LB6C 4HHWA 3SDCA 2ZOUA 5CIPH 2IWKA 1E28B 3TA3D 4JZNB 1U93A 4UIKL 5EBLB 1TU2B 2L7UA 1F97A 3VYNA 5TE6L 2QVIA 1YNLL 3AGWA 4XPBL 3TN0B 3KLHD 4PV9B 4OCWL 4PJEA 1P4LB 2EC9U 3G04A 1XEDA 4OZFA 4QO1B 1AIZA 1ZSHA 4M3KB 3DETD 4NZRH 1N5YL 5HHPA 1ZLEA 4PJDF 5JHLH 5CCJA 1PX4A 4M5TA 4X5PA 2QSVA 5BRZA 4I89A 3VXPA 1AXIB 5D2LE 4MVBC 3DBXB 5EO9A 1M05B 4P2RA 1X5LA 1N9PA 2YA2A 2DWEB 1CUOA 4TNVK 4H1LB 4YDJB 4K23L 3GLEA 5GGVH 2WOBA 1OAXH 3QZWG 3L9RA 3VFNA 4HYTB 4KGJA 4NHCL 1A22B 1C12B 3CMGA 2HMID 4MDRA 4BZYA 1ZD6A 1WWBX 4K73A 2J71A 1TQVA 2DQHH 4B9PA 3AUWB 1FBIL 2FTAA 2E75C 4WI0B 3H42L 3MROA 2MCPL 4NQQA 2IGTA 5D6CB 1G5GA 3MLRH 5CS7A 3UO1H 1N8ZA 4QYOB 1EK3A 4HBCL 5F7BA 1MF2H 2QBWA 3JXAA 3RI5F 4BWUA 2J20A 3O9WC 1DSFL 4K7PY 4FEIA 5IOKA 3UMNA 3U0WH 3P2BA 1W0VB 4UDTA 3W2DL 4WSJA 5HP5A 3O4LE 1T1ZB 4K2UH 4WI7A 5IVXF 1RZKC 2O6CA 4AC2A 4A6YB 5IY5B 1BFVL 1P7BA 2IGLA 4XWOC 3ILEA 4CN6A 8CGTA 2BHFA 1UD5A 4G9FA 2VDMH 2LT9A 1P6WA 1UFUA 2VN3A 1M9WA 2CLZA 3HFMH 4IGBB 1FFOA 1ZLWK 4LGPB 1QZ1A 5GRXG 1FNLA 2AEPL 1JGDB 5F8RC 4PN6A 2BVOB 3V0VB 2QSCL 1AD9A 4LSSH 1VZGA 2EC8A 2DQEH 3WFCH 1TUPA 3DRQB 4CADB 1IE5A 1WZLA 4Y9BA 1JGLL 4KROC 4NPYA 5I28A 1S4IA 4RDQG 3AACA 3VWJD 2DAVA 1ADQH 2N7SA 3CFDB 3O6FD 3LKSA 1NM4A 4OVUA 4ZX5A 4ERSL 4YSUA 4DK5A 1V8HA 3L9BA 4PRNA 4MVBD 2VUOA 2DWSA 1T3FA 3H9SA 2HN7B 3LHPH 4HKXB 4JFFB 1E6OH 12E8L 3LSOA 3ULSB 2R7EA 4B9YA 2VR5A 1E6JL 4TRPL 2DQJL 3SJVD 1E3XA 5FYKU 3FL7A 3PXLA 3I6KA 1BFOB 2PPEA 4OLZH 4QAWA 3I9IA 3BN9C 3UYOD 1SM3L 2DWYA 5TTRA 4KDTC 3X1FA 3QUZD 2CAKA 2EYTB 5ITFA 4WWOA 5EU6B 5J3HC 1QP1A 5BRPA 3QA3A 2IAAC 1AH1A 3OKMB 3O3DA 3PGDA 4HXAL 4PMEA 5E8OB 2NCEA 3HHMA 2I60H 4JG0H 5I8EA 2BLFA 1YEHL 2EIZA 1PJ9A 3TT3L 2LE9A 2XG5B 1JGEB 3VGGA 1OARH 2WNGA 4QHKJ 5CSGA 3HI6L 1XCWA 5CMAB 3NBNA 3VH8G 5GS2H 1HHGB 2WW8A 4HBQA 1MCEA 3BZDA 1EHXA 3NA9L 4AGLA 4U1LB 4RH4A 1SLWA 4NO3B 4F37F 5HYQB 1L4IA 3MXVL 1ZS8A 2FYYA 2GJ6B 1NCAH 3CE1A 2P5WD 3TF7C 4G5ZL 1IAMA 3MMEB 4YHMH 3ROLA 1JUFB 2GCYB 4ZXBA 1TVHA 2F58L 1F41A 3P4OA 4CBPA 1MHPL 2WXFA 4YO0A 3E2HC 4TMPA 4NXKA 2Y3NA 4ALAL 1BQHB 3HC4H 3GSUB 1VFBB 1S46A 1I1AC 3WKML 1OCRB 2E4FA 3F7RA 3MVSA 1FFPA 2Z0BA 5HI5D 4MQ7B 1BHGA 5T5NF 6TAAA 3NZSA 1OCCB 1TZHA 1KCWA 1JN6A 2WIIB 3K1KC 4DQOL 4G6ML 4JFEA 2H3NB 2FJUB 3SKOB 3BH9B 4XP4H 3RPIB 4GXUM 1YEKL 5JPNA 2VXUL 2VLJB 3ZW3A 1XB8A 4HS3B 1LJMA 2WV3A 3DOIA 2PXYB 3RHWF 4XAWH 4F9LC 5CHNB 1UA6L 3QIBD 2ID5A 3U2IA 1Y18A 1BG1A 4N2AA 4UQ3B 4QJ3B 4X9FA 2IBBA 4WCYH 4L29B 1HEZB 1NWPA 2AXFB 2VERA 4JW3A 5DMGC 1R1CA 1RZGB 4NZRL 1H3PH 3TJPA 4A63A 4F3FA 1NANI 1V27A 5J56B 4AGPA 5F7NC 5JHLL 1JXJA 3AY2A 4Y5YC 1FL6B 1OCZB 4KKLD 1TJGL 2BNQE 2CIIA 4O51B 1OL0A 4GI8A 2NSQA 5EZJA 2IALB 2EDFA 5H4YA 3TBWA 3UBGA 5CD5C 2NX5A 4FFZH 1QRNB 1CQYA 2WXJA 3FHQA 3RX7A 3FQTB 5IP4A 1OAXL 1TJHH 4MZ2A 2G4GA 2UZIH 1UD4A 4ADGA 3EG9B 3IS1X 4JFWA 3WY1A 2DQHL 1MCWM 1IEBB 4HC1L 2BOBB 1T0MB 2HB0A 5E1AA 2JVUA 2WK2A 3LXAA 4LPVA 2HPOA 4GG6A 4XPTH 2YWYA 5SX5H 4JGUA 1E2ZA 1RMFH 3Q1SH 1TJMA 3MC0A 4BFEA 5FM4A 4G42B 1EVUA 4DN4H 1FZJA 2SEBB 1DDTA 4WO0A 4ZMLA 2RTTA 4HEPA 2CBMA 1AO7B 3FDWA 4U6XA 5A2BA 1UFGA 4UIMA 1DQIA 3VXRA 1A6ZB 5JXAH 1MW2A 3DUSA 3TJHC 4UV7H 4K2UL 3WE6B 2G9HA 4NO0B 3GMMA 1ORQB 5F2FA 1M57B 2J55A 2ZOKA 2DMBA 2DIAA 1M53A 2BZDA 4U3SB 1J5CA 1L7TL 2GUYA 1I4FB 4HPYH 4NB7A 2A9DA 4NM8H 1TTUA 4KXZH 2GJRA 2J8UE 3L5WB 5C07A 1I8LC 4LHUG 3HFML 1XGQA 3IDNB 1KB5H 3UMTA 5HYJB 3V5HA 4QRTB 3CDGB 4Z7UA 2Z4QB 1KPUB 1QSEB 2C7UB 4LCWB 1JGIA 3M7OA 3QPXH 3T0ED 4KXAA 1YA5A 2DQEL 3MJGX 5PAZA 5I5IA 5IMLB 1JYWA 3VFUA 4F58H 1HE8A 2GTQA 7PCYA 3U4EB 1AGCB 2LTQB 4XNAA 1BPVA 1WBYA 2EXSA 1ZWIA 4G6FD 5LN4A 4S0HA 3IDGB 3S8GB 4WI6A 3LZPA 3FRPG 2VQUA 1MAKA 5DURB 3B9KB 1SEQH 2IMNA 4R90H 2MMXA 5D72L 3V6OA 3NEOA 4JO3L 5CP3H 3AQYA 3QAQA 4ABVA 2JB5H 3MLYH 1JK9B 2BVYA 4D0BB 4ZW7A 4UDUB 4TSBH 4P3CH 3MKKA 2VQ1B 1IM3A 3UGEA 1OM3H 2XQYK 3E6HA 4OSUL 2ODHA 1TDQA 4G8GB 5ISZE 4YBLC 3D0LA 4PJ7A 2M8XA 3QR0A 2EADA 2NW2B 3MLVL 4MGXA 4J4PC 4NYLA 2EYRA 2ESVD 4L3AA 4PJXA 3O11A 2DPKA 3KL5A 3PYCA 1ERNA 4C56B 1BQRA 4NNYB 1FP5A 3FO2B 4XN4A 3D87B 3ZHLA 5T3XE 1U36A 1HXMB 1OARL 2FEEI 4G6KH 1KG0B 2DIEA 4U1NA 2A6IB 3AT0A 4Z3JA 5ECGA 2QZQA 2F74A 3CFUA 2X4PA 4NQVB 3ULUC 4QD2E 2OL3A 3FN3A 1LQBC 1FNGA 1NFDF 2FO4A 2W9EL 3DUUA 2H2SD 1NDGA 2PO6B 2YJQA 4YHML 4Z0BL 15C8H 4WEBL 1ITCA 1GS7A 3IGAA 4KK8D 4ZD3H 1RZKL 1UUSA 5FV1L 1TIUA 3NZ8B 3MTXA 4GXUN 1WT5C 2D7TL 2OMUB 2R39A 4J27A 3WBDA 5DJCB 5EU5A 2DEXX 3DTXA 5D7LB 4EN3B 1U8MA 2X38A 2YMTA 3F7YB 1WAAE 3F58L 4LVNB 5B1JA 2Z91B 5L8KB 3V9CA 2E7HA 2VE6B 3VI4A 3AXHA 3I6LE 4NKOB 1F1AA 4LP4A 1HQRB 3EJJX 1XGZA 1PG7W 3KYKH 4XP4L 5HPOA 5EUOA 4OJYA 4YBHA 4HF5H 4GINA 4LSPH 1S7RB 4PJCA 3SDXF 2WZ5A 4FG6C 3ARFB 2VSMB 3MJ8B 4D2NA 4XAWL 1IO4C 5I1GH 4F7MA 2JTYA 3LOWA 2GSGA 2VR4A 1ID2A 4GO9A 3QO0B 5GGRB 2AKRA 4YBQC 1U8HA 3CFMA 3MV9B 4WCYL 2D7NA 3VGHA 4AQ1B 3CVHB 1U2CA 2DWDA 1FVCA 1QG3A 2MPAL 2R4SH 5I1EH 2H1LM 4CBZA 1L3WA 2NNFA 4FTVA 1WFMA 2IDSA 4KO7A 2WWKT 1DEEB 1MFBL 2WLMA 1AS8A 3UPRB 2F19H 3AC0A 3BQVA 2DQUH 3KWXA 2UZPA 1X5YA 2UZXB 2ENPA 3K46A 3KPMB 4JM2A 4MJ5B 4BUGA 2W1NA 1LK2B 2VDKB 2NY4C 1ND0B 2UZIL 5E8EB 3QUMA 1HAUA 3HVNA 3GJEB 5KSBA 4JHAH 4DJMA 3ULUD 3GXUB 3RGHA 5IB5B 1JWSB 3IYLW 3KJ6H 5DJ6B 1N6QH 3C2AL 1RQ5A 2WJ7A 3LQMA 1UB5B 2XVKA 1LK3L 4M62H 2FECI 1Q9OB 4XPTL 3GRWA 1RIHL 5E5MB 1DUYB 3Q1SL 2D0HA 3SDAA 3TXAA 4DN4L 2ZP9A 1LVEA 2H26A 3CPLA 4PJHF 3UCRA 4XCCH 1D9KA 3NJGA 4PS3A 5C9JB 3CK0H 4B9ZA 1PVHA 3KYNA 4PRAA 5EBWA 1PQZB 2VSCA 1MAJA 3II1A 4GRLB 1NZRA 4BK5C 3HBQA 4GAJH 1AQDB 4TUKH 5I1DA 4QHNA 1AGDB 3RVVD 2HT4C 5EZIL 3KLLA 5ICZA 3BVNA 1YO4A 3RURA 1Y1DA 2VR3A 1B2YA 4NWTH 2PWDA 1E67A 4JL2A 5DRNB 3HCVB 2WC7A 1R5VB 1RFDH 5DQDH 1CU4L 3DVIA 4GOSA 1JFHA 3KPQA 2XZCH 4QNPF 1QI4A 1YSOA 3BXNB 5JYMA 3W37A 1YMHB 3UJJL 1FRGH 2PYEB 2JJWA 2IDTA 5T33H 2WLIB 1IAII 3NEEA 4WEUD 3KPSB 3TEWA 4WSKA 5E6IB 3LNHA 5AVVB 2HJLB 1X9RA 3EYFA 1PNCA 2CXKA 4PJAA 4XMLL 3V4VA 1H5BA 1FNSH 1TZGH 2AHIA 1I8UA 4HIJA 4FKEA 2JB5L 4DEUA 1AQKH 3IJYB 3O4OC 3ARDD 1UQSA 2LU5A 2XA8L 1V05A 3KXFB 5MENE 1OM3L 4Y4HC 1MJJA 5AYTA 4FXKC 4N0FB 1NCWL 3WFEH 3UG5A 5FF6A 4P23A 4ZQKB 3VXME 2V17L 1U8JB 1IGMH 1FV1A 4O58H 5CU5A 5SWZE 1KN4L 4QRUB 4KGLA 1ONQA 2WQWA 3D51A 4LLUA 3WIFB 5ABZA 4KITB 1UB6A 2A83B 3T0DA 3QJXA 5E8PB 4JS7A 1MHEA 2HKHH 3BSGA 4HJ1A 1MQKL 2VZVA 2XDHA 3UJIL 1YMME 4G6KL 5IQMA 2X4QB 4P46C 4DTGH 4XCFH 5K9QG 2AXHA 1DUZA 4QOKB 1HJBC 5DYFA 3HBZA 5IB3A 3DVNB 4A7GF 1ETB1 2XIIA 1AGBB 5FO8B 2YQ3A 2KMWA 4XB3A 3HMXA 2ITFA 5MEQB 2R2BB 3GYRA 2OMWB 4NO2A 2LAGB 2XX1A 1T5XA 4PJBB 4LEXL 3QUXA 3S36X 4A7UA 2GIXA 2J6EL 3PWJA 3U9UA 3WFDH 4LOVA 2GITB 2JH2A 4P2QD 1T2QL 4X4XB 1NL0L 5D4QA 3QWRD 4OZHF 2HVJA 3EFOB 3QORD 1BVOA 1B6UA 3LKPA 3S5LB 4F7PA 4E42A 1OANA 4QF1A 4L4TB 3SE9H 3LIZA 5KSAA 4FQ2H 4H5SA 2GSIA 4LRIA 4JPIA 2WQ8A 4AYID 1UM4H 4LSQH 4PJEF 4JPWH 1KN2H 2QDVA 1X5KA 2W0FB 1Q1JL 1BAFH 4NGHH 1I1FA 1AXTH 1G7LA 1KACB 3MLTB 4KDWA 4HIQA 1NAMB 3SDCD 5I1GL 4NP4H 5EOQH 1J10A 1RPQA 2Y07H 2JQZA 4DERA 1T1YB 3EOBA 5CGYD 4F7EB 4ELME 3BAYA 4QRRE 4AWJC 4M1CC 1URZA 4H26B 1QBAA 5CAYB 3OKEA 4MB4A 4L23A 4Y2DB 5FGCB 5DMYA 2Z8VC 3BEWB 3T65A 4KK5C 5AW4B 5A2IH 2VLKB 3ABMB 1T89A 2ZONA 3C8KA 3KLAB 3KWWB 5C09B 2Z92B 5BRZD 1ZV5A 5T1KA 3DK0A 1RJZA 3D25A 5K93A 1TEYA 5JW5B 3CX5J 4W9EC 2L4OA 4P2RD 5IREA 2YLHA 2RALA 4ORGA 5CFHA 4P46D 5D2NC 3O2DA 1S8DB 1EMTH 3FB8B 2DB8A 1MFCH 4KKZA 5JORA 4JHAL 5KYYB 3CN0A 4N8CH 3QULB 1DVFB 4HIIA 3KJ6L 3QG6B 3C6EA 5AKRA 3QZLA 4ANKA 3MV7B 1CLOH 5L4JA 5AENA 2SODB 3IFPA 4M5YH 2WBJB 1B4JH 4K94H 1QZNA 2J43A 1I3RA 3ULUL 4WKZB 1A8ZA 4Z7QF 4LNVA 4XCCL 1GVIA 1AYOA 3I6GA 5CIPA 5DFWH 1GJIA 3QVAA 2QADB 2YSTA 3V4PH 1FYTB 1VIWA 3OG4B 4H2CA 3RG1C 3TLRA 4R4BB 1EJ8A 4GBXA 4W81A 4TUKL 3H55A 1Z0MA 1TZIA 4LOFA 1CS6A 5C0BD 1KZYA 5DMKA 2AQPA 2VJXA 4FP8H 4Y4FB 1Q94A 3FZUD 4JBSA 5C0CB 2BSTB 5T3ZE 2YK1H 4YWGH 1U30A 4NZJA 3ZRCC 4OGYH 4OJAA 3WEAA 4UAOB 1RFDL 5DQDL 3UTPD 2OK0H 3NZHL 4OLUL 4YXLL 2BNRB 1SJEB 5HDBB 3MREA 5JOFB 2ZJSH 1USZA 1KB3A 5T33L 2ADFH 3BYYA 2APFA 3OWEA 1JZDC 5CP7B 2ADYA 4WWKA 2Z35B 1DANU 2WXHA 3KG5A 3BPOB 3MRMA 3WEXA 4Z7NF 2YAHA 4PTUB 4Q6KA 4IOFD 2MH4A 1LL1A 2NYYC 1JMXA 2BW5A 2WVVB 3CX5K 1FNSL 5J89A 3WJMA 3G5WA 4F2FA 2A9NL 2QKIA 1T20B 1T66D 3QEHA 2HVKB 2H9GB 3A5VA 2OM5A 3B6SB 3FO1A 2DQTH 4LSTH 5E56A 1GGCL 4YX2H 2MIZA 4HV8A 4GKSA 3D48R 2AK4E 5I8OH 2ODIA 4MNGB 3CC1A 4O58L 4PJFA 3QGVA 3FOLA 1VGEH 3WS3B 4MA8H 2Y6SD 1EHLL 4LP5A 1IBZA 3VFTA 1L0XA 1RPUA 5IROC 4ZX3A 4X7TA 2XQ0A 2XY2A 1ZA3A 2Y7SA 5D7JA 3F6JA 1E4JA 3Q3GB 1F86A 2B3IA 4U4IA 4OLYH 4XCFL 2IF7A 4J6IA 5FB8A 4X7CC 1CIDA 2KZKA 5GRYA 1BPLB 2D0FA 3VI3B 1C5DB 4LAJH 4L8DB 4FAAB 3SOBH 1CLYL 2PTVA 2VSKB 4TQIA 2QJDA 1H0DA 3MRBA 5HHOA 2IBZY 3T0VA 3X1GA 5JO5B 1ADQA 4G80A 1NPNA 3G6AA 3KD4A 5IW3A 2WUCL 1ZPUA 3GM8A 5KVFL 3EYVA 2X9YA 1AIFA 4ZXBD 2NTFA 2ZAHA 1DJWA 1RY7B 4ODWB 5AB0A 1L6XA 3NJJA 4CAGA 1GAFH 3OAYK 4GQRA 2AEIT 3H6JA 3PPSA 4IK7A 5I1LA 2A3TA 4IIQC 4A68A 4CJ1A 3JTTB 43CAB 4KRMB 4H8HA 5CEYB 4DPCX 4KOBA 2EP6A 3ARGC 4IOIA 4PAZA 4X5LA 4J5VA 4D9QD 4FQJH 4FQ2L 4N8VG 5T1MB 3RTQB 1DQKA 4APQB 3MRFB 4PGJA 4MAYC 4JFED 3EYUH 1ODAA 2WYHA 1UM4L 5FO9B 2EACA 4F80A 1J5HA 2L3BA 2NYYD 1BSIA 4NGHL 5DRXB 5KVDH 1HL4A 4AK2A 3FT9A 4GEIA 3MRJA 2NZ9D 3LN9A 4KNUA 4NRYB 5DJ0B 1KV7A 2JIXA 5EOQL 4DP2X 4NIYE 3TVMB 1YNKH 3P54A 4TVPD 1E27B 3NJIA 5B1KA 3S3BB 1CIUA 3VD7A 3FF7A 4G5AA 5KSVA 1JDCA 4JNXA 3RWHA 2WUBL 2UXTA 5IROD 2ZWZA 3H9ZA 4KPHH 2G5BA 2GBTA 5GXBB 5JOPE 5I73C 4FE9A 2PKDA 2ZUQB 1NBCA 4HJUA 4NUGH 4MLIA 1I3GL 3RX8A 3V6BR 1ZTMA 4GG6F 4PJGE 4OH2A 1PX3A 1K4CB 1KBVA 3I3EA 4AGMA 4N8CL 3AJ7A 2QEJA 1DFBH 2YD7A 4LCIL 2LLNA 2F53E 1IFRA 3NFPA 4M00A 1UXSA 1CLOL 2NQ3A 1RIUL 1QLRA 1TEFA 1H6UA 1SOQA 4R9HA 4Q9QL 2X1QA 3FHEA 5TE4H 4ZYKB 3VMPA 5GSRA 5DJ8A 2G5UA 2P45B 5IVZA 3S4SB 1W72H 3VXRD 3IFNH 4FG4A 43C9A 1DLFL 1P7KA 1JVLA 1UM6L 4NWUH 5A2AA 2C5DC 3ARGD 3NA4A 3SSGA 4BGDA 2E6JA 5EHFA 4Z7UF 3B4NA 1W9XA 2WCGA 3TNNB 1EXUB 4ZX4A 4QWWD 1PZCA 4KZDH 5E8NB 2YK1L 5CJOH 4EIBA 5C07D 3MLZH 3J07A 4OGYL 3BW9A 3CBJB 2P5WE 3OSVA 3X1NA 2I69A 4KTYA 5K1VA 4HS8H 4P99A 1XGTA 4FFZA 2J1XA 4GPVA 3V5KA 5B3NA 4HWNA 4OV5A 4JRXA 4GW5B 2YRPA 4NERA 2ZJSL 3FQUA 4GRWE 4OUOA 5IHWA 1KIPB 1HHIB 1LYQA 2ADFL 2CR0A 3QHFH 5CBEA 4J8RA 4F9PA 2JK5B 3VD0A 2IANA 2WXNA 1ZLUK 1WITA 4PJ5D 3UOAB 3FCUB 4OTXL 1XD0A 3GSNB 3STZA 1QLFB 4N6RB 1U6AH 3SB3A 4UZUA 1JPFB 1H3TA 1QR1A 1SN0A 1WAAF 2Q7NA 5DJYA 4FQXB 3F3HA 3SD5A 5I0ZA 1ZT4A 1YUHB 2AFNA 5INCB 4GAFB 1P7QA 4FNLL 5EC2A 2DQTL 4YX2L 4LLDA 4LSVH 5I8OL 5EIVA 2AJZB 3LKRB 5ESVB 4KQ3H 5E99H 3VFWB 1MI5A 3QXWA 5DSCA 2WM0A 1KBGH 1VGEL 4MA8L 1J05B 3NCEB 2VJ8A 1NCGA 1B0RA 1BX2A 2GJPA 3BO8B 1R33A 1RUAL 4YIQB 1EZUA 1TYEB 3H85A 3JV4B 1LO0H 1TQSA 3FB5A 4MJIE 4BIKA 3RWDB 1XH0A 1GY1A 2X1XR 3NIFF 1OM9A 1PZSA 3H4HA 4PWKA 4RFOH 3ULVC 3L5JA 1YQ2A 4PR5B 4HIEB 4J7RA 2Z6FA 3OAUH 2CO6A 4KX7A 3SOBL 2P24B 4XTRD 1U8KB 1X9LA 1F0LA 2EKJA 2DEYX 4HKZB 3APCA 4ZFZA 2BVPA 4UM9B 4W9ZA 4HQQL 1XF4B 4NO5A 1UH4A 3GUTB 1UCTA 1NICA 2J57A 3BZFA 5EPMB 3BUIA 2HJKA 1QBLH 1OGAB 3QISA 3WTYA 3T77A 4RIRA 3ZYZA 4EJ1C 5CP3A 5FDWA 2Z1KA 1T04B 2OSLA 3WTTA 3KYOA 2V5YA 3NJFA 3CNKA 1L5GB 4JLRA 3ARYA 3AQDA 4UQIM 2R1XA 5JIHA 1R3HB 4PB9L 1MSPA 2P8LB 1KJ2A 5FCUH 2UUDK 5FUOH 4K4KA 5DR5H 3OAYH 5HD8C 4PRHA 1XSOA 4UT9A 2OTWB 2ZP8A 4NQCA 3S35H 4L37B 4WU7B 3VW3H 4ONHA 3U1PA 1DL7H 4PJIE 3WLWD 4HP5A 1A8JH 1LD9A 2Y5QA 5ETUA 2EICA 2WBKA 1B0IA 1F4AA 1MCDA 1E4XH 5MEOB 1NGXB 3FO0L 1SEBB 5E1GA 3TBTB 3WMQA 2Z31A 2AP2A 4KQ4L 3FAXA 2R69A 4X0NA 5CEXB 3T0EE 1VACA 5C0AB 1SLXA 4JM2F 4JE4B 3P2TA 3ZHNA 1KYDA 3QEUA 4ANXA 1K5WA 1G6RH 2EIDA 2JLLA 2GHWB 4N9GB 5HDLA 3S88H 4YZWA 3LVEA 4ABUA 5H94B 5IF0A 4TQHA 4NUGL 1AR2A 4CSZA 2O30A 4OB5H 1R47A 1RK0A 4CVXA 4ZMPA 5J57B 1YG9A 4I0PC 3UBXG 1CPUA 4YDNA 1QPKA 5HDQH 3Q9PA 4D8PA 1RPKA 1LEIA 4JM2D 4I3SL 4QIRA 2B0SH 2Q6WA 5E24E 3C2SA 3ARBA 4XX1G 3BQUB 1U8QA 5TDOB 5D5MB 1JZGA 4ZFFB 2IBGA 1E3FA 4JFPB 4Y5VC 1UATA 4IRSA 2BCKA 5D96C 4HFWA 1L6ZA 4NDMA 3IETB 4U1IB 2L7QA 3OHXC 1ZA6B 4RZKA 4ZNEE 5E4EC 1F90H 3IDYB 3A6BL 3GWJA 2ATKB 4K3EH 5TE4L 2V2XA 3PNWB 3QJHB 3SDAD 5CR8A 4XWGH 3NAAH 2ESVE 1W72L 1IGYA 3EYSH 3PV6A 4PJ9B 4JHBA 4WQOA 1D9KD 3IFNL 3N9GL 5FA3A 3MNZA 4NWUL 2H32A 4XMPH 2B5IC 5TGBB 5J5EA 1ES0B 5E6YA 4XMXA 3C8DA 4F8LA 3OJDA 1UOWA 2L8AA 3OZLA 3IWVA 3CHPA 4RFEA 5TDPA 3QQ9D 4N2OA 3AM8A 3MUGA 3IKCB 3GGWA 2K9UA 5HD8D 4M56A 2CJSA 4WRLA 1EUUA 5CJOL 3F7LA 4H0HB 5M7QA 5AW9B 4EDXA 4EVNB 2FK9A 4RGND 3PHQA 3V9FA 4CILA 3QUXC 1RVFL 3PUUA 5DVLA 1BFTA 4EI0A 1MY7A 1NWOA 2H0PA 4AH2B 1QPXA 2FL5B 3L4TA 2JELL 1QASA 3L95B 4GS7B 2B59B 3MDJA 1MHHB 2CHWA 3QHFL 4NZ8A 4FXGC 2WN2A 3FC8A 3L3DB 1RURL 5KSAC 4P59L 4Y4KC 2F6AA 1OT4A 3IF1B 1WBZB 4QEGA 5D2LB 5D7KD 4DN3H 1JYVA 2TRYA 3C8HA 2F1BA 2K9FB 4KFMA 4CC1A 1A5FH 4J28A 4ZPTA 1DANT 3EYOB 3OL2A 4EIGB 1GJUA 1QSFE 5SX4H 1E4KA 4HPOH 1N5AA 3O8XC 2BVEA 4RMRA 1J0KA 4BHUI 4EDWL 1JNJA 2EE9A 4KQ3L 5E99L 4AT6B 3B7RL 3C5JA 3K4DA 4P23D 3X11A 2B16A 4YUEH 4AYFB 3FU7B 1ZANH 3WUWA 4OJDH 1KJVB 2YMXL 4GKOA 4DUVA 5F0JB 3Q8AA 1KGCE 2QVMA 2BS9A 5INDA 4B97A 4KI5C 5JXEA 2CRIA 2BIMA 4OJEH 4RISH 4GRMB 5CJ8A 3ALWA 1LO0L 1N4XH 3RZCB 5DYOB 5BV7C 5GRVK 4DP5X 4L1BA 3T2NH 1B4TA 3E9UA 4APXB 2XKSA 3WXVH 1FHNA 3O4LB 5DLLA 5GZNC 4OI8A 4CU7A 4N85A 1NUGA 3GZPA 2X4UB 3QDJA 5E8DH 3WEMA 2XBTA 3KL3A 1MLCA 4ZMVA 1FNHA 3FN9A 2KH2B 4KKCC 3ULUE 2B2XL 4NPKA 5K33A 1SGKA 3QJSB 2XPZA 4R2GC 4FFWD 1TTCA 5IFJB 3D2TA 4PLJD 4JFXB 1UWGH 4IBYA 4YLQT 1Y07A 5KYXA 4ETQA 1QBLL 3BGMA 5FHBH 3QUXD 4QHPA 4P5RA 1E7VA 3Q2LA 1HEHC 3ZT7A 3B3IB 3C60C 1XAUA 5C8JB 4E9YA 3TESA 3HHSB 2WKLA 1DVUA 3CXDL 5GGSA 4F92B 3I84A 3MR9B 4XXWC 3EFDH 1AZVA 4ZOEA 2AJYH 3GRBA 5DD1H 5HI3D 2X2IA 5F8QC 4LLQB 4M1DL 5DQJB 5KSAD 4GP8B 1NCTA 2YPVH 3EH5B 3VCLB 4JE0A 2EVGA 4AW7A 2G75A 2B77A 4IMKA 3QZWB 3VW3L 2Y5TA 4NUJB 3S35L 2QSTA 5FM5M 4TLKA 3HUJF 4NZDA 4HJGB 2OLDA 1AVAA 3DX8A 1D5XB 3BKYL 2FJGB 2XQYA 5C6PB 3ZTJH 1R9FA 3UTSA 4E5XG 3G5XB 2Y36L 2UUDH 2VZ1A 4XI5C 3N44B 1AXSB 3H1ZA 3G5VB 1M71B 1AR1B 2IAMA 4HCRA 4U0QB 4Y16B 1GW0A 1XF1A 5HGBA 1C7TA 3DX1A 1UVQA 5DHDA 4L8CA 5T1KD 1A4BA 1TEGA 4OB5L 5FECA 1A1OB 4Q9RL 3IDMA 3PLYA 1J0ZA 4O4YH 3V52H 3LPOA 4POYA 4L4JA 3VD4A 4NCC2 2B0SL 1ASOA 4YHLH 1G4MA 3OGOE 3LCYA 2QMKA 1WLHA 3MLWL 4YGVB 5IBTL 4Z7WE 2X0VA 2DJSA 5HPMB 1MFEL 3HAEA 3LZFL 2P7TA 3N1PC 3ULVL 3QC5X 1PY4A 3DO7B 1F90L 1UJ3C 2BY1A 3BOVA 4N0RA 4MMZC 4KVNL 1HWWA 2A0LC 2XWTB 3Q8EA 3QUML 3MLSH 2YAPA 3X3FH 3Q06A 2OMXA 4Y8AA 3ARUA 4XWGL 3N06B 1TO4A 3WFHB 2HG0A 3FMGH 2OMZB 3AREC 1K8IA 3ZSTA 4L3EA 4H25B 4I48A 1KXQA 5AW5B 2N4IA 4CDHA 3GRWL 1A4CA 4IS6B 1XSIA 3WNIA 1XBDA 1WC7B 4NRZA 4YL9A 2MQGA 4GBXD 3M88A 1KYAA 1JZ4A 4KUZH 1PCXA 2ORBL 4CA4A 3OV6A 5KVFE 3VFPB 1GGIL 4HZAA 4J8QA 2YPKB 1O5PA 5D7SH 1Q8MA 5IHHA 4PM1A 2ENQA 2NW3B 3P4LA 1M7UA 1F3JB 1U9KA 2YRBA 4IJ3B 4JKWA 3VQMA 3CN2A 4U33A 1NCUA 3SPIA 5HDOA 2IWFA 4MRBA 2NY6B 5FYKD 1AD0A 3CHXA 4I0KA 3FNKA 1KBWA 2P5EA 5F1NA 8FABA 1AY1H 3IMWA 5IQ7L 4P2OB 1E4WL 4PW9A 3JV5A 4P2QE 4AQAB 4KK6C 1R24B 3TBVA 3SBWC 3AXLB 4WWKD 2GSMB 1D6EB 2Q8AH 1NBYB 3DRTB 5FA4B 3VQ1C 3FSAA 4LSRL 2BNQB 2DQFB 3ZKNC 2BP8B 4AI7A 5I19L 3VH8B 5DRWA 2EDLA 1TYJA 4ZO7A 2TAAA 2QVTA 1QA9B 3OKLA 3HOGA 5F7MC 5HGHB 3TS8A 3EOAA 1P4UA 4N0CC 3V4PA 1R3JB 4L9DA 1R3IH 3F6LA 4ZS7H 2ED8A 1HI6A 1G94A 1XIWB 4PJ8C 1E5CA 1Z32X 1XGYH 3D3VB 5A7EA 1EEQA 1I7RA 4KKQA 1ZAGA 4KH2A 3ECVA 3V4VL 3CH1A 3TM6A 2VO8A 4W6WB 2WXQA 4CW1B 2X2HA 1ACYH 3FT4A 5GS1B 1X44A 4CVZA 4KY2A 3HNVH 3R06A 5J13B 5IHLB 4WV1B 4X9BA 4Z7OE 1IAOA 5HHQA 4RVBA 3SIKA 4H8WL 2X5PA 4O02B 4WW2C 5D7JD 2GY7B 1CF8L 5BRZE 1IC5H 3WY4A 3WXVL 4K3DH 4N3UA 4I77H 1HKLH 1AMYA 1GS8A 4S0SD 4ZMAT 3CFTA 4U05A 4J39A 3W9DB 2B20A 4P2RE 4XX5A 1KT2A 2JCCA 4N2BA 5FYLL 5E8DL 3TN0C 3KPLA 4P04A 9PCYA 1RJYA 5DUPH 3KLKA 3HE6B 1NMAL 3IMRA 2LHAA 1A6AB 4PY8I 4RZCB 5HHOD 3ZVVA 2J8UB 3JWOC 1KBPA 3GNML 4TVUA 4YEEA 5I8KL 3WTXA 3P4MA 1UWGL 1FVDB 4B0MM 2EDRA 4R5VA 3V7AG 4YS4A 5I17B 4QHMB 1JBJA 1FORL 1OSZB 1ULVA 3QO1B 3HZ3A 5E6RB 5D1QA 5EO1B 1FO0B 4O5LH 5AW7B 1UGKA 4U7MA 3HN8A 2DI9A 1TETL 1PZ5B 2F15A 3GBLA 2AJSH 2Z1PA 4DOHB 2XC8A 3QDHA 4LDCA 3U0TB 5CZXD 2UV3A 5C0BE 1DBKH 3PWNA 1IKNA 1GSKA 3LIZL 4IOSA 4J23A 2ZXDA 4GAGL 4BGLA 5HHXL 3UTTA 1HCZA 2JIXD 2XN9E 3E1ZA 2Q86B 5EFIB 4D3CL 4LVOB 4AEHL 3DROB 5BZDA 3V0GA 4MS6A 4KDVA 1DVYA 2XWDA 3AWFA 3Q6FA 4ODXA 3UTPE 3VVWA 5ISZB 1HYSC 5GS2D 4H8VA 4OLWH 3TIEB 2GJZB 3P9LA 1Z2KA 2XTJC 4JY6A 3NCYS 3QZPA 1E3ZA 3LRMA 3IXAB 1NGWB 1SDDA 4TSCL 1RHFA 4Y1AA 4DWHA 2CLRB 1HSBB 2YGOA 4HD5A 4X98A 4OZIE 4Q8BA 1NC2B 3DOHA 3HBGA 4KY1H 5EU3A 2QVKA 3DVGB 1LHZA 4NKIH 3AAZA 3AY4A 3MYJB 4JO8A 2W65A 2C3WA 3NRQA 3ZE0E 4YHLL 1MH5A 1OOWA 4LNRB 1JF5A 1DVSA 3D69A 3ET9F 3DX0A 5BV7L 7FABH 4PTTA 3Q13A 3EJSA 5FKAB 3V7AE 4YHOL 2Z34A 4MMXB 3II2A 3VYPA 2COVD 5BW7C 5I6XB 1FFNB 1NINA 5FHAH 4UILL 1A7OL 5ITBL 4CMMB 2NR6A 1MLBB 1T4KB 3MCKA 8PAZA 5I24A 4KTGA 1RZ8A 1Q0XH 4AIZB 1XEUA 1LGVA 3AQXA 3PJSB 1II4E 4WJKB 3B83A 1GPOH 3FRPB 2AQ1A 2BWDA 3IDUA 3O0RH 3OF6A 4YDZA 5HY9B 5JLZB 3SDYL 1COBA 3RNQB 1QPPA 5JQIB 1JPEA 2IH8A 3A67L 3ZYJA 2NXZB 1CT8B 4H1LH 5F1OB 1XF3A 2DYPA 2EXYC 1DBBH 5KJ7E 4YDVA 1EV2E 2DWTA 1YPZA 4HKJB 4K8RC 2UZYB 4RQQA 4DW2L 4HIHB 4HKBA 3G5ZB 1Q9LA 4HLZH 4ZAKB 4JRXD 3EZJB 3GFUA 4FQIH 4TNVF 5C9KA 1X7SA 2A6JB 4Z7AA 4JQVC 1LDPH 1KSRA 4G3YH 3IJ7A 5AOJA 3MRLA 1EFXA 5C0EB 5IJKC 4K71C 2BJML 2IAND 4YHPB 5GJTH 3G6JF 3T04D 2X7LB 3F2LA 4JHVA 5KW9H 5LKNA 1H6FA 2FH6A 4IU3A 5D4IA 3HW7A 4LCYB 1JHTA 3ZDYE 3TFKC 4JFEE 4BFJA 4Z3GA 5BS0A 3JBG7 1Z3RA 4A6YH 1GTNA 4OBRA 4NT6B 1AZBA 2BOCB 5A43C 5IIEA 1GGYA 1P7QD 2P28B 1XGYL 2DD8H 3APNA 1U8LA 1MIEL 2E7BA 4OFYA 3QS3A 2CUAA 4I7ZC 3VGDA 2D3VA 3KPPA 1BYOA 5I0XA 4MXVE 3E3QC 1MI5D 5FOBB 3UJTL 2Y72A 1ACYL 2W8CA 3CSFA 3HNVL 5E9DB 4M48H 4OIIH 2VABA 4HAGA 4NLAA 1XXFC 4XAKD 2R51A 2VC2B 1RUQL 4W9FC 5E94A 4WO4B 4LCCA 4ZNCD 1HKLL 1KCLA 3FSZA 1KTDA 3QUHA 4MNQA 1T7YA 3P2DA 4M4RB 4F7TB 4MCNA 1XGPB 4NOBA 4MQTB 1EZLA 1VPOL 2ZWYA 4MTMA 4F33B 3GK8H 2ZUYA 2UWEA 1N59B 4QRSB 1NDMA 4WFED 3QCTH 1OO2A 1A7PH 3BESR 1BF8A 3AABA 5GGQH 1JV2B 2JI1A 4CVWA 4JJ5A 4NQSB 3MA7A 4I18B 4OLEA 3KNBB 4KRPB 3OLEA 4WNQA 3BAEH 4JFYA 5EA0L 1IFHH 1LNUA 3P73A 3US9A 4K8RH 3CCHB 1X7QA 4XBGA 5LBGA 5IJBC 1NBQA 3BE1H 3RUGA 4FQQB 3WXWH 3TYGL 2AJSL 5AOZA 3IJHA 2VDNL 1A4JA 4LK4A 2YFNA 4PRHD 2XYCA 3PQYE 3F7PC 4NQCD 3LN4A 2YARA 4OD3L 4G7YH 2FBOJ 1MCNA 1C08B 4IBQA 3SCMA 1TCMA 3IMVA 5IB4A 1DR9A 5C07E 4PW4A 2E4TA 4DGWC 4I9XA 1CK0H 2TRHA 4LBEB 5J1SC 1EXHA 2Z31D 2FSEA 3VXMB 4OLWL 3WE1A 1N18A 1S5HA 2FR4A 2ROXA 3T4AB 5B39B 3GI8H 4TUOB 3W9EB 5E00B 3O2VL 3GKZA 3W57A 4MXWL 5A3IC 3LKNA 4JG5A 4EZKA 2I27N 1YMMB 4NKIL 3LZLA 4FOMA 4PJ5E 3X12B 5MEPB 4JFOB 4I1NB 2NCMA 2AAAA 5EEWA 4R0LA 1ASQA 4OM1H 2HFGH 1QUPA 3BEVA 5DMIL 3WEOA 7FABL 3ARBD 1QO3B 3V6OE 5JNYB 1P5UB 2QV4A 1ICTA 4IRSD 1S9WA 1I75A 5KVEH 3VD2A 1X9UA 4TNFA 2MSPA 2LTQC 3RVTD 5L4FA 1F2XK 2VLRE 4P4KA 4PJ7E 4KXDA 5JW4M 4QXVA 4GG8B 3GUFA 4ODSH 4NRXA 1ZGLM 4FNPA 4BRVA 3B9KC 3G9VA 3JWOL 4JDZB 4PJXE 3ZDZE 3AFLA 4HJJH 1SYSA 5D93B 5I18H 3HE7A 3KE0A 1DBML 1EJOL 1GPOL 3HZKB 2XFGB 1EPFA 2OTPA 3O0RL 3MRHB 1XSKA 5E2VH 3OPUA 4NKDB 4OCRH 4JVUA 4ZSOA 4YSOA 2E47A 4K7FA 5DT1H 4E9TA 4PGEA 4B9GA 1SJHA 1RP9A 2AV7A 4JZOA 1MRFL 2X89A 3OR7A 1DBBL 1WA2X 1WK0A 1R3LB 1RIVL 3O6LH 4QYAA 4X5RA 3DTDA 3VSQA 1B3IA 1JWUB 4AEIL 2N59A 2W94A 2ZTBA 3EF7A 3U82B 4ELMB 3KBHE 2HLEB 4UQBA 2K6WA 1CBVH 4B5EA 1LDPL 5CUSL 4G3YL 4J3OC 3KH4A 4YDKH 3VA6A 1M1XB 5I1CL 4N0UA 1DE4A 2VLMD 3QXVA 1ZVYA 3QFJA 4WIQA 2X44D 1CFTB 5GJTL 3VXUB 4ZMZA 5CD3B 2PO6C 4MLSA 5KW9L 3VI4E 3US0A 3WFZA 1CL7I 4A6YL 5HGGS 4TQ8A 5DI8B 4AQOA 4XGZB 1Y0LB 4HMCA 4XZUB 3DV6A 4PJCE 4M7LT 3NRPA 4X0KA 3V0FA 1IC4L 3IDIB 3ZHDA 4LVNC 4LVEA 4TNWK 1UXWA 1TCRA 3U36A 3RFZC 3ARZA 4BQ8A 5DFVD 2W9DH 3NK4A 3N40F 2QKSA 2ICES 1QYGL 5JXED 1ZK9A 4KH9A 3OGCA 3VM5A 3N43B 2JSFA 4AJ0A 3S2CA 3AT9A 2DJ4A 1BMGA 2YR3A 3D6GA 3GDCA 3QI9B 4A7SA 1HL5A 2IDFA 2VMEA 2ZSWB 3ARFC 2I32A 3WY2A 3FT2A 5AVWB 1BVLA 2R29L 4IMLB 5ICXB 3RDTB 3E7JA 4XN2A 4C59B 5IQ9B 3EIFA 3QUKB 2D03H 1AACA 2IDUA 4Y9FA 3ULVE 2H0FA 1SF3A 1A3QA 3QDJD 4KMTH 4AQ1C 2XTSA 4MDIA 4WI4A 2VKWA 1X9QA 4LXFA 1JVOA 2AVFA 5KSBE 3SPHA 1GOHA 1PMYA 3L13A 2QGCA 1EJ6A 3HKZA 3QCTL 5D1ZC 1IQWL 4RAUA 1IILE 4U4BA 3CFBB 3V6ZA 1F6AB 4ENEC 3EJCA 4MASA 2CKBA 3UZQB 4R3SA 3K8LA 4BFKA 1DBJH 4ODHH 5E03A 3RJDA 5HYFA 3BIAX 3IM1A 2J4WL 4H44C 1LP9A 5LBSL 3NP3A 1IFHL 5T1DH 5CGMA 1G7HA 5L9DH 4I4WB 4K8RL 2JJSA 1N2RB 1PDKA 3BAWA 1JF1B 4J3OD 3BE1L 3ABZA 3D06A 4NZTL 4PGDB 1U8OA 4N2KA 4UOQA 3VFMB 5IB2A 2FRGP 4PBWD 5GRJH 5DA4A 1UT9A 1IGJB 2ZCLL 3QXDB 2DYSB 2PW2A 4XPGH 2Y1ZA 1KJ2L 4HMDA 3LQZA 1F58H 1CGTA 3LH8A 3GSQA 4IRJC 3ZDZB 3ARXA 4ZO6A 1L9NA 1UXLA 3BD5A 3OMNB 5HTSA 3TA3B 3UTSD 5SWSA 2PCXA 5C0JA 2OXHA 4B60A 1T0NA 2IAMD 3VFOA 5IBLC 4J1UA 1SBSH 5CZVH 4ZOBA 4G1MA 2B3RA 1DQJA 2GAZA 1C1EH 2F8VA 2HT3D 5HHNA 4JY4A 2OQJA 4YNYB 4KRLB 2XICA 5JW4N 5D7KE 3FU6A 5C0DA 5DK2A 1YN7B 1E2WA 1RH8A 2NY1C 1XR9A 4U3CA 3INUL 4PJAE 4QRBA 5KS9E 1K4DA 2O61A 4XVJL 1FJ1B 5A6IA 4OZGA 2J25A 2J2ZB 4OCXL 2NZ1A 1YYLH 3WLBB 4Q7DA 2LFGA 1GMEA 1LM8V 4X6BA 1U95B 4A2EA 3RKDD 2YN3A 1FLTX 2RA1A 3QBTB 4FXTA 4BSVA 1KLGA 3FQWB 3QDME 5J12B 2BRQA 4UTAL 1CR9L 3MBEA 1XTMA 3CVHH 5E6IC 1SVZA 1I85C 3B5GA 1QSVA 1FGNL 2F1EA 4WEEA 3DC0A 5I18L 4L3ED 2OR7A 1XGUA 3N0AA 4QRPA 1D5ZB 5FYLE 5E2VL 4HK0A 3HIZA 4OCRL 5DS8A 1KCVH 5CLXA 4ZMNA 3CDFA 1HXYA 1YJDH 5DHVH 5DHYB 4W9DC 3ML8A 3OKOB 1EEZB 5AFAA 2R2HA 2K7QA 3F64A 3V0WL 2VDKH 2ED6A 4G72B 1PLBA 2MRYA 3OHMB 4Z78A 1XF2B 4KOCA 3PP4L 2OX5A 3GO1H 2WQRA 3H3BC 4WJ5A 4IRJD 4DGIH 5I2IA 2B4CC 2NSMA 2OR8A 2P5ED 3IPBA 4MMYA 1IUZA 3K2IA 2EDQA 3Q2VA 2Y3AA 1A7RL 5I1IL 2HRGA 2ZCKH 1VHPA 4FMFA 4YDKL 2XT1B 4YDMA 5PCYA 3RDJA 3Q48A 4XO8A 3NOIA 3ES6B 5TPWL 1KEGL 3Q8FA 4XP6H 3ECWA 4G6AD 3VWJB 3BD4A 4R7XA 3CDZA 3O6FB 1FNEB 3JWDC 4OFKA 3KYAA 1URLA 1H19A 3DVFA 4AL8C 1KXTB 3WNNA 4PREB 2VN7A 1HZLA 5DVMA 1FNFA 3GXMA 2F53B 3QJFB 1A02N 4Z5RB 2CLVA 3SJVB 4HCFA 1HINH 4MDJB 5ESAB 2DF3A 2W9DL 1ZKAA 4KHTH 5GISL 2MNUA 3UTZA 3BD3A 4HX1B 4KVPA 4YHIB 1MCQA 3SYPA 3JTBA 2JCCF 3X2QB 5EUKA 1E5UI 1BQKA 3VFGH 4G7QB 4N8VB 1LWRA 2FD6L 2XWJA 4IW4C 1AC0A 3JUZA 4KI5E 1OOAA 4WU5B 2CPUA 1RK1B 2CGRL 3H7LA 3IU3A 2ATAA 2EQDA 4MWFB 3VWKA 3WHXB 2HRHA 1EANA 3HRZA 2BMKA 3NQKA 5FPIA 1BQSA 1ZLSH 3SKNB 4D7PA 2CO7A 2QPEB 3C5SB 4Y2DC 1UCBH 2X4RA 2YBGA 1CGVA 4NNPH 1ECZA 5C0RH 3RL1A 1BREA 3CX2A 2P5WB 2WTOA 3I50L 4HHAB 4U7SA 4AQEB 1HESA 3RP1A 1DBJL 3S34H 2YGQA 5F88A 3UAJA 2W60A 5I8CB 4RFNC 4GRWB 5T1DL 3IBOA 5L9DL 1HZHH 5F1SA 5K69A 3BIBX 3MRRA 2Q2EB 3PABB 2YSSB 1KELH 2A73A 1HQ4A 5ESQA 1Q9WB 1QNZH 2ZOLA 3FAWA 3L3HA 4ZODA 1QKZL 1RJLB 5GRJL 1CGXA 1JXDA 1NFIB 3QJUB 5HJDA 4B9CA 1U3ZA 4URTB 4X4YA 4M3JA 4XPGL 4Z3EA 1F58L 4FZ8L 4IOSD 1N7ML 1E9PA 1KGUA 3QR1A 1SHWA 3JV6A 1DQDH 5E2WH 1OD9A 2EAEA 2ZWSA 3AMKA 3QIBB 1ZMYA 2FX9H 4JG9A 4BDVA 3O3BB 4JZJA 2IPTH 1E5AA 2YKLH 5CZVL 2DH2A 3GMPB 3OM3B 3UTOA 2CJUL 2WQVA 4FGMA 3LJ3A 1IMHC 4Y1AD 2OSWA 4OKDA 5J6HA 4R96B 1V54B 4Y4FC 2OZ4A 1BZDA 4XPFH 3EOTH 2C1PA 3KAAA 4L8BA 4MJIB 1UOVA 1E9QA 1PY9A 4HCRL 3BZEB 3ZE2E 4YHYC 2NY2D 3W1ZA 1JNNL 4U6YB 1VERA 3C5ZA 4WFFE 3LDBC 1AG0A 4UM8A 2A74A 1SUJA 5AVUB 2EILB 1N0LB 1SZNA 3QQ3B 1NCCH 3PL6C 4OGXL 1U91A 1JNLL 1ECYA 4NCDA 1QQDB 4WTWA 1PZDA 2E9BA 4UU9B 1R3KA 5AW6B 1CURA 4O2FA 2VDQB 4PJFE 4QY8A 2IPUK 3BPOC 2ZYRA 4HUWA 1WCBB 5L4MA 1MRDL 4MYPA 4Z77A 2MCAA 3JVGA 3ZY7A 1IZKA 3CVHL 3ECBA 3ABKB 3SQBB 1INEH 2BNUA 1DLHA 1WIPA 2NR6D 2DQIH 3E2HB 1TZAA 4MA7H 3BP5A 2BSEA 4YXHL 3PGCB 2XRAH 1KB9J 2GFBA 1D2PA 4HIXL 2IWGA 3D7PA 4UV4H 3D08A 3OF6D 2FWSA 2BHUA 2NNAA 1QWUA 1K85A 1FSKB 3LV3B 3OR6A 5EEYA 1QNIA 4TM9A 3MFFA 2VDKL 4W9IC 2EIKB 1E9OB 2Z4TA 3EFFB 4GW4B 2IQAB 4K7PH 3ATFA 2VGLM 4DGIL 4DP4X 3O0LA 3WHE0 3GMRA 1Z3GH 4G7VH 2QR0B 3CMOH 4ESKA 1TFPA 1O75A 3C12A 4LLVB 3T0EB 4R7DA 1HK6A 3HBPA 2IH3B 4W4OA 1N3NA 3BRDA 1AP2B 3U25A 1EFXD 5CBAB 2ILLA 3HPJB 3ISRA 3SDDA 4X4ME 1E28A 2WWMC 5EBLA 4BFBD 2XZAH 2X4OB 1TQCB 4IKLA 1BLIA 2BIOA 4G6FB 4H8PA 5BS0D 1S7TB 3GMOB 4ZPVB 4G7RB 5AB1A 5C7XL 4PRPA 5IEHA 1RULH 1JSYA 1VDGA 2JF1A 3G08B 4E2OA 1AKJA 1FZMB 2F8OA 2CE6A 4BH7A 5CM1A 4HLZG 2DQDH 4QTHB 1IIIA 1HINL 3K6FA 4OFYD 1CD1B 2ZUWA 3D9AH 3V79C 3N0PB 3DBXA 2XWBB 4EUPA 4B3VA 1AHWA 4XVUC 1M05A 3MJ7B 3RU8H 1JK8B 2KUTA 2DWEA 1JPSH 4APQC 2EE3A 2WB7A 2AV1B 2W92A 4H1LA 4YDJA 5ALBH 4HULB 4PWIA 4JANB 4U1GB 4W6YB 1I3UA 3ELQA 2O4EA 2ESVB 1MWOA 3ZYIA 1PYWA 1WE5A 3KGUA 3EGSB 1C12A 4HEME 3MV01 4ISVB 3DHUA 4RA0C 2GTWB 3NH7L 3ZDXE 3UEQA 1HDMB 4WI0A 4BUQA 4MNQD 4UYQA 3K7UA 1KB9K 2K4WA 4EIZC 3QCVH 2AABL 4UTCA 4QLWA 5IESH 3DMMA 3LS5H 1OAZH 2XVLA 1UCBL 1VFAB 4NNPL 4GY4A 3L3JB 2Y25A 1P9MA 3RWIA 3RUGF 2X2JA 3HZVA 2ZUQC 2AJ3A 4JG1L 1GMIA 2WZPA 4H13C 3CUPA 2GPZA 5IZ7A 5A6MA 1OTSC 2OP4H 1HZHL 5IHUH 3VSVA 5KYWB 3ZL1A 2VLLB 4L0YA 5TH2A 1OF2B 4HZLB 1NFDB 1KELL 2B4CL 1CE6A 3IRZA 4IGBA 5HGAA 2CM5A 3UTQB 5CLWA 1QW8A 5DLMH 1JGDA 2NUPB 2APTA 3E9TA 3V0VA 3M45A 4RAHA 5MERB 1J1OL 1QSFB 2GIMA 2IQ9H 3DRQA 1JWMA 3BKMH 3SCMD 4CADA 1SXAA 2FWLB 1KIRB 4TQEL 3GKWH 4CKQA 4S1DC 5LNDA 3JWDL 4XPHH 2D9CA 3BSHA 3EGDB 2YQ2A 3R1GL 4H20L 3RY4A 3GBNH 2P8MB 4ZI8A 2HN7A 4JFFA 4XVUD 4JRXE 5EORH 3IMUA 3W11C 4AL8L 4DGYH 4YBLB 4AXWA 1Q9KB 3ULSA 4TV3A 2GTZB 2XTJE 5IV2A 3K0WA 3K4ZA 3S3SA 4XPFL 3MJ9L 1T7VA 3SO5A 3FCTB 3HC2A 2IANE 4I2XA 3U7YL 4HOMA 5CINH 1BFOA 2FX7H 3EYQD 2BC4B 4PRBB 1DHKA 1MVYA 2EYTA 2APVA 1U0QA 3AUVA 4KZ0A 2V37A 1S7WA 1YYML 5FO2A 5AB9A 1GGUA 1GZQA 3OKMA 4ZZFA 3MBWB 2EDYA 1OTUC 3D85D 1IRAY 2GBUA 1I9RL 2WQUA 5CN2A 5E8OA 2DM4A 2HTLD 3DURB 3BRGC 4LARH 1D6VH 1F3DJ 3BUYB 4QXGL 3KH3A 3GHEL 3L4WA 4P4KD 1BQHG 4NAQA 4YR6B 3DX3A 5CMAA 5JPMA 4MCYB 3BP6A 3GJFA 4NZFA 4PV8A 2DQIL 4QXUL 4JDEB 5DD0H 1UOKA 1JFQH 4N2MA 4NO3A 1JD9A 5J9PA 3BIKA 1OTSD 2GJ6A 3T1FB 1IIKA 1F6FB 4XAKE 2XRAL 1T1WB 3TBCA 3T8XB 3HN3A 4O9HH 1JUFA 4FYRA 1BZ7A 3BMVA 2G4EA 4LPTA 5IW6B 1OALA 2IGFH 2Y2YA 1J0IA 1BD2A 3L3IB 3AG3B 3NABH 1XZ0A 1K2DA 4L9LA 5ICYB 2IV9A 2YD4A 5A16B 3GSUA 3N42F 2X89D 4FJZA 2Q8BH 4WGKA 5JR1H 1K6QL 4ELDA 1WFJA 2V9TA 4K7PL 5EU6E 3ZU8A 5C0NC 2X12A 1CICA 4JM4L 4QTFA 2VDOB 2OMTB 3OSKA 3I9GH 3SGKA 3CMOL 1OCWL 1ZVSB 1QBML 3L2LA 2ZX5A 1F4WH 1WUZA 3MNWB 2H3NA 4H4NA 5TF1H 1OD7A 3SKOA 1MCHA 4LKXB 2PP8A 2ZKMX 2G2RB 3BH9A 4NHUA 4Q2ZB 5F21B 4GSRA 1MCJA 2VLJA 4HS3A 2P8PA 2PXYA 3BUBA 3QFJD 1CG9A 5CHNA 2XZAL 4DESA 4AVHA 3UAEA 4UQ3A 4G9DB 3L48A 1SYVA 1YEDB 3H8NA 4X6DE 4L29A 3B56A 1HEZA 2AXFA 4PRHE 1Q72L 2GHZA 4NJAH 1RZGA 3WCYA 1BQ5A 4HJTA 3NJKA 3NFSH 5I6PA 3BWAB 2O6PA 4LOUD 3SQOH 4FX5A 2DQDL 4XNZC 4Z7WB 3ARDB 4G8IA 3BI9X 4HWEL 4OBSA 2EDNA 4Y5XC 2HJFB 1OHZA 2VIRA 1JZ6A 5EF1A 1QFOA 1XL6A 3RU8L 4MD0B 3EZ8A 4C55A 1CLZH 3GXDA 4LLMB 1SLUA 2R9HD 3E3QE 5ALBL 2YXFA 3FQTA 2JKJA 4PWHA 3BFQG 3GM0A 2P1YA 1PY0A 4WUUA 5B4MD 1PS3A 1T6WA 3BVUA 1FPTH 1Z66A 4RBPK 3CDYA 3ILDA 4AYSA 5L4IA 1T0MA 4IBUA 2ZX9A 3BT2L 2Z93A 3IU4H 2CIKB 4K5MA 1PEZA 4UZSA 3GSNH 5D55A 1BQUA 3V55A 3QCVL 4F8NA 1AGEB 4OD2B 4P4RB 5J6SA 5EBMB 4G42A 2XNAB 1S5IH 5FIEA 2SEBA 1EERB 3Q2WA 3QEQE 1EGJH 1FL3B 2ADGB 1M4KA 2JV6A 3FOMB 1A6ZA 4E5XB 1V7NH 5JDSB 5L8JB 4OGQC 5C0ND 1A14H 1ORQA 1U3HC 5DZAA 3ESVF 3FB6A 3IJEB 1A9EB 1I4FA 4NM4H 1WVZA 4TF4A 2JJTC 3ZHFA 5HYSA 1XWVA 4M7JH 4P2QB 3L5WA 3VJ6B 3UC0L 4DGVH 4LRNH 4NQDA 3QORB 5DLML 4PVMA 4XXDA 3IDJB 4TQPA 4HETA 3MFGB 1SY6L 4OIAA 1KPUA 1QSEA 4LCWA 4ACTA 4DFIA 4PP2B 2C3VA 1TNNA 3QJOA 3K8KA 2IQ9L 2Q0ZX 3IDYC 2E7DA 5IMLA 3OQRA 4GI6A 4LL1A 1KCKA 2JKWA 1HH9B 3U4EA 1AGCA 1C8QA 4TOYH 1QX1A 1NANH 2WGXA 2Q7YB 3BCDA 3SDCB 4DSYA 2AMUA 5C6TL 3U4BH 3QZBA 1U93B 3GBNL 5B21A 1EO8H 5SWSD 1PZUB 4OJCA 4Y4HB 4FXKB 3PWPD 4M43H 5AVQB 1I9JH 4ZO8A 5BO0D 1J86A 4PJEB 4Y0GA 1FH5H 3DXAD 3GBEA 4OQTA 4OZGF 3CSYB 1JK9A 3WG7B 4KNSA 4XMZA 1BAWA 2AANA 5DK3A 3AG4B 4UDUA 3ABLB 5CO1A 5HHPB 3L5XH 5J6GB 2GEQA 4X4ZA 1OWWA 4Z7VE 5BRZB 2YS4A 3VXPB 3RY5A 5FW7A 3GSXA 4WJG3 3NG5A 4XZ4A 3C6LA 4J3OG 5JYLA 3FTGA 1F13A 3WJJC 4KZCA 4P2RB 1EIBA 2ZUTA 5JA9A 4P46B 4XO5A 3POHA 4PP1D 3LAFA 4C56A 2J1ZA 3VFNB 2X0WA 4OLVH 1Z0NA 4NNYA 3EGXA 1D6VL 4EO5A 2DMGA 1I31A 1PG7H 5T5FH 1HXMA 1WFUA 4FF9A 1YEGL 3MROB 5CCKH 3MBED 2A6IA 4XP5L 5F7FA 2VOTA 2AJXH 1U3HD 4ABWA 3KVDD 1FNAA 1N8ZB 1Q0YL 4WTXA 2G60L 1YC8A 2BP0A 4W93A 1IT9L 1YDPA 1YY8B 4O9HL 2EYSB 1B4LA 1FCGA 5HDRA 2XACC 5I1HH 4UDTB 4YHNB 1KFAL 3LQAL 2F54D 3HMWH 4UNUA 1MCPH 1WICA 3P77A 3ZE1E 4A1RA 3UERA 3NZ8A 5FUZH 1KCUH 2OMUA 2Q8BL 5FR3A 1QHQA 2FGZA 2HA1A 5C0BB 1JD7A 4EN3A 5D7LA 5DGQA 3U7WH 1VCBC 2HH0H 4GSDL 2B1AH 4JREC 2XN9B 4OD1L 2Z91A 4YFLI 2CLZB 2NQCA 1IGTA 1RZJC 1FFOB 1T7XA 2VE6A 5KWYC 3QRLA 4M6ML 4OF3A 5FK9B 5LBVA 3CN4A 5C0FB 4L1HA 3ATBA 1EAJA 2V3FA 3H3KA 3N91A 5IHZB 2QELA 4PG2C 3SE3A 4DO5A 4N26A 2IG2L 4BYHA 3R8BB 3D09A 4JY5H 1KEML 1AD9B 1HXKA 1IC7H 1S7RA 2EJ1A 3OAWA 2FEDC 4NPYB 3SKMA 4DHLA 4OZIB 2BIIA 3WSQH 4AUYA 3ATEA 5HDWA 4U1SB 3WN5C 4R4NC 1SQMA 3LKSB 4P5KA 3RQ3A 2WPGA 4UTBL 1VENA 2IXQB 3BVWA 4GQ9H 4PRNB 2EUWA 4I3GA 4GQPH 1T3FB 3ZE0B 5K9JH 2WAQA 5ILTH 3NFSL 3LSOB 2R7EB 3SQOL 3NPSC 2X6UA 5GGVY 4JFVA 1DEEA 4ODVL 5FYJU 5JIDA 1CD9B 1EZVX 4PWGA 3MCYA 2J88H 3ZUNC 4CC4A 1A21A 3O6KH 3FHAA 4N24A 1NEZA 1SUHA 4ZMTA 2LW3A 3KPMA 5ITFB 2FDBP 5F70A 1QFWH 1FZOA 1LK2A 1FIGH 1ND0A 3QA3B 4JFQB 1FPTL 1LO2H 3O3DB 5GRUL 5GJSH 2LR4A 1B0GA 1V5JA 4NZUL 3T6WA 1MHCA 3ZZSA 5ADOH 5GQBA 3WDHA 3QQNA 4HWBL 5CILH 2UXGA 4E9WA 4ZMWA 3IU4L 5I8EB 1QAWA 1VAHA 1Q9OA 3GSNL 4TN9A 1RZ7H 4JPQA 3HS0A 1QWNA 1F3DH 1P53A 5IGXL 1AJ7H 2ATPA 1RUKL 4Y16C 1S7SA 1QD0A 3MUUA 4GUQA 5C9JA 4IJTA 3DNKA 2FYYB 4KTDL 5J06A 2XPGA 2WLLB 1A14L 1G9NH 1PQZA 1LEGA 4ZXBB 2Z3FA 1TVHB 2WQXA 4GRLA 3P4OB 1B9ZA 1TF4A 1GTFA 5IMKA 3GTTA 4XP9H 4AUJA 3D4YA 1AGDA 2ZQKA 3C75A 1B2WL 4JUTA 3TASA 2WN3A 4L3EE 1FFPB 2CKBL 3SGJA 4JHWH 3ECUA 3OXSB 1RZJH 3QIWA 4AZ8B 4N5ED 1ZLVK 1TZHB 5DD5H 4PB0L 3ZDYB 2C34A 3B2DC 1T22A 4JFEB 3THMH 1YMHA 2R0KH 1BQLH 1J1XH 2PYEA 2ZWNA 4TOYL 1J48A 1JXGA 2LVEA 3PFUA 5DXWA 3U4BL 4X5QA 1I8KA 3KPSA 4HALA 2HRPL 1ILSA 1Y18B 2LGNA 4RMSA 4M43L 4F7KA 2PCFB 4JPSA 2HJLA 9CGTA 5E0QA 1MREL 2ICWA 1G0DA 1YAZA 1HAWA 1CF1A 1JGUL 2C9VA 4W4OC 4E41A 1TSHA 3ESPA 3WKQA 3ARVA 5ERWA 2ITDB 4F3FB 1CDGA 2E7LC 4YEFA 1IGIH 2CIIB 4DGUA 4FTDA 4ZQKA 3IVKB 1JL8A 3ZTNH 4ADIA 3C5ZD 2RBLA 5BOPA 1M6OA 4ONFH 3WIFA 2R0ZL 4Y89A 2A83A 4P2OC 3FTVA 5E8PA 1VEPA 4U1MA 2PUQT 4LL9A 5B38G 4XHJD 2DMHA 1XMWA 4OF6A 5C0IB 3RJQB 4JDTH 1PG7L 1TTGA 1W72B 4GT7A 5E1AB 1NIDA 2OZNA 4J6RH 3ZBMA 3O45A 4DPRA 1EEYB 5CCKL 1J0YA 3VD9A 2AJXL 4QOKA 4FQHA 4OFIA 4U1HB 4N5UA 1TZOA 2QPFA 2BY0A 5LGHL 1FZJB 3WFBL 3F00A 2ZWKA 1AGBA 5MI0C 5BUAA 4FXLA 2A4EA 1BBDH 5MEQA 2C1OA 3AU1B 3EHBD 2R2BA 4LQ1A 4ANUA 2OMWA 2XIDA 3HB3C 1XIWC 3DUSB 3N3EA 3HMWL 4PJDA 3O6MH 3ARGB 1MCPL 4MZRA 2G9HB 3GMMB 5AAWA 3DMMC 1MJ8L 3QZNA 3JSSA 2ZOKB 3KPTA 4NAMA 4AMWA 5H37H 4MAYB 1U3JA 4TPRH 5GS1C 4KTEL 1QWHA 2DN7A 3RIAK 2YEZB 2HH0L 3TEYA 1G7MB 2F0CA 3EFOA 4WW2F 5E23A 4Y7MA 1QSZA 5J13C 3S5LA 3ESOA 5C07B 3E6FB 4WENB 3C5XA 5D6DA 1XGQB 2F8XC 1H6EA 4EPSA 3ZR5A 1IAIH 2EDXA 3V5HB 4M7LL 2VW7A 4PGCA 4Q74A 1T5WA 4AITA 2BSBA 3UYRH 4XNUL 2DW5A 4DVRL 1DVQA 4JY5L 1YEJH 3GIVA 2ZYSA 4M6NL 2W0FA 1YEEH 4TULL 4Y9EA 1E8ZA 3VFUB 1NAMA 3ZUCA 3SDDD 4FLRA 1T1YA 2C26A 5DZOA 2YD2A 5GGTH 1GW6A 1PNDA 1WBYB 3RGVC 4PJ5B 1ZWIB 2O6EA 1R34A 3CN1A 1KPVA 3B2UD 5FCSH 3FTSA 4H26A 1C5CL 3TT1L 4PRPD 4U1KA 4W9GC 5HJ3B 4HZ1A 1JTOA 5D9SB 3WD5H 3BEWA 1AKJD 2CCLA 1U33A 4FHBD 1PFOA 3CV5A 4WZ9A 5C09A 2Z92A 3FFDA 1UWEL 1TKWB 1A9VA 3ZKMC 5EC1A 2AERT 1UC6A 2V8MA 3D0LB 4PJ7B 2FEEL 4N2FA 2X6AA 2R1WA 3MPCA 2GYSA 3UACA 4ECNA 1S8DA 3NGBC 5GPRA 4FFVC 1AOHA 1FIGL 2O5NA 3FB8A 4AY0A 5JIQA 4NYLB 1LO2L 5ADOL 4FFYA 3T6XA 4PJXB 3MYZA 3QULA 4TL5A 4YQXH 2B9BA 3O11B 4MJJA 3RJOA 1DVFA 3R4RA 4JKLA 3QG6A 5DQ9A 3CZKA 5CILL 1G9ML 4KO6A 4N1CA 3FQRB 4FLQA 4B0MB 3TA4D 2G30A 4HCIA 2WBJA 5KUKA 1GZHA 4DKAA 3CFKA 1ZOXA 3AQZA 4WKZA 1KXHA 1NOAA 3DMMD 2F74B 2X4PB 3CFIC 2OL3B 3BAXA 3DUUB 4UBDD 1NDGB 4I5BA 5IMMB 2NY5H 2JI3A 5IWLC 4R4BA 3IGAB 3QSKB 2XA3A 3H6AA 2R59A 4MA3A 1GYAA 1CBJA 3BSZH 2PP7A 4GIOA 4XCNA 2EDMA 2WZPD 5T1JA 1BF2A 2PCYA 3REVA 1BZEA 4BH8A 4WWNA 2ZIDA 3MO1A 3D18B 3OMZA 3RNKA 5C0CA 2BSTA 5EU5B 1NLBH 4IGBD 4X6EA 1U8MB 3EJZC 4O02H 5E08H 3MI6A 4U2ZA 4MMXC 4MFHA 2ZSVA 1NBZA 2DM3A 2H3KA 3TV8A 3RGVD 2VM4A 3VI4B 2BNRA 5I9QC 1SHXA 1ZDSA 2CR3A 3EJTA 3L3OC 1WAEA 4MA1B 2R0KL 1BQLL 3Q2CA 3HG1D 5JOFA 1HKFA 5EUOB 5FV2A 1J9TA 3N1MC 2ZCHH 4PJCB 1CICC 2E7CA 2HTKC 2VMDA 1WBXB 4XB7A 1YPZE 3CVBA 3HC3H 5C08A 1ZLVH 1O7SA 2GSGB 4KHXL 1WS8A 4JM0A 4PTUA 4M1GH 5CWSB 4OF7A 3VXSD 3T09A 4JFFD 3ZKMD 2AKRB 1G7JB 1U8HB 4QTIL 2WVVA 4DZBB 3D39A 3EBGA 1KIUA 1YY9C 1FVCB 4BJLA 3QUYC 2NXZC 3WGVB 1FO0H 2DQ6A 4Q14A 4W4NA 1IGIL 2EECA 4O2EB 3DX9A 2DTSA 2MTPA 2VZUA 4MSWB 2D7MA 3V8CA 3VFRA 4A2MA 3ASOB 4C54A 5BS0E 2XY1A 4ZAKC 4GFXA 5EZOH 3DLQR 4JO2L 2CBQA 5CSZA 3J27A 3QUMB 2ITEA 3F05A 5KSBB 4LSDA 2KC0A 3DIDA 1EFQA 5K39A 1FVEA 4LE8A 3NACH 1XB3A 3G9AB 4U1JB 2Y7QA 1R75A 3RLSA 4J6RL 3B2VL 4QKXB 2GABA 3VI3A 3AS1A 3SDAB 2OAAA 2WSDA 2CDFA 1U4FA 1WSST 1XTLA 5EU7C 1LO3H 2GJ6D 1D9KB 1CYXA 2EIJB 3CHRA 1YQVH 4KKAD 3FCBA 3RBGA 4YSAA 3EJZD 3KYNB 4PRAB 5EBWB 5F3HA 4QUOA 2HT2C 1BD2D 5T3XH 4MNQE 2DQGH 3QAZC 2M2DA 3IFLH 3TBSB 4YXKL 3BLPX 5I1DB 2I7SA 4QHNB 3DGDA 3BVNB 2LQRA 2UY6A 1BEYL 5F71A 5K59F 3FPYA 2UWEE 5LBSH 1CICD 2C4XA 1IAIL 5T1MA 1I8MA 1UKSA 5DEGA 5IFHL 3U6RB 5J11B 1HHJA 3MRFA 2Z7ZA 3EAKA 1LO4L 4DNLA 5FO9A 3H0TA 1F4XH 1NFKA 3KPQB 1BZQK 2ZWLT 3ZZLA 4XXCA 4ZFGL 5DRXA 5D1XA 1YY9D 3F7VA 4IHBA 3GXNA 4MAUH 2PXYD 3TF4A 1QR4A 2VTFA 4LAQL 2X1OA 2IPUG 1HL9A 1ZHNA 5IQLA 3TVMA 3WIHL 4FNQA 3R0NA 3N6YA 1BIHA 3GEFA 3TTSA 3MRGB 3TJEL 2X6BA 1S7UB 4J2XA 4FHKA 3T3ME 4PJAB 5KS9B 4I18C 5BZWB 3V4VB 1H5BB 4KRPC 4JB9L 3HR5A 4HUCA 1UQSB 3SY0A 2OJZH 4F57H 4JGNA 2YD5A 4WHDA 5AB2A 1NUDA 5FF6B 3QDMB 3GSWA 4PIRF 3S4SG 1FF5A 5I16A 1JOIA 1NBVH 3WL9A 3BKCH 3H2QA 1ONQB 5E4EB 3APDA 3U2JA 3WIAA 1K4CA 4D9LL 4BBWA 1UB6B 5AVYB 4WUUD 1CDYA 4Z76A 3UG3A 1KGXA 2GT9B 1UD2A 2DLIA 5KG9A 1MHEB 1KDJA 1QFHA 1URIA 2WTPA 1S9XB 1BJMA 5AW1B 3C6LC 1D5MB 4LLWB 1JHKL 4PSPA 5AAMC 3LKOA 3TCTA 4M7KL 4LCVA 5B3JF 2EXWC 4JR9L 5EDSA 1GYUA 1P4IL 1CFVH 2EO7A 4ZYKA 1IEAB 5ENWB 5AVTB 5E95B 2K78A 1DUZB 2D7OA 3A24A 3JQOB 2YEQA 2ZP0T 3T4AC 2ISDA 2A6DA 1EAPA 2CGZA 2E3VA 4Y1SA 1V7MH 1INQB 3MUY1 2ZXWB 5BQDA 2P48B 2BWIA 3BSZL 3TNNA 4KQ0A 5BO1L 1BCIA 1EXUA 2R8SH 3QUXB 2XWXA 1KY6A 3PWJB 1OLZA 2E86A 3FQ1A 1J1PH 3U48A 1NLBL 4N90E 4MYWB 1I9IH 4X6CE 3QQDA 4NQDD 2IOIA 3NSJA 3ZL4H 1P5UC 4FQ1H 3LKPB 4O02L 2VC2H 1SXBA 4R6UA 5E08L 3UP6A 1MUJB 1NMCC 4LEBA 5F7LB 4QF1B 1G7QB 1QSED 1MCOH 1AAJA 1PZBA 4LCWD 5AZEH 1VFUA 2NYKA 2R56L 5KSAB 4H5SB 2G3ZA 2GSIB 2P49B 4TVSa 3WJLA 3QJRB 1QLEB 3CIAA 1OAUH 2WMPA 1NLDH 1A6VH 4Z3HA 2VW4A 1I1FB 4C4KT 3VDBA 5GGSY 4UT7H 2CJTA 4M61A 4LCUA 3HC3L 2D3LA 5IT2L 1L7IH 4PI0A 5AYQA 3UEZA 1A9BB 1QLFA 3Q44A 3M6DA 5A2JH 3IDXL 3KWUA 3V0JA 4PLOB 2J56A 3DGCR 1RUML 1WGVA 2WKOF 4HPHA 4FQXA 4A66A 1YUHA 4JVPA 5BVJA 2KLRA 2CGYA 5DJAA 3QFJE 3C8KB 5BQ7B 1A6WL 2AJZA 5AVSB 4ZW8A 4ENZA 1CZ8H 3D25B 5BV7B 3C6LD 1HCFX 1ACCA 3NCMA 1UD6A 5LCVA 5BUGA 1BGXL 5EZOL 4HT1L 4UIKH 1BOGA 4ZJ9A 4P3DB 3GB7A 2X4NA 3BO8A 1FN4A 1XMEB 4K55A 4C56D 5TE6H 4PCSA 1UASA 1YNLH 5CKGA 2W0KA 3MRQA 4HIIB 3QWQB 3SE4C 1PFCA 3SDXA 4YDLB 2Y6TE 4YPJA 3IFPB 4UI2A 4I13B 4X9YA 5TK4A 2YZ1A 1U8KA 3SQRA 2IOOA 4HKZA 1A6TB 3U79A 3DARA 4F91B 1YQVL 2D3NA 5T1LA 2XN0A 1EJFA 4UM9A 1XFPA 3KCPA 3DX6B 3OPZL 1UZGA 1CE1L 4K23H 1AHKA 4GBXB 1UZ6F 4KK9D 4MS8D 4Q97A 4NHCH 3ZT5A 3KMDA 2VXTL 2DZEA 3MV8A 5LUMA 2FHFA 4N68A 1KBBA 1XO8A 5GGUB 3P3RA 5DMKB 3QJQB 4JFDD 4RGOL 5D7LD 1Q94B 1FBIH 5FXCH 3T3PF 1OV8A 3H4FA 3S96A 5LGJA 1IQDA 1JYNA 2MCPH 4RRPM 3VDAA 1L9MA 1R3HA 1XF5A 3QI9C 1WEJL 4KAQL 4PGZA 5H2BA 3W82A 4X42A 3B2XA 4HVBA 3FTWA 1F4XL 1XH2A 3IKKA 5DJZB 3WENA 2EO9A 3IT8D 1IAIM 1DSFH 1AZZC 4EXPX 2OTWA 3RDTC 1NEUA 4M8QB 1U8CB 3W2DH 1G43A 3MREB 4HWZB 1AC6A 2R4RL 4JQIL 1KY7A 2APXA 3VRJB 4EBQH 4XOEA 5EIQA 2G2PA 2YWZA 3V9EA 4WWKB 3EUUA 4L4VE 5E9NA 4PJHA 3MRMB 3TBTA 3ZE2B 1J5IA 4W9KC 3W39A 1TQWA 4G1EA 4BCYA 1SFHA 1OXYA 5CEXA 4YE4L 4PHZA 5C0AA 4ONGL 2BX5A 1UKTA 3MODL 1TMQA 2VR8A 4N9GA 4ZTEA 5HVGB 3MBXH 3V6FA 5H94A 4YJZL 3RWFA 3ZZQA 3FO1B 1TITA 4BA8A 4KXBA 4GKSB 5F3FA 5SWSE 4PJFB 5FS5A 2H1PL 2XXCB 3PWPE 3PRZA 1JMZA 3VFTB 1OAYL 3GD1C 3DXAE 4HOXA 3BQUA 4ERSH 4X9HA 4H2AA 4X7TB 4JFPA 5M94B 1TSRA 12E8H 4HUMB 3CD4A 3IK2A 2QMJA 4L1SA 4QHUA 4U1IA 5D7JB 4BSJA 4URKA 1BG9A 3O3AA 1KYFA 1HOEA 5IKCA 3TA3C 2ATKA 3RWEA 3PNWA 3QJHA 2DQJH 4JFHE 4M6OL 3VRLE 4PRIA 3KLHC 4P07A 4PJ9A 1SMAA 1SM3H 1BYNA 3MRBB 1H0DB 2JJVA 2BVUA 4MRCA 2JFCA 4HA1A 5TGBA 3MGOA 3DETC 4AENB 3BUPA 2YD6A 3EYVB 1AIFB 4BZ1H 2NTFB 3SGEH 4GRLD 2XTLA 1S9YA 2R8SL 4HXAH 3IKCA 4FKHA 1T03H 5LDUA 1SJXA 1WDAA 1RV6X 3EH2A 1T83C 1CXIA 3DIFA 3MCLL 2VDNB 6PAZA 1YEHH 4A39A 4RAVB 1CDIA 3F5WA 4X6FB 4YSRA 5KAQG 3HI6H 3QIWD 4W9LC 5D7IE 5AKSA 5DUBB 3CHSA 1MCOL 2R1YB 5AZEL 3NA9H 4I85A 3VFVA 2HMIC 4TNWF 2F54E 2QQNL 4CGUB 2YPLD 4DVBA 1EDQA 3MXVH 2ZXCA 4L3CA 2FL5A 5B1AB 4WF7A 2DQMA 1JDDA 2PYED 1TT6A 2F58H 4XVTL 1JRHI 1JV5B 4UT7L 1MHPH 3OMAB 3L3DA 5T3ZH 3MRJB 4L0ZA 2V2WA 2JIXB 1L7IL 4ALAH 3KPSD 3IF1A 5D2LA 5LN8A 3WKMH 3G6DH 4JAMA 5FKPA 5TK2A 4GP5B 5JQ6L 3KPRA 3BKJH 4X80L 4E41D 1KTCA 3K71B 3KPNB 3W0WE 2WO2B 5DF0A 5A2KH 5CEZD 5KSVB 4AM0B 1HH6A 2MQ0A 2V4LA 2YGVA 3OKDB 2OMBA 5K1NA 1U2YA 4NIKB 1HHHB 2HUEA 4OZHA 4NC2B 3ZDXB 1HNGA 1YEKH 3QCUL 2VXUH 5F3BB 2VMJA 3CQFA 2OMVA 4W9CC 3S5ZA 1UA6H 1FYHB 1M7DA 5E6SB 3UDWC 4AZUA 5IQNA 5BNXD 3RZCA 2NY3D 4TNGA 4QJ4B 1W8EA 5CNHA 1BP3B 3P0YL 5ANHA 4XO4A 3O4LA 3OWRA 3VWJC 4PJBF 5AW3B 3O6FC 2Q10A 4QOKD 1ZLDA 1VADB 1TJGH 1ETJA 5GSRB 1AS7A 5SX5K 1W0WA 1H3GA 3HKFA 1JZ5A 3U30B 2PF6A 5F7YC 3ZO0A 43C9B 1HIML 5EV7A 3RIFK 4JFXA 3QDGA 1QTSA 2ENYA 2ZXQA 2OJEB 3KEDA 4FZEL 2QFPA 3VUAA 2CHNA 2VL5A 3MA9L 1SHMA 1DZ0A 4LOEA 4HCGA 3QUZC 4HC1H 3IAPA 1Y6KR 5FFOA 4UOZA 1SHSA 3G7TA 1F2QA 3TPUA 3BPLB 4LLQA 5BZZA 1CDCA 1DJZA 2HCZX 1J7VR 4B9KC 1XGTB 3IE4A 3QZWA 1CVSC 4JRXB 4NUJA 4OV5B 2AK1L 2N7BA 3GZKA 1TPXB 1UD3A 4UOW0 4YHKL 3V0DA 2QPSA 3PGFL 1OPGL 2XTJB 4IDLA 4EBQL 1Y1UA 3K4AA 4AIXA 5CBEB 1G0XA 4HJGA 2JB6A 4IK6A 1D5XA 2IANB 2FJGA 1P6AB 4JRFA 5DZNA 3EJRA 1L7TH 5H37G 3G5XA 2APSA 3NPZB 3STZB 4RRPG 5ABDE 3G5VA 1M71A 1G1OA 3D4ZA 3HLAB 4P2AA 4XNMB 4DKDC 1QR1B 5DJYB 4P05A 2WCSA 4DP9X 3MBXL 1ZT4B 5IHBA 1P7QB 2NZIA 2R15A 4B96A 4LLDB 2YUVA 5I74B 2I25N 3PXJA 5HI5C 2PTTB 1MI5B 5DSCB 4IRZA 4PV1C 4OLXH 3PF2A 3UG4A 1A4AA 1B0RB 2XLLA 4CVUA 2EDOA 3ZMEA 1D7CA 2DLGA 2QQLH 1ZT7B 1ZE3C 4O2CA 3FB5B 4G59C 3GMQA 4LHQB 2EH7L 1OW0C 3EJYD 4PY7A 3UP1A