2LLGA

Nmr structure of the protein np_814968.1 from enterococcus faecalis
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein NP_814968.1 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2llgA00
1LMIA 2LLGA 3CFUA 4LESA 3QFGA
chains in the Genus database with same CATH superfamily
5IG7B 3S48A 5I74B 5C0GB 2R0KL 5HGAB 4F1ZA 4NPKA 3BGMA 1LEGA 1WZ1H 4GKNB 4XI5C 2VLMD 2WWOA 4JM2A 5KBPA 3O3EB 4A6YL 2UUDH 4F8OA 4XH2A 2VLME 1O9WA 3KXFA 2FJFB 5K1NA 3RAJH 1Y7VA 4MCZB 1CK0H 4K15A 3NUKA 4WUUA 1ASPA 3TL5A 3RFRA 3EXJA 5EZIL 4AEFA 1UOKA 5CJ5A 5G4NA 4FLSA 2HLAB 3VNYA 1OAXH 4HX1A 3AGWA 5KANI 3IBEA 3WL9A 1V7MH 4PGDB 2NW2B 4WDIA 4X9YA 3VD5A 3VD0A 4NN6B 1SUJA 1OAUH 1P84K 3QQ4B 3NFSL 4U1SA 4QLWA 3GPEA 3MV9E 2QKIC 3B9KC 3L3OC 5EEUA 3FUJA 4MDIA 2DLEA 4BFEA 3QNFA 1JZ2A 1VFAA 4MASA 1CZ8H 3SGEI 3DHUA 3IJSA 3QZOA 1F4WH 1NFDF 3ZQXA 4BFJA 4QY8A 4MGXA 3N42B 4L3EA 1BLIA 5EBLB 3B56A 1FO0A 1PG7X 4Q58C 4G8FB 1E6JH 3GSNL 1GR7A 4DP6X 4PJIE 4EZMA 1SJHB 2IPUG 4OAWB 4GW5B 3RQ3A 1KTJA 5GS1B 2ZSWB 3FZUD 1T03H 2X3CA 1MFDL 1EWHA 5DRXB 3S4SB 1T7WA 4Y1AD 4OV5B 3IDJA 3M1CA 2VDOB 3BFOA 3A6BH 5D7IA 3GRBA 3L5WA 1IFHL 2DYPB 5DD3L 3U46A 1BF5A 4FERA 2DEWX 3VXRA 5GQBA 2Q87A 4U1MB 4N8CH 4CSTA 3MOBH 3MRDB 2EKSB 3BGFC 4JE4B 4F7EB 4ABQA 2E76C 4AGLA 3TT1H 3JWDL 4BK5C 3FTWA 3V0EA 4LK4A 2YAPA 4OLZH 2OMYB 1I3GH 1A6ZA 5EZJA 5AZ2L 2EEFA 3GWJA 2DQJL 3MBEA 2BSBA 3MLWH 2BWIA 5EN2B 1N7ML 3ECBA 5DA4A 4LBEB 4PB0H 3M07A 1N8ZA 1GSKA 2DTMH 3VYPA 2A83A 2EECA 2GSGB 2VDRB 4MLSA 4OLVH 2NY6C 4LEBA 3T2QA 5IB2B 3MLPA 4PP2A 5FR3A 4LOVA 3TVMD 3HMWH 4H8PA 4M29A 5KEZA 5C0DB 2XIDA 3FK3A 5ADPL 4GSUA 5E8DH 4HFUH 2EDTA 3II2A 3LXCA 4DCQA 1EJOL 3FQRA 3W38A 5C0BB 1PZDA 1T7XA 3OPZL 2P28B 3A0OA 1XR8A 1N6VA 4U1GC 1ORSA 2H6UA 3D09A 3RYMA 4YDIH 1TQBC 2ATKA 4FQHB 4M1CD 3OWRA 5D9SA 2YQ3A 4P3DA 2DQHL 2MNUA 1F90L 1ORQB 1QTPA 1UD6A 4GAJL 4MZ2A 4AGNA 4EUPB 4KX7A 5JHLA 3MRQB 1NCBL 4WFFD 1G6VK 4JO3H 2PLTA 2IGFL 5I1JH 3KL5A 4HUXA 1XO8A 4XMZA 3SDCA 4RFNB 1KLUB 2W0FA 4N8VG 5IEKA 4WFFE 1Z5HA 2FWLB 3GMRB 2WAQA 4JY6B 1E4XL 1JGDA 3CFEB 4RDQG 4K8RH 1CLYH 1X7QB 4LSPH 3O8XA 4PGCB 4G6ML 4X98B 3L5HA 2LFEA 4Q6KA 4X6DF 3SBRA 5KYWB 3SCMC 3ZE1F 2OL3H 4OF8A 2Z35A 5CP3H 3ULVH 3D4YA 2CDEB 1R75A 2VLLB 5F7EH 5DMKB 4XP9H 4LLVA 4MAZA 3O0RL 1J5HA 4IW4C 2JTYA 3Q13A 1Z6JT 5CD3A 2C8NA 2G2RA 4JG0L 2VE6B 2XTLA 5IMKA 3HZKB 1PNCA 1ZLEA 1XIWD 3PAZA 1MFBL 1ND0A 1U91A 3HNSH 4Z7WB 2APTA 3JTTA 3SGKC 4FXKC 4FXLA 4LEXL 1E5UI 2AJXH 4FLOA 3QUMA 4NAJA 3VTTA 4ECNA 4KH9A 3VU1A 1KJVB 3KLKA 3O2VH 4L4TA 2BXYA 5HHXH 4H44C 2I60L 1E8XA 4MZIA 5E7BA 4P2OB 4YNYA 5EEVA 1NEZB 3KG5A 2F19L 1YPZA 4PFEA 4ZO8A 4WGKA 1ZVHA 4JFTA 3VYOA 1J12A 2WK2A 1EGJH 3STLA 3LKPA 4FLQA 1RXLA 5EU4A 5LWYH 2NZIA 3DJSA 5D2NE 4BFNA 2WWKO 5MHSE 3DHJA 4RMVA 5KTEH 4NRZA 2ITCB 1PZUB 2P24B 2YC1A 4GKSB 3FW6A 1UVQA 3ARBB 2CA3A 3NCYP 4OJYA 2G75A 4F9LA 1FZJA 3BZ4A 4HPYL 5JIMA 2VM3A 1RZIB 3BP4B 4QXGH 1T83C 3MOAH 5D1ZA 2RQ8A 4IDJH 2MHAB 1U8PB 4MA1B 5H37G 1MIEL 1NGXA 4O5LL 1D5ZA 2AV1B 1U92B 4L9LA 1AD0A 1F8TH 5HDRA 1K4CA 2DMHA 2XZZA 5ANMB 4Q9CA 1C7SA 1OZTG 4HP5A 1JMZA 2G3MA 4CADB 4NYLB 1PPIA 3LPFA 3BW9A 3TTYA 4KTEH 4N1EA 1HHHA 2D3LA 3CC1A 4C56A 2F58L 3WIHA 4P2RA 2QQLH 3DETD 4DQAA 3DO7B 1KMGA 4GRMB 4NQCE 1DO5A 5E6ID 4AQEB 2OPCA 5I19L 4NUJA 5EEWA 3SGDI 2BS71 3G5VA 5D7SL 5FUOH 4IOSD 2GY5A 1T89C 2KBGA 1MSPA 3MX0B 4GINA 1LILA 4X4YA 1CN4A 2L7EA 3TONA 2HRPH 1X9RA 1PFOA 1QTSA 3BIAX 5E4OA 3LV3B 4HCRA 1ZLWK 1TT6A 1G9MC 4P9ML 5JHMA 1DR9A 2WCSA 3BH8B 2XG5A 4PG9B 2AK1H 1TJGH 2DQFB 4TULH 1QSEB 5I23A 1XV8A 2C1OB 5CAYB 4E9VA 3T0ED 3RWFB 1S3KH 3I84A 2CE6A 2G4EA 3KVQA 3MN8A 4ZG1A 1KBBA 2VXVH 1IQDB 3KDPB 3CQFA 1AJ7L 1DTUA 3HKZA 4JG1L 2P5EB 4U1JA 3TPUA 3VGAC 3VFSB 3W39A 1BOGA 4EI5D 4XOAA 2GQHA 3O6KH 2BJML 1AO7A 2WV3A 3OJ2C 4O02A 4X6CE 5IQMA 2FEEL 5KVGH 5H2BB 3CVHH 3CXHK 4ZS6C 2VZSA 5C9JB 2EUXA 4OLEA 1AKJB 1JUFA 1QRND 1DHKA 2FQGA 2P49B 2EEXA 3CUPB 1UA6H 3OXRA 2A38A 4LAQL 4LSTL 1KFGA 1IGTA 1GGTA 2XBZA 1FV1A 4PH8A 3WDIA 3H6AA 3EG9B 2JB6B 4QRPA 2V7NA 3QHZL 2Z8RA 2BOBB 4G9DB 4RIRB 1ZEAH 3ARDB 4F7CA 3L4VA 2L4OA 4KXAA 4BWUA 5I18L 4NO2B 1Z0NA 2AQ3A 1YNKH 2P8MB 1KYDA 3QUYB 1T20B 1V27A 3GMQB 4PJBF 5ISZB 5K69A 5SWZD 3L2NA 1O7VA 4PQXA 4G9FD 1WV7T 5C3LD 3ZGIA 4JPIA 3AUVA 5F0JB 3L45A 5SWZE 4G9FE 2LU7A 2OMXB 3NSDA 3K1KC 1NKGA 3SKUD 3UBXI 3UO1H 4MBRA 4YHMH 2P26A 5HGDA 2PNDA 4J3OH 2XA8H 1HKFA 1XGTA 4B97A 4JQVA 1F4HA 1SXCA 4FKEA 5JXED 4YXLL 1GHFL 4IMLA 1YEHL 1Y0LB 3GJFB 2BFGA 4R96B 4M5YL 2I5YH 3CXFA 3NSJA 5D7LB 3W3BA 4LSSL 3VVWA 1TUPA 1SFHA 3HR5A 5CEZE 3WNPA 4KWUA 2VN6A 1GVIA 1K5NA 1L0XA 4UOW0 5CP7B 1S7XA 3C6LC 1EV2E 1NBYB 4IDLA 4PGZA 5L4IA 3BE1L 1GJUA 1OB1B 4NUMA 4YDZA 4HMCA 3MGOB 4KO9A 1M3IA 1RUAH 2XIBA 1E9PA 4AYDC 4S1RL 2XTJC 2V5MA 4P4RB 1YEJH 4UMGA 1FL3A 1MWOA 4JLRB 5D6CB 4AQ8C 2OMVA 3TESA 1OCWH 4YVUA 3ZMNA 1WDAA 2GSIB 2YA1A 4IBWA 3UPRB 1BQLL 3IAPA 4EN3A 2VLRD 3MYJB 4XNQA 2R2BB 4Y16B 3GSUB 3B2UC 2WLYA 4OR1A 1S7TA 4H8WC 5DO8A 1S9VA 1IAII 1QI5A 1WD9A 2IOOA 4AWJC 3GPSA 2B20A 1BZOA 2E5EA 4PJXB 3T4YB 1QR1A 3FSZA 1JPGB 1BQHB 1PY9A 5I26A 2C3VA 3OGCA 1IEBB 3QCUH 4XCEA 3R8BB 3UTTD 1AZNA 3SYQA 4Y5YA 5MERA 2EVGA 5BS0A 4PRNB 1UKSA 2FHCA 2AITA 3TIEB 2FZ3A 2UVEA 3G7TA 3N91A 3QJOA 3UTTE 1J11A 2YPVH 4MAYC 1L9OA 1ROWA 2Y24A 4X5WA 3U4EA 4Z76B 2YD9A 4EBQH 4NQTA 2ZJSL 3S5LG 2CDGA 2CBQA 4L5FH 3TS8A 4OLWL 1B4JL 1FNSL 3T2NL 4JRXE 3DX7A 3C5ZD 3QHTC 1F4YL 4BXVA 4OVVA 1MEXL 5F1IB 3T71A 2A9DA 3GK8L 3H7LA 4PRHD 1RJYA 1PY4A 4PUBL 5EWIL 4EI6A 4PRHE 4E9QA 4GG6A 3K4ZA 1UXWB 3L7EA 4XNAA 4L4VD 5F7WC 4U2ZA 2JKWA 5FA3A 3ULUL 5I1IL 5CN3A 4L4VE 2DMGA 3MUGB 4N8VA 4ZDHB 4X2UA 3WTUA 1SHWA 2EZ0D 2J25A 2HFGH 1JERA 2WQSA 3OKYA 2AK4D 3D18A 4YHOH 3DGDA 2YS4A 2HKFH 4W9LC 5IB4B 1CFQB 3EHBB 3HG3A 4DP5X 5G5DA 3ERXA 3I3BA 4F37F 4JPWH 3SPGA 3L1OH 1WPCA 4NO0D 4FQXB 2Q86A 1AHWA 5KVMC 4R8WH 5PAZA 4WI0A 3NA9H 4JHBA 4UV7L 5FKAA 1DANT 4FCHA 5I73C 2PCXA 1U3HA 3NIDE 1X5HA 2ZUVA 1E90A 1GH7A 5GGVY 5C2UB 4L1BA 3BRFA 4L05A 4HWZB 2H8PA 1IAOB 1MAJA 4U3SA 1U8LA 6CGTA 1RUPL 2HRLA 4M7KH 5I1GH 3ARGA 1NCWL 2DICA 2Z3FA 1AOHA 1QX1A 4UDTB 4UF7C 5HYJD 5TFSH 2X4NB 5DJXB 1YN7A 3MUZ1 1Z5YD 4JQIA 4EJ1C 4PLNC 2H0PA 5HHPA 1DE4B 5DF0A 4PJ7E 5IR1B 1BPLB 4D0BA 2BXZA 1TCMA 1M71B 2FH6A 3A4EA 4UU9B 2ZX6A 2DLFH 2Z91A 3GLEA 5IJBC 1FE8L 4X5QA 5ECJE 1MHCB 4J7RA 3A21A 5ESAB 3TBVA 1R33A 3DVGA 2NRDA 4TM9A 2YWYA 2ZP8A 3KYOB 4MA7L 5A2FA 1OWRM 5C0FA 3MJGX 3LS4L 5CCKL 2IDFA 3OPUA 4Y2LA 4PM1A 3OXSA 4L4JA 1I7RB 3D34A 2FT8A 4EZKA 1FC1A 4GAYB 3RVWC 2X0WA 1F02I 3LZQA 4DUXA 1JGLL 1VACA 1EHLH 4WWOA 1H5BC 3QDGA 2YSSB 4O2EB 1DFBL 5H37A 2TAAA 1QLFB 4Y2DD 5ALCH 5AALA 2FHFA 1OAJA 1MUJB 4HGWB 1K8IB 5F89B 4ATWA 1SHMA 5HDOA 4OUUB 2IPTH 4PJ5B 2YQGA 1CLZL 2AABL 1KLFB 3SDYL 2N56A 2Y22A 4R5TA 5TK2A 3ZY7A 5D7KD 4UV4H 4KJQC 1C1EL 4WU5B 1N64H 4L18A 1PTZA 1TLKA 3G5YA 5D7KE 5EFIA 5L4MA 2C5DC 2W81C 1F2QA 4W9CC 4A2EA 4L2YA 1NPUA 3BOVA 4XCCL 4PJGE 4U6VL 3SJVA 3LN5A 1GSMA 5DTFB 1HHIA 4OT1H 5J12C 4AIZA 1UZ8A 3KDMA 2P4AB 4UQAA 2FL5A 4U4BA 1UCBL 4CKQA 4XP4L 2DJ4A 5LN8A 4KJPC 4PV9B 3WENA 1BVLB 1M2VB 2IAAC 4R83A 3I50L 1C5CL 1U0QA 5D5MF 4LCIL 2V0AA 4YXKH 5I74C 2ICEC 3OTTA 5B38G 3UAFA 3RNQA 4B3EA 2R69L 3FQXB 1RZPA 3HZYA 4M7JL 2X0VA 5GRUH 5I2IA 5IIEB 1F3RB 2W8CA 1X6NA 3KD4A 1QWUA 5F3BB 3QUXA 4TVPL 5CJQL 3BLPX 5C0CA 1G9NL 2FTAA 1X4YA 4WI5A 4DP2X 1ZTXE 1OF2A 2P5WD 3FO0H 3W5NA 4HUVB 3QQ9D 4D8PA 1R9FA 4HMDA 4ZYKA 2P5WE 5ILTL 1D9KD 4IRJA 2YFOA 2YR3A 3R19A 2DQGL 2YD2A 2ARJQ 1AH1A 1NANI 4MJHA 4PRDB 1EXGA 1INQB 1X3DA 4JFDE 3MA7A 2Q8AL 1OAYL 1DSYA 4NN6C 4AYSA 3ZTCC 1N59B 3P0VL 3TBSB 5IHWA 1JNLL 1ICTA 4TUKH 1I85C 5LQBL 3DARA 4Y4HD 3NTCL 2GBVA 2SEBB 4LLWB 1QZNA 4BZ1L 3SQOL 3Q06A 3Q8CA 4XP1L 3QRBA 4XPBH 1KBGH 2WLJA 2VKXA 5HJBA 4DN3H 1N0LA 2RJMA 3OB8A 1FFNA 1YEKL 3UJJL 1BFSA 3U4KA 1S7QA 1SYSA 1NC4B 2AV7A 2BNQD 1XCWA 1RZGB 5T1MA 3FHQA 4HXAH 4JFHE 25C8L 2BNQE 1RJLB 3K4DA 4XB7A 2GTZA 3M17B 1M1SA 3NIFB 1QFUH 2YRZA 3COOA 5GS1C 4Z0XB 4N0UB 1KIUA 3BZEB 2X3BA 1MN4A 1NJ9A 5K1JA 3T3PB 4EF3A 2R0ZL 1PYWA 3MNWB 4M56A 2LGNA 1WFMA 4PB9L 4XMUA 4GQRA 4IIQA 5IVZA 1X5FA 4ZOAA 3V8OA 1N6UA 4DW2H 2CLVB 1XSOA 1LO3L 2VXUH 4X80H 2G3XA 3QUGA 5EULV 4BSWB 1JIBA 3H54A 1SQ2N 1PU0A 3O81A 3MLYH 3OKDA 1MFCL 2WVUA 2J8UF 1Q90A 2I7OA 5TPWL 2F54B 1VKXB 2WXKA 2YFNA 3GSNB 4U6HA 5E9DD 1M53A 3EH2A 4OCYL 4OZ4B 1FYTD 5F7HA 2Y36L 5JW3L 5BOPA 4PJIB 3S7GA 3LMJL 4YFEA 3TV3L 4JM4H 5E9DE 3DOIA 4M6ML 3B3IB 4JRYA 2DLHA 3RE0A 4YDKH 1UZ6E 4TSBL 5DUBB 3PJLA 3I6GB 3QIWB 4L48A 3F64A 1FQ9C 3IGUA 4I2XA 4PVNA 4ZK8A 3U9PL 4UQBA 5GGRA 4KK8C 2C1PA 5C0IB 5DSCA 3PWPE 1JCKA 4Y1AB 2NSMA 4N8PA 3FFDB 3WD5L 5B8CA 5DVMA 3B5TA 5J0BA 2F53B 2YBRB 2Q2EB 1OEZW 2ZKYA 1NBQA 1AGBB 3O6LH 5GHWH 3SZ6A 3PXLA 3IAQA 3ZZQA 4LSRH 5IROA 3MYZA 5C2BH 5ICYB 2QTEA 2XWBB 3D05A 1WBXB 4B95C 4D0CB 3GSOB 4DIXA 1A14L 1U95A 3SYCA 2K78A 3A47A 1SY6H 1XGUB 2H2SD 5D8JH 3U7YH 2NY5L 3AY4C 3D0VB 1SDYA 1NMAH 2DTSA 1PF3A 3UZVB 3QE5A 3GS7A 4JZOB 4RFNC 1HSAA 2DEXX 4AW7A 1R17A 2GCYB 1GZPA 3D12B 3TJHD 4HKJB 4OCRL 1IGFL 4PW4A 2IQ9H 3UYOD 4Z7VE 5I0VA 1AS8A 4DP1X 2Y7QA 2CLRA 1IAKA 3TVMB 1JPST 1HXMB 3IDNB 2X40A 5GSRA 4X7FC 3G5WA 4IU2B 2FJSA 3ALWA 3I2CH 3QNXB 2GG1A 3CDGA 1KGUA 2RCSH 2CO6B 1W8OA 3HC3L 5B1AB 1A3QA 3ZR5A 2MCPH 2WXMA 1ETZB 3MGTA 4AL8H 2OL3A 4KU1A 4YQXL 2GHZA 2YBGA 5CP3A 5GRZA 1OO2A 3WDJA 1HI6A 5B4MC 2FAUA 5HYIA 5E94B 1MJ8L 3D9AL 3TNNA 1JNNL 3DROA 3WELA 3EFOA 4ZAKD 3FQTB 3IJYA 3RY4A 3T2LA 4CRPA 3CNKA 5CN2A 3E2HB 3X14A 4B0MB 1C9SA 2EKJA 1HQ4A 2Z4TA 3SDDB 1BJ1H 3MMEB 3VRIB 4GIPD 3IJ7A 3RDTA 4X42A 3LN4B 3ZR6A 4AE1A 4ILDA 4P2OC 4R3SA 4IGBD 2ZKHH 3ZUCA 1YMMB 5IF0A 1UKTA 3LSOB 1U8IB 4UBDD 2VSKB 1GY2A 4LLDB 4TLTA 1IIKA 2EILB 5F1NB 4MAUH 4X5PA 3BXNB 32C2B 3GD1C 1VSCA 4LHUB 3FQUA 4Y88A 3D0AA 3L4XA 4P9HH 2FJUB 4PS4H 3SO5A 3VI4A 5JXAL 3SD2A 1ZT7A 4YBQD 2XICA 2XWEA 4H26A 2J72A 2BVEA 1B90A 1MFAH 1EGJA 1E5AA 4OM0H 3ARBC 3F7LA 3K46A 4K94C 2OBGA 2HB0A 1G7PB 1KFAL 3FUEA 3BQUB 4R7XA 4AEIH 1BVZA 2XJKA 2V5YA 3BWUF 3HFFA 2DZEA 1S7SB 3PNRB 1ZLUH 1NCAH 1NWOA 3ZT6A 3KVDD 1QYGH 3L3GB 1NCNA 5HD8D 1TTAA 4X0KA 2CLZB 1ETB1 4NZFA 3AZUA 3ZTDC 1SDDA 3QZWA 4KDWA 3I9GL 1WT5A 4W70A 5FF6A 3HE6D 5C7ZA 3QZBA 2ZXDA 5DDHB 3SPJA 4UIMB 1N2RB 3UTZA 3X13B 1RQ5A 2P8LA 3MRCA 1RK1B 4QXUH 4B7IA 4FS0A 1AR1D 3THML 3S97C 2AS5M 1JPSL 1GIGH 1NGPL 2VDMH 2J4WL 2OTWA 4HIXL 4QCIA 5KYYB 1JXKA 5HHOD 2DQIH 2O61B 2B4CC 5JOFA 3SHSA 3PWUA 1QPXA 3K2UL 5HHOE 3E8UL 1ET7A 1B0WA 1P7HL 4A6YH 4TPRH 5AYUH 1NFKA 4ENEC 3NIFF 1AXSB 4H25B 5KSBF 2R1YB 1FJ1B 1WFTA 4GH7B 4FYQA 3KPLA 5D4JA 1ZHBA 1AI1L 1QFWI 2G5BB 2YXFA 1LO2L 3EOAA 4NWTL 5KYXB 3TJEH 4J2QA 1RHHA 4TNEA 5BZZA 1C08B 2OX5A 2I69A 5BCAA 1HWGB 5KANG 2VLKA 3T65A 2MKLC 2LABA 4NQXA 1NFDA 1S7UB 2C7FA 5IP4A 3D5OF 1KB9K 4JN1H 3SDAD 5C3TA 3LY6A 5DJ2A 3MBWB 2A77L 3AU1A 4TNGA 5E6IB 4F7PB 4PWFA 2OP4H 3S6CA 4K3HA 1E6OH 1WCBA 1GYUA 1EX0A 1JI1A 2NR6C 1CCZA 4MQXD 3CMOL 4JFZH 1CDHA 5L9DL 2H45A 2HKAA 1OP9A 2ZYRA 5F72S 1K8DA 2H26B 3Q0HA 4GKLA 3P3TA 3CVHA 1AY1H 4ZFGH 3F83A 4UT9L 2YHGA 1KXHA 3OMZA 1BGXL 1IUZA 1Q1PA 1LP9B 3L95A 1R3KB 4FNPA 5DHVH 3UYRL 1VGKA 3ARDC 3RL1A 2RBLA 2X4TB 4KV5E 4HG4J 1R5VB 2BC4B 3QUYC 4G42A 3HG4A 3HVDA 3MFFA 5C08D 2EVIA 4RRPA 2AXWA 3PL6A 2GJZB 5CCJA 1DUYA 4N87A 5C7XH 5J9PA 3NCEB 3T0EB 3FB5B 2GEQA 3P9MB 5C08E 3SE3C 4L8CA 5DYFA 3PNWA 5EF2A 2JJVA 1CFTB 1KTKE 1H8NA 1CTMA 1G1OA 3DGCR 2WXJA 4LPUA 4D9QD 2FIKB 3LZPA 1YZZA 2R2CA 3KW7A 3GSVA 3O9WD 4B96A 5SWSD 3UJIH 4D9QE 3QNYB 3MXVH 4E5XB 4FNSA 3RWIB 3BLBA 4JFVA 4PJDE 5SWSE 1QRNB 5EU7E 4XN9A 4JDTH 2D73A 1IAIH 3Q6FB 2IADA 4HPOL 5ABAA 4KAQH 2WN3A 5F3HA 1UEMA 5BW7C 3FUDA 4OGZA 2V6HA 3L3JA 3FAWA 3X3FH 1O7SA 2ARJA 3R18A 4MD5A 4H0HB 1A5FL 3DXAD 3L3IB 1TDQA 1QFHA 3VDBA 1J9TA 4I0KA 2DWDB 5ICZB 3ABMB 2BVPA 4GIOA 2BK8A 1JV2A 3P73A 1U8NA 4UDUB 1DQQB 3VWKD 5CBEB 4M3KB 3FT2B 4XGZA 2FATL 4ONHA 2W60B 5IQ9B 3F65A 1A22B 2BNRD 2FEDD 3DBXA 5AOZA 2IIJA 3CH1B 3RVUD 1SQMA 3NIGB 2LLNA 4IBLT 4YHNB 4PLJD 3BN9C 2P43B 2AEQL 3QPQC 4X9HA 5FXCH 5BUPA 4ZOBA 3VFPA 4CMMB 4WNQA 2VXQA 1YA5A 1SN5A 2VZOA 3LNEA 3KGRA 1RP9A 5IVXF 1DBKH 3VO0A 2Z6FA 1DQJA 1NM9A 5ICXA 3VXUA 3ENEA 4O51B 3VXSB 1XWVA 4WFHD 2FVNA 3NJJA 1I1AD 3EO0B 3CU7A 4N2KA 5J1AB 4ZXBA 4PJCF 2WVSA 4PCSA 1WFIA 4WFHE 5E5LA 2WUCL 1PBYA 2YPVA 4N22A 5T1KD 5K9KA 1DP0A 3QS2A 3V79C 3ZYZA 2VLRB 5CMAB 3CVIL 3KJ6H 5DJCA 5IESH 4I1PA 4N3UA 3ZHFA 1YY9D 3AQXA 3KPRD 3QO1A 3C6SA 3MHZA 2X1XR 3EH3B 4JGMA 1S9YA 2H0FA 4YO0B 1ZCRA 1A0QH 2DKSA 3DKHA 3DTUB 3KPRE 3LEVL 4KDVA 3IMVA 5FA4B 1CYGA 1ZPUA 5IJVB 1ZPLA 1W72L 2VOTA 2E74C 2P7TA 3S35X 3TXAA 3C5JA 3QEGH 4UAOB 4HHAA 4TVUA 3EGSA 5FGBA 1PX4A 2LAGB 1FL6B 3MRRB 1JHTB 3WE1A 3JSSA 4MB3A 4XNUH 5DI8A 3GBNH 4X4ME 1ZHNB 4J6RL 4KHTL 3QQDB 4GSXA 3ZMRA 3RZCA 1G7LA 4GRLB 2BSRB 4HJ0D 4CVZA 5FYLD 3NH7H 3TURA 3EHBC 2R0WH 1PG7L 2ADJA 4U33A 1WBYA 1XSJA 3V6OA 1SBBA 5F88A 3C5ZB 4FQXC 1I8MB 4BINA 4I0PD 5TK4A 5FYLL 3K2KA 3G08B 5DZ9A 5L7XH 3QA3A 3JWNC 3MRMB 4EEEA 4J2XA 2GC4C 4B9FA 3DJRA 2AW2A 1TVDA 4TQHA 1NIDA 2ADFH 2MQGA 4H1LG 3GEFA 5DUPL 3QDMD 2GJ6B 4IOFC 1KTLB 3MTXA 4TRPH 4S0HA 5JW4R 3VD4A 5IOKA 4L23A 5ID0B 1TCRA 3AITA 3UX9B 1HS6A 3E3QC 3T8XA 4H88H 4ZW7A 1CGUA 3EO9L 2YK1L 3H2WA 3TEXA 3V52L 3T6ZA 4UUJA 1HYRC 3QIBA 5L2KD 4U0QB 2AK4B 2MQ3A 2R29L 2FJHA 4E9XA 2YEZB 4XT1C 1U36A 2ED9A 3RWDB 5KVFH 2AAVA 2YGOA 2WHVA 1S9WB 3SE8L 1XXDC 1N0XL 3LHPL 4AGQA 1EIBA 1V3JA 4XXCC 1AXTH 4ODVH 1JV5B 4GP4B 5AOLA 1I1RA 1PDKB 1T1WA 1F13A 1U42A 2B59A 3C8DA 4NM4L 4KGJA 3NJHA 4J8RB 4HZLA 3IPEA 4WUKH 4JB9H 3PWLA 1I82A 4LL4A 4QRQA 4AY0A 4G7YH 4M1GL 1UM5H 2QSCH 2WLZA 4MD4A 5LBSH 3RWEB 1VB9A 4UAHA 2BSED 2L7JA 3UTPD 1INEL 1K72A 3D8MA 5HYJB 3J07A 2DAVA 2WIIB 2BW4A 2V9UA 4P5SA 3JTSB 1WEJL 1MI5E 3K5SA 4X4ZA 3TN0C 1AG0A 1DEEA 5FHAL 2XX0A 2GYSA 1H3WM 1UT1A 3ZE2B 3H85A 4IOIA 4N0FB 3LNFA 4OFVA 5AAWC 4A66A 4DO5A 5IEHB 4C83A 4G5ZH 3B8SA 4HXBH 1W0WA 2A6IA 3CDZA 5TGBB 4F58H 4WHDA 2WVVA 2J5LB 3BSZH 4K9EL 2FLRT 2JB5H 4BA8A 4PJBA 2VW6A 3WAKA 1QEXA 4PJ9A 1U8QB 3WFBL 1JWMB 2FSEA 1ZSDA 5IJDC 5GZNA 1VPOH 2OMTB 43CAA 3CLFL 4ZSOA 5M7QA 1JTPA 1NC2B 2EIEA 2CO2A 1NBZA 3Q8BA 3VJ6A 2X42A 2IWKA 4ISVA 2NNAB 4XOEA 1RIHL 4LPCA 5JW5B 2KH2B 1UACL 3OQRA 3CZSA 1L0PA 3MBXL 4WI8A 3LRSA 3FDWA 3PIQA 4Q97A 4XX1G 3ZDYF 1B4LA 2X4RA 4KI5F 1J0KA 3AMKA 1NANH 3WGUB 4ZD3H 3QARA 5EB9A 3AABA 1H3PL 3FC8A 5CGBA 3X1EA 4XZUA 3G04B 3TO4A 4BZ2H 5J6GB 3VD1A 2BVYA 2X4SA 1UD2A 1X5IA 3WFHB 5C09D 3HS0B 2JCCE 3FRUB 5C0RL 1G9EA 1A1OB 5C0NC 2UUDK 1AGFA 1N6QH 2EXWC 4JY4B 2Q10A 3OB0H 4Y7OC 4CC4C 2AXHA 4G7SB 1WIUA 2C3GA 2F8IA 4Q56A 2PTTB 4JFQA 4LU5H 5HHQA 2VGLM 4XPAH 1I4FA 2ESVB 3LQZB 2YRLA 3TOPA 2YPLD 1RIUL 4M61B 1TETL 4JDEA 4OZIB 3PRZA 4PR5A 1DANU 1RD6A 2GIMA 2YPLE 4NGHL 5MEOA 1LTXA 1EHNA 1IBGL 4W9IC 4LKXA 4WJKB 4AENA 4HT1L 3BUPA 3QEUA 5JHDD 1NDGA 2YQ2A 4A63A 3S9DB 4KTYA 4WNJA 1P5VB 3REVB 5HY9A 4N2BA 5JHDE 4A7QA 5LNGA 4G1MA 5K59F 4H7VA 1OLZA 4RESB 1Z66A 1MZZA 3LH2L 3D3VD 5ALBH 3H7BA 8FABB 1TTFA 2E3VA 5JHBA 3MGAA 4PGJA 3D3VE 5GIRA 1LO5B 2E7DA 4OZGB 5GGVL 3RVTC 4ANXA 4TMPA 3HUJF 3AG3B 3FF7A 1UYWL 3MV8E 1UFUA 3FB7A 1IGIL 1F5WA 1D9KB 1F4XH 3T77B 2VABA 2DM2A 1PLGL 5EO0B 2CO7B 3V4UL 5I6LA 3WXVL 2F7IA 2EDBA 1C16A 1DSFL 3W11D 1DJIA 4OJDH 1ESOA 1TZ8A 4QXVA 4PS3A 3VU2A 2OJZL 1E5YA 2H1PH 4P4KD 2I07B 1X5LA 3B37A 4Y4HB 3ZRSA 4WU7B 5E8PA 3CFMA 1EFXD 3UO8B 3U9UB 1M7DA 5TE6L 3ULUF 5E08H 1EEYB 2PXYD 2O5ZH 1TQVA 2KT6A 2XKNB 4RFOL 4Y19A 4NHUB 4G7QB 1U3ZA 4TSAH 4EZJA 2QPDB 1S7VA 3BESR 1WF5A 4XP6L 1XB6A 2X70B 1CICA 3LKRA 4ZO9A 5GGQH 1DQTA 1ZHLA 4MQ7B 1SEQH 5E6UB 5IBUG 3F01A 1RZKL 3QIWC 4LGPB 4NRYA 4S1QL 4S2SA 2OSLB 3US1A 1UXLA 1JDCA 3EGXB 4MLIA 5FX3A 1ZT4A 3BGAA 4E68A 3DUHA 1TU2A 4G8IB 3ZOAA 2QDVA 1GCFA 3P11L 3CSYA 4NQSB 1X5JA 3CC5A 1DQLH 3OD3A 3JWDC 1N5AB 2K3HA 3FN3A 3QO0B 2RTTA 1PKQE 3AB0B 1AFVL 4MSWA 4DGIH 3QW9A 1IBDA 2X38A 1OSPH 1BEYL 3G6JE 2EUVA 4JVUA 4K3GA 5ESVA 3O2WH 3MUJA 4MNHB 4UYPA 4BHUI 4L29B 4PTTA 1FYTB 1SOSA 2VITB 2HG5B 3BAEL 1SY6A 4B9CA 4YIQB 5CGYD 4TVSa 5JA9A 3FTGA 3LX9A 4K5NA 4LKCA 4XPFL 3NOIA 4JPKH 4XX5A 5EF1A 4PRPA 3V5DB 4BK8A 2I9TB 4PJEE 4FG2A 3TVMC 1TQCB 4UQ3A 5F6IB 1M1XA 1QEWA 1CMOA 1CIDA 4BH8B 4KRLB 4AYID 5D4HA 3IB4A 3OLDA 2J71A 3CPUA 1DQKA 4PSPA 3TO2A 3RFZA 2GK2A 1OB0A 5LG6A 1FVDB 5KBLA 1DVUA 2CKBH 5HDBB 5CGMA 2ZUSA 1XCXA 1E9QB 3CFDA 5EU6E 1T5XA 5TE4H 1CBJA 5B3JF 1JJUA 2Y3AA 4HU2A 3MLRL 5GGSY 2R1WA 3MUHL 2VQ4A 2C9QA 2Z65C 1LD9A 1YMHA 3QQ3A 4U7MA 4YX2L 4IEFA 4UANA 1TJHH 1M9WA 1NEPA 3E2HC 3I6KA 4XMLH 5INCB 3SOBL 5D7HA 3QORD 2ZAIA 5TH2A 3SDDC 4R90L 3RUGE 1S78D 4R26L 2HRHA 1KB5L 4Y9CA 2JJTA 2Q3ZA 2XKSA 3MRIB 5FGCB 5T5NF 3RWHB 4BFIA 5EH1A 3E0GA 3QFJD 3BRDA 1OVZA 3DVIA 4JAMA 5HHNA 4M8QA 2Y3NA 1UWYA 3QFJE 3UIYA 4LAJH 3ZE0B 5JPNA 4ZUTB 3BT2H 1QATA 3I02A 4JANA 1ZGLA 1QBMH 2W94A 1QHOA 2V33A 4O2CB 4AYFA 2FUQA 5JYLA 4HCGA 4UNVA 2WINA 4HJEA 1XR9A 1DVYA 4JG5A 4YZFF 3GSRA 5CD5D 5I1EL 2EIZB 1L9QA 4YSQA 4H20H 1MVUB 2PWEA 3MXWH 5DS8B 1T0MB 4MXQC 1Q94B 3BQUC 1ZVSA 1V8HA 2A0LC 4K0OA 3ZSTA 1DLHB 2J43A 3NZ8B 3WEXA 4P2QE 3CIQA 2GAZB 3CVBA 3VRLE 4BWTA 5E8EB 1FGNH 4IBZA 4OM1L 3FCTA 1OARH 2JWYA 3MJ7B 4TQEH 2E9JA 3PP4L 4ZW6A 1HT6A 3GMMB 1T1YA 2WP3T 3PAVA 4NQED 1JYWA 5FUCC 3OAUL 1YEFL 2A9CA 1HNFA 1U33A 1YJDL 3KWWA 4AITA 3VFRA 3TBTB 1USZA 4I7ZC 4V1DD 4AYMC 2HH0L 2EABA 3E6HA 4QKXB 4LHJB 1T6WA 2QJDA 1MFNA 3MRGB 4V1DE 3VXMA 5GJSL 3K8LA 2H2PD 2HFFB 3QFGA 5T1DL 3GMLA 3L5XH 5FM8A 2DLGA 3BP5A 1CWVA 2J12B 3ZVVA 1NKOA 2KZKA 1TZIA 1VZGA 5EA0L 3CBJB 3GJEA 1D6EA 1CE1H 3U6XA 3B9AA 1OTTC 2BIHA 1A9EB 4XWOD 4QRSB 4A6YA 2CK0L 4LSUH 3ZBMA 2FX7H 3IPBA 3N1PC 1FH5L 2D4DA 3MUY1 1CE6A 4WY7L 1OGAA 4F3FB 5LGJA 3FFCB 1ADQH 2IPKB 3U2IA 1RURH 2WZ6A 4DK5A 2FX8H 3ZKMC 1JZ7A 3CLEH 3MNZA 3DETC 3ZJAA 2MCMA 1BLNB 2F8XC 3BWAA 3ZKNC 4F1SA 3W5MA 2GITB 5FO8B 1AR1B 5DHEA 5E6IC 5DD1L 3SN6N 3IFLL 2IH1A 1FNLA 4AK1A 1T0OA 1JRHI 4RRPM 5C3IA 1M42A 4HEME 4AUJA 3MAWA 1KIPA 4PJ8D 4AYGA 3X1BA 6FABH 3R0MA 4M7LL 3UBXA 4BKTC 5JPMB 2OULB 3GMNA 3UTSB 2E6PA 4OGYL 4X4XA 2J2ZB 2IG2L 4ODSH 1OCOB 4IHBA 4N68A 1MJUH 2HKHH 1FLTX 3TYFA 3KXFD 4J4PC 1BMWA 3BEVB 4KI1A 4WUUD 4IBTA 2FSDA 1JZEA 3T0EC 4ODXA 1EEZB 4L0YA 3QXDA 5DHVA 5IGXH 4LEOA 4DP8X 5EUOA 1IGML 2J8UA 5K39B 2EDJA 1KACB 1A6VH 3D30A 1IVLA 1NL0H 3K7UA 5HVGB 4S1DC 3OAYH 3SDAB 3UMTA 1LE5B 1ZE3H 4EE2A 4UTAH 5AL8A 1R4XA 4NKMA 4GUPA 1J1XL 4V33A 1KEMH 3O41A 3QJUB 4NZDA 4A2DA 3GINA 1MVFA 1U8JA 3Q1SH 4WI7A 3EYVA 3U4AA 3VXNB 5E1AB 3VFGL 3QEHB 4KKNA 2GEEA 1DQIA 2QT6A 3U0TA 1NDMB 3PFQA 2DDQL 5C0AB 3MV7A 3VSQA 1ZS2A 3VXPB 4ELME 2XJLA 4O00A 4Z7UF 2IDUA 5F7MC 3C9NB 3X12B 1T1ZA 2J8OA 4P57B 1R3JB 5C08B 3T4AA 4PHXA 3WTVA 2X2JA 4DKTA 1BW8A 1BZ9B 3BSGA 1UM6L 3UXFA 4PJFB 2VIRB 1FO0L 8CGTA 5I24A 2PO6C 4P59L 2WBJD 4DQOH 2EQDA 1JN6B 3CPLB 5MI0B 3RJOA 5DHYB 3DVNB 2VCOA 1YQ2A 2J88L 5SWSB 1W8EA 1EEUA 1DQDH 2E27H 4G3YL 5IW6A 1GGBH 5JXEC 1WUZA 2IANE 3POCA 4AYBA 3QCVL 9CGTA 2YD6A 2DWSA 5AZEH 4ETQB 3VMOA 5F1SA 3EYUH 4W4NA 2HFEB 3ZO9A 2DW5A 3NJLA 2P80D 3MBED 2Q76A 3D87B 4U1HB 1N26A 3ZE0F 2YUZA 3DMMA 2VKWA 2CJSA 4ADGA 5BMFL 2GFBA 2WVTA 3ILPB 5CBAA 3ULSB 2WNKA 2FIRT 4ONFL 4WTZA 3N9GH 3DXAB 1IVTA 2C9UA 4Q7DA 4GBXA 1IKFL 3Q9QA 4FABL 4JG9A 2YMTA 5EZLA 4AG4H 4WI4A 5DC9B 5IBTH 4L3AA 3WLBB 1AR2A 5IVOA 2FQEA 2VJXA 5BUGA 1FCCA 3QI9D 3NZSA 5G4OA 2R56L 5JZ7C 3QWRA 2HTLC 1KJ3H 2JJWA 2BNRB 4M5SA 3HA0A 4OFIA 2V4LA 3KS0J 1T80A 4H8HA 5LG1A 3WUWG 3TZVD 3VAEA 3OKKA 1U3NA 4P5MB 4XC1L 4ZPTB 1WZKA 1PIGA 5B1JA 1R47A 4UM8A 4PTUA 5JMRA 4UAOC 4JFXA 1HC1A 2QHRH 2WKLA 1PZAA 3KLQA 5JHLL 3UTQA 1WRFA 2WXPA 4Z7OB 1Q0XL 3WFCH 1RFDL 3ES6B 1L7TH 2NQDA 3K1DA 2J1XA 1I1AB 4JHAH 3T3MF 3V95A 4GRLC 3U2SB 2FRGP 3UAJD 4DKFH 1FG2A 2HT3C 2CRIA 4XPHH 5JIIA 1A7PL 1C5DA 5T1KB 3WJJA 1IT9L 3C5ZC 5FAAA 4BKLB 2UZIH 2NQ3A 3VMNA 2Z64C 4P23B 1ZLVH 4C59B 1L6ZA 3DRTB 3FONB 1LEIA 4UZUA 3H3PH 5I5RA 3U6RA 2VLJD 2VWEC 5I30H 1Q4NX 1SYVA 2WMPB 1W72B 3ULUC 3UAEA 4I48B 2VLJE 2CHZA 3KPSA 2VDPL 4BEIA 3WIIL 4JJ5B 1S9XB 2B1AL 4UINL 4DUVA 4XMVA 3IFPB 3OX8B 2UWEB 1A1NA 3RPIA 5HXMA 2DL2A 3US0A 3L9YA 1RU9H 4XBEH 1DVFB 4L4TD 3VXTB 3VI3F 3R06A 4KQ3L 5FYJH 2EZ0C 4R2GD 3ZDXE 1LO0L 3IDMA 3QUML 3H9HB 1Z9SB 2WW8A 1U8KA 5EU3A 3QRGL 2PTVA 1BBJA 1B88A 4UM9A 5E8NB 3LKNB 4LCUA 5KSBA 1U9KA 4YFDB 4BCZA 2B0SH 3CVCA 4RX4D 4ZFQA 4AJYV 4BA0A 3GKWL 3QDJA 1X5KA 4PPTA 4I0PB 4M6NH 4QOKE 3B5GA 1GPOH 4K7PH 1KGXA 4UOZA 3FTSA 1AGDA 3QEQE 5DD6B 5E5MA 4JMNA 3KL0A 1SJEB 5E5RB 4EVNA 2VMDA 4U1NB 2DF3A 5I6XB 3QDMB 3RTQD 5L4JA 4WFED 4R4ND 4HUNB 4FNLL 5IREA 4CC0A 4UOW1 4F33A 1EHAA 3GZOA 5D7JB 4KZEH 4EDWL 3L1FA 3O6FA 3KPPA 2VC2L 5FK9B 4E42B 3HW7A 2JKRM 5LBSA 4YXHH 2ICWB 5J4MA 5L2KB 1I8KB 4JCLA 2Y23A 2YZ8A 3X1GA 2XHNA 3IJEA 3DJTA 2WZ5A 3M1OA 5C6WH 4OQTH 4H5SB 4C56D 1F18A 1YC8A 4P2RD 1R3HA 1PQZA 1K5WA 3FL7A 1DBJH 4XX1E 2OJEB 3HBPA 2J5LC 1EMTL 5TQ2L 2E47A 3K2IA 3WIHL 2VDOH 3SBPA 5F7YC 4F93B 3W82A 4FA8A 4HWBL 4OZHB 3MLUH 4YDJA 4MJIB 1HAUA 4OCXH 3BSZA 4NNYA 4LDOB 3V6ZB 3RWCB 3IPFA 3OC8A 2OSXA 1NCCL 2JE8A 4ZT1A 2FWUA 4JL1A 2APSA 3SY0A 4PRBB 1IO4C 3FPXA 4HCRL 5DVNA 3AT8A 5EO1A 3N06B 4HLZH 4W4OA 1JZDC 2VDRH 4NJ9H 5DRNA 4B5ZA 1YDPA 3IXTB 5AKRA 1U8MA 4P2AA 3QFDB 3V0HA 4AV0A 1RJZA 3ME0B 3HS0C 3B2VL 5ADOL 1MFUA 2X4UA 2DQTH 1HQRA 4KXDA 5FO7B 4BZ2A 4LNRA 5LVEA 5BOZG 4K23L 3VGGA 4XO4A 5F8RC 3MV7E 4A37A 3QK0A 2VW7A 3ROLB 1O6SB 3TBYA 3K71A 2I9TA 1SLWA 2J3SA 4R4FH 4JKLA 1SEBB 3IDUA 3BUYB 3NCWA 1TO5A 4QRPD 2B3IA 5DXWA 2JKJA 5HYSA 1NUGA 5IHZB 5KVEH 3A6CH 4G7VH 4AIXA 2X10A 3D2UD 1A6WL 3ZZLA 2CMRH 3CFCH 4GQ9L 5FW6A 4RSYA 4JUSA 1QSZA 3FO9A 1MH5A 4F91B 3SE9H 2YLKA 4A39A 2VW4A 3HG1B 3PQYA 4NQVB 5TTRA 1JF5A 3CN2A 3V10A 1KCSL 3KYMA 5I66B 1UTDA 1G9NC 1FGVL 1P2CB 2AGJH 3B9DA 4YHZH 2ZG3A 2AEPL 4JKPH 4G6AD 5C09B 3NVQA 5TQ0H 3VH8A 3MLSL 5IVXA 3F5WA 1XD1A 2DYSB 4IRSA 2HJFA 3CSGA 1TMCB 2L7UA 3L7FB 2FWOB 2GHWB 1A7QL 1CD1A 3T1FB 2JSFA 1OOAA 1T2QH 4U3HA 4PJCA 2PP9A 4JO1H 3S37H 1D9KC 5AAMC 3VVVA 1ZA3A 5F9WB 3UG4A 3W0WD 3VTAA 1QNIA 2XPZA 2NNCA 2BMKB 2EJ1A 2WUBH 3OGOE 3MCKB 3OWEA 2XXFA 3W0WE 4Z77B 1JHKL 5KSVB 3OMNB 1QLEH 4Y4HC 5AD0A 1T1XB 3F12A 4YJZL 2MNJB 2V7HA 2IH9A 4NKQB 5D1QD 4QHKJ 1C5BL 2TSAA 5DEGA 2B7DT 5AW8B 5IQLA 5D55A 4EN3D 4YE4L 2CR0A 4PGBA 4HD5A 1NCGA 3GM8A 5D1QE 3DIFB 2RFXA 1PLCA 2FQFA 4Y2OB 2DQCH 5KSAA 1O5DT 1H3XA 4F37K 3EXLA 2YD4A 1I8LA 3ATBA 1DDHB 4FULA 1P6FA 3RI5K 4OLUH 3ARSA 4RISH 2X1PA 4GG8A 4PRAB 3L4CA 3BKMH 4BQ9A 4KH2A 4ZNEE 3NMEA 5GS0H 2YRBA 4ZUVB 3ZTNL 3OBAA 3NCJH 5E99L 2GUYA 2APBA 1CYXA 3OHXB 4Q4IA 4MCMA 1DJWA 3AB0C 3VRJB 2EE2A 4P4KB 3NABL 2V9TA 4JHWL 5DYOA 3VYNA 4HH8A 2V2WB 1P4LA 2K6WA 35C8H 1EFXB 3M45A 1ZANH 3G6DH 5DD0L 3GI9L 5TJWK 1ZIBA 3FQ2A 4LASL 4MNQA 3K6IA 4QF1A 5A3ID 1QKZL 2JELL 3KGUA 4DOHB 4M4RB 1FORH 4N6QA 4YGAB 3RX7A 1KCVL 1PL3A 3QSKB 1ITCA 1MLBA 4Z1PA 2OR8A 4F7MA 1AAJA 4IS6A 4NQDA 1TQCC 5F6IC 1IGJA 1PGRB 4YGVA 3HAEH 5B3NA 2I25N 4FFZL 4Z7QB 2NUTA 2IAMA 2XVBA 1VFBA 5L88L 2WXHA 4BSVA 5J6SA 3HJ0A 3WUWA 4NEHB 3O6ML 1KLGB 2H3NA 3MZTA 3CSBA 4BBWA 3WNKA 2HWZL 3WKML 4XI5D 4PRIA 1REIA 4P5KB 4LARL 2NY5C 4ZMNA 3QJFB 5KBKA 4JDZB 1L7IL 3PUCA 3B83A 5BZXA 1BV8A 3QQXA 1KTDA 1NLDL 1K3ZA 2CKBA 2R1XB 3KLHC 4OIIL 3B2PA 2OMWB 2P42B 2HTKC 1B0RA 4OZHF 2H2SC 3WJMB 4PJAF 4JNXA 5BZDA 4LP5A 4D7PA 5DUJA 1J9QA 2G9HA 5A16B 4NZJA 3QRLA 4OD1H 3GTNA 1H15A 3H0TA 2OSWA 2VL5B 3Q6GL 5IOPB 3BFWA 2XYCA 4E36A 2GI7A 4LSVL 2OXGA 4O9HL 1JPEA 5EOTA 2EE9A 1KB9J 1RI8A 1G5AA 1C12B 1HAWA 1BF2A 2B8OT 1EZLA 2H6PA 2PW2B 3B9KD 3P3UA 4U1LB 4WGVB 4P46A 5GS2D 4ELKA 3CCHA 3FN0H 5DJ6A 3C2AL 5ACMA 1HCYA 2XBTA 1HHKA 3QIUA 4U31A 3WLWC 4Z7NE 2ZX5A 5F7AA 4Z3EA 1ILUA 3PWJA 5F0LB 1EAPA 1UH2A 4LO9A 4WF7A 5C0JB 3O45A 1U3YA 2CR6A 2J1KA 4TQ8A 3K0YA 4DF9A 2NYKA 2UY7B 3IU4L 4Q9RL 3BKYH 3SE4C 3D85A 5FYKD 5E9NA 1YEIL 4JQIL 4W68A 2XBDA 3BAXA 1BM3H 1KB5B 5FYKE 2BFVH 3RUGB 3GI8L 2Q8BH 1LK2A 4Y2NA 4TTGA 3UZQA 4LHQB 3FB8A 5F7NC 2HPTA 2DD8H 1CGWA 4RFEA 4OD3L 5F96H 5FS5A 4BE5A 4NDMA 2HN7A 1NAMH 3T6VA 4OLYL 3BT0A 1B0GA 2MH4A 1E4KC 4JM0A 2CA4A 4J6IA 3JV4B 4RMBA 3QDGD 2UZYA 2F61A 5KS9E 5I8EA 2A74B 4KZCA 2BWDA 3S35L 2NY6D 3L4TA 3ORJA 3S4SG 4AMWA 2IGLA 1JYXA 5SV4A 4CVXB 2FEEI 3EJTA 3NFNA 3MODH 1KENL 4JPVH 5BRPA 4KNQA 4WJG3 2ZSVA 4AT6B 1JRHH 3D6GA 3MRBA 4DN4L 3IVKA 1EDYA 3HI6H 5C6TL 4POUB 4OGXL 4YWGH 4PJHA 3L5JA 5DMIH 4RZKA 5JLZA 1GZQB 3CFTA 2Z4QA 4HIQA 4F8PA 2QSTA 3BVVA 4HJ1A 3WIFA 3RL2A 4F2MB 4NKOB 1JF6A 1DJYA 3DYMA 3WS3B 4BQ6A 4YEEA 4WKXA 4NQEB 2O93L 3MSPA 4NZRL 1J5OL 4HLZG 3WIAA 3QR2A 3SJVD 4LSQL 1GS8A 2ZWNA 4WEEA 1RPUA 2LLGA 4FADA 4MMZB 4HV8A 4NM8L 1GKEA 1ADQA 1HVXA 4RQQA 3X11B 4G6FB 4TLUA 1OOWA 1YEEL 3NA4A 3DX0A 1XXFC 4L8BA 4HWEH 4X9BA 2O30A 3CN4A 1EUTA 3HUJA 3OKEB 2KZWA 4G1EA 4HBCL 1NSNL 4G71B 1BCIA 2CHXA 3LVTA 3OJDA 4K3EH 5JPMC 5EMYA 1A6AB 2WZ0A 1I8UA 3LIUA 4MMXA 3BLKA 2UXFA 5KAQF 5SWQB 1OSYA 1VEOA 4EUPG 3OKOB 4P48A 2EXTA 1OP5H 3WG7B 4WW2F 5LAXA 5D1XA 3S34L 4QRTA 1A4JB 4X0NA 4DUWA 4S0TD 4ZTOL 4EXPX 4Z95H 4Q6IA 4KXCA 4XAWH 2Y1YA 4Y5VB 1WZ1L 1NEUA 1RH8A 3QVAA 1ED3B 3SDAC 1O6TA 3BAJA 4O2FA 3SKNA 1DCEA 4ZPVB 4KVNH 4XHQA 1CLOL 3IEAA 4TKWA 3VA6A 1IGCL 1ET5A 1IAIM 3RAJL 1SMOA 1CK0L 4MQXC 2KZ1B 3EF7A 4F5CA 2XVGA 4MS8C 1CVSC 4UTAA 3OKLB 3EJRA 3RHWF 1CT8A 1HDMB 3BGMB 4H8VA 4O58H 2AMGA 4ICWA 1KWGA 2WGNB 1WAAE 4NIYE 4JM2B 2YAHA 1V7ML 5C07D 2G5RA 3VD7A 4IMKA 5ESQB 4XH2B 1OAUL 1T4KA 4MXWH 5A1AA 3KXFB 2X2YA 5BO0D 5C07E 3SDXA 5JIDA 1KT2A 4HSAC 2N0KA 4WUUB 3JZ7A 1GZHA 2V5SA 5GISH 5LB1A 1YNLH 4YDNA 3PJSB 2Z0UA 1F4WL 4Q14A 1IM9D 1MW0A 4HX1B 5MI0C 4FLRA 3C5XA 1GYWA 5HSFA 3EYOA 1T4WA 4NCC1 3WS6C 3Q8AA 3WNNA 2Z7WA 4HLJA 2XN9D 4HS8H 4WDIB 1NEZG 1E6JL 4U1SB 3WMQA 3WO4B 5LXVA 1MJ7L 2XN9E 3AC0A 5CU5A 3RGVA 4F92B 1F58L 1XF4A 3IRPX 4MDIB 4DAGH 2JNZA 4I8DA 1VFAB 1T03L 1JPFA 3HJEA 3IJSB 1H6UA 5GGTH 3FUKA 4QY8B 2D31A 3A6BL 3GXNA 4JKMA 4LCWA 4BFBD 4JR9H 5JTWA 4XNXH 4NT6A 1FO0B 4JRYD 5FO9A 2WLHA 4N8CL 3DECA 3MOBL 4PV8A 2IVFC 3U9WA 3K0WA 4QJ5B 3TT1L 4URTB 1JFQH 2KERA 4LFHG 4OLZL 1I3GL 2WBJB 4N2AA 1UWGH 3MLWL 1L6PA 3IDJB 3B1UA 3QH3A 2YMXL 1NIFA 4PB0L 5D7IB 2DTML 3L5WB 1I1CA 1H6TA 6PAZA 3DJZA 2BVUA 3CX5K 3U46B 1IARB 4OLVL 4U1IB 5KN5A 3VXRB 3K8MA 4FI8A 3LDBC 3HMWL 2EADA 3AADB 5DQ9A 3HC0A 4LCCA 5DJYA 2E4FA 4JS7A 4WWKC 5DZOA 1I75A 3MJ9L 1RUMH 2IGTA 3DX9A 3VSUA 1A6ZB 3A5VA 4HFUL 1GAFH 5E8DL 3MBEB 2X6AA 5EZJB 3S96B 5AVRB 3E1ZA 3ECBB 1JGUH 3RX9A 3WE6A 3T6XA 1N8ZB 5SV3A 4RAVA 2YUWA 5CKGA 2GJPA 3AM8A 4PP2B 1DL7H 4YDIL 4ZS6D 5JIQA 3Q01A 1I1AC 2A6DA 2VN7A 3HVNA 3MNVA 3S36H 1JK9A 4R4BA 1GYAA 4K8RD 4IHOA 2PPFA 4I4WA 3AAZB 4JO3L 5I1JL 4H13C 1G1YA 4KX9A 4WSKA 5B7FA 4DCQB 2MFNA 3L8QA 4RNRA 4B9KC 3FQRB 3G3LA 3IE4A 4P23C 2V9QA 2EDMA 3CFKA 2ZXEB 4K8RL 1CLYL 1XR8B 4OFYA 4LSPL 3TM6A 3ULVD 1YY9C 2NX5D 1ORSB 2Y5TA 5MENA 1CB4A 4OGQC 2ATKB 2AJYH 5D9SB 5TF1L 3TWCH 4AVIA 4P3DB 3TPKA 2OL3L 2C9PA 3KW8A 3ULVL 2E7LC 2N4IA 2BRRH 5IWLA 3QUZA 3F7PC 3P0GB 4HUXB 4NOBA 5F7EL 3SDCB 3H9SD 1KPUA 4EIZC 2W0FB 4XC3H 5IEKB 5BV7H 1BFVL 1JGDB 1FVCA 3H9SE 2NLJB 1DVFC 3QYNA 3MRLA 1X5YA 4FHJA 3RDTD 3SKJH 5I1DA 4BCXA 3INOA 4XOCA 1H19A 4HJ0C 1Z5LB 2Z35B 3HNSL 4ZX5A 2BS9A 1HEJC 4GKNA 1Y18A 2AJXL 1BVKA 3NYKA 1OAQH 4UB0H 4LLVB 2WCPA 2NY4B 3C6LD 4G6JH 4I0PC 1L9SA 2XQBH 1JD9A 5IQ7L 2VDPB 3N1QC 5T5FH 5CD3B 4KDTA 5HHXL 3L3DA 2G2RB 2MTAA 5IFAL 3HN3A 4K5OA 4EIGB 1UB5A 5I6XC 4LSDA 4PJHE 2XTJD 4ACPA 1ND0B 1U91B 5DWUH 2J5WA 2HLAA 3JTTB 5D7JC 2XTJE 1L6XA 1EGJL 2MKWA 3QUMB 2NW2A 5LWYL 5EN3A 3N1FC 1G7MB 4FTVA 4L4TB 2R7EA 2C7UA 3BD5A 1HZKA 4NO5A 5EEYA 1DJGA 4JFOA 3WXWH 4LPTA 4AGOA 2K8QA 3ILQC 2J56A 3O11A 2IALA 1YPZB 2DIBA 4QXGL 5HJ3A 3MOAL 3STLB 1SVBA 3LKPB 4IDJL 5EU4B 2XWTA 5DC4B 2PW1A 3FQ1A 1F8TL 3GIVA 4OQTA 3VM5A 4NRZB 5AENA 5CJXA 4GSRA 2RALA 1SJHA 4MAYD 2YC1B 1OM3H 1ZRUA 1UVQB 3FKUS 2F0CA 1DN0A 1G4RA 3KHOA 1KCBA 2G75B 2VC2B 4KTEL 3MJ6A 4E41D 3LOWA 2QQLL 3TT3H 3DUUA 2F7RA 5D1ZB 1IBYA 4E41E 1PLBA 5IQOA 1NGXB 3LRLA 5ITFA 1D5ZB 4L9LB 1AD0B 3ALPA 2EKSA 5FUOL 3NP3A 1BQHG 1K4CB 4G2AA 3CXDH 5I75C 2XRAH 5C71A 4C55A 3BW9B 4X6CF 4Q89A 1HHHB 4C56B 1LWRA 4K9EC 4P2RB 2FWSA 2BOCB 4MNGE 4PY7A 5GRYA 5JQIB 1LDPH 1MRFL 1PZ5A 2CSPA 4Z7UA 1TJGL 3D52A 2D7TH 4NUJB 4TULL 3G5VB 5F9DC 2ZXCA 1GMIA 4HZ1A 4X4YB 1VRSA 1DSWA 1S3KL 5C0DA 5AB2A 2WLNA 4FG6C 2VXVL 2X2IA 4GI6A 1WS8A 3K6SA 4HEPG 3VQ2C 3ZZ1A 2HA1A 3MO1A 3O6KL 4OF0A 2JKSA 4G43B 3MJ8A 5KVGL 3VXOA 2XG5B 5KVDE 5D7IF 3CVHL 1CD8A 5J11B 1BQKA 4BFFA 4V2CB 3AFLA 1NGYA 2PR4H 1QVOA 1J05B 5E70A 4UT6H 1ID5I 3WNIA 3UPAA 1TOXA 5H8DA 4FXGA 2ZP9A 1UA6L 5DK0A 3MRQA 1BVNP 4Y4FA 3FCGA 1UUSA 2DI8A 4FNUA 3RA7H 2ZG1A 4FC3E 3TPUB 5EBWA 3W39B 2OZ4H 4ANKA 4O02B 1AO7B 2VDQL 1ZEAL 3ZDZB 1WA1X 2QLYA 2HJKA 1FP5A 2E6JA 4X4KA 3RU8H 4EAEA 3K72A 3CFJA 1TTBA 2LU5A 2DQUH 3D0LA 5KYWA 1MHPH 3FRPA 5KYUA 1CVRA 2F68X 3UZEC 1G9HA 3BI9X 1IGTB 3DUSA 2K4WA 3HOGA 1FV1B 2FBRA 2ZOKA 1J8HA 2YLHA 3UO1L 2XV6B 4QRPB 2V7NB 4DKEH 3ZKXB 3BD3A 4YHML 2LAAA 2XA8L 4HCFA 5KBMA 4XB8A 4F7CB 3D39D 3D2UB 5D2LE 4R7DA 1KV7A 1DUZA 2CHDA 1IGYB 4UYQA 2AJ3A 3D39E 2CXKA 4XMXA 5A2JH 2I5YL 1KN4L 2HUEA 3RBSA 2ETWA 4JPIB 1JTOA 1DO6A 4FZEH 4ZQKB 3CZFB 4JFFA 5KZCD 3DBSA 5HGDB 1TYJA 1XGTB 1RUAL 4QHNA 1PFCA 4M7ZB 4YHKH 4DGYH 1YEJL 1XB8A 2AMUA 4X6DE 3HR5B 1QBLH 1OCWL 3BPNB 5T3XE 3FOMA 4LEXH 1K5NB 4BHUA 1S7XB 3DV4A 3GXIA 1TYEB 3JZYA 3DGGA 5LXGL 3ML8A 1Q38A 4MYWB 1KTCA 3OHXC 1KGCD 4P4KC 2PYEA 3Q2NA 3K91A 3ARBA 1UEYA 1EAQA 2QSQA 1FL3B 5C9KA 2OMVB 3QCUL 2ZKWA 3TIDA 4GPVA 2R4SH 1V5JA 3PHQA 1ZLSH 4EN3B 2DWTA 4XNQB 4KRNA 4U6XA 2AV1A 1HNGA 3ESMA 2YPVL 1S7TB 3VI3A 1S9VB 1LM8V 4JMXA 3V6FA 3WMPA 4EBQL 5JOPE 5TF0A 1MZYA 1VFOA 3N1GC 1QR1B 4L5FL 3HG2A 1P5UA 3M88A 3MR9B 5MERB 2VQUA 1T6VN 4Y5YB 3S3JA 5BS0B 1WVZA 4KITB 2OM5A 3EO1A 2X3AA 3MDJA 4Y9EA 3HAEA 4O4YH 4O5LH 2FZ3B 4JKNA 1QSVA 3LZFH 3L4YA 4ANUA 3NBNA 2A9NH 3U4EB 1P7KA 2AVFA 4D3CH 4F9PA 3UH8A 3RZCD 2WNGA 4APQD 1M05A 1Q9WA 3WHXB 1IBBA 1A6TB 2OR7A 4MX7B 3DX7B 2LFGA 2WLKA 4ZFFB 1TEGA 3MRJA 2G3ZA 4XXWC 1PD1A 2R2EA 2ZKXA 5D7SH 2FLBT 4G83A 3ECUA 3NIDF 4JFEA 3HHRB 1CDIA 3L2LA 2HFGL 3RWFA 1RJYB 2JQMA 1UD4A 2NY0D 1YEGH 2BLFA 4YHOL 4NN5B 2HKFL 4EI6B 1JF1A 4GG6B 4XCNA 1A25A 3L7EB 1UJTA 4KKCD 5IB3A 4JPWL 5F21B 3L1OL 1SNRA 5FA3B 1CLVA 1M7IA 1KTRL 3VFVA 1MHHA 1H3VA 4FX5A 1S7RA 1AZRA 2QZ5A 3SPIA 3Q48A 1Z9PA 3QBTB 4R8WL 3D08A 3NA9L 3FCBA 4OB5H 2W5PA 3AXLA 4WI6A 4BJLA 1KEGH 3D18B 4BQ8A 1AJ7H 4J3WA 5JIKA 3UEQA 3MLXH 5G5DB 4YPJA 4OW6A 3MC0A 4QRBA 4LIQL 1B6DA 1A3LH 3DLQR 4M7KL 5I1GL 2NZ9C 2Q86B 2P8MA 1AHWB 1Z1WA 1T20A 3GMQA 2DYPD 1S78C 4M8VA 4IK7A 2OI9B 1T5WA 1SGKA 3R0NA 3LIZH 5FKAB 1E5BA 2FNBA 1U3HB 4XNDA 5JR1H 3LEXA 2DLFL 3P0YH 3QHZH 2O6CA 2H8PB 1RUQH 1E9OA 1U8LB 2WTRA 5LGHH 2WM0A 3ARGB 2L8AA 4KNUA 4LLQA 4LOFA 3HNVH 1T0NA 2A74C 4YE0A 1NAMA 5B1CA 1YN7B 4Q0XH 2QV2A 4JGNA 2JIXA 2VR6A 3A22A 4XPTL 5HHPB 1NBVH 2Q9OA 1RZ7H 4D0BB 1OTUC 1KPRA 3B43A 5D6DC 1UWEH 5FYKU 5BW7A 4MQTB 4KK8D 3QC5X 4AOFA 3TBVB 3ATFA 1EHLL 3DVGB 4MDJA 3F6JA 3EDFA 5C0FB 4PJGF 1YJDC 4MJ6A 5C0BE 5GZOA 5ALCL 3APDA 1DQVA 1M7XA 2Y69B 5D6CA 3BGFB 3NEEA 3CHXA 3LD8B 3LNGA 1E5CA 3WEAA 3UPRA 5E24E 2IPTL 1X9QA 4F57L 4Y16A 5IUCA 2BNUA 3FO1A 3BE1H 1VACB 3QULA 4YHPB 4ZUWA 4UV4L 5G4MA 3QDGB 2DBLL 5M95B 1N64L 4MA8H 3FQYA 1L0QA 3AMLA 3IRZA 4ZMQA 2NY6B 4PJXA 3T4YA 2BY2A 2H2PC 4XRCA 1MJJA 1L3WA 5L6YL 2CJTA 1E2VA 3BH4A 3JWOH 4DZBB 3O3BA 4GRWB 4OT1L 3K5RA 1WQVT 4NNPH 4HKXA 1A7NH 2H6OA 4XWOC 3HBZA 1U6AH 3G5YB 4MMYA 1HX0A 5EFIB 1QW9A 4U1GB 3TC9A 4N5UA 5IK3A 3MACL 4Y5VC 3DVFA 3SJVB 4AIZB 3ARFA 3PDDA 4N90E 5GRUL 1NA8A 2FL5B 1TQUA 3OG4B 4Z7WE 1T22A 3W37A 4Y9BA 3P4OA 5F1IA 5JQ6H 1KTBA 3WTYA 2XN2A 2OAAA 4KO6A 3QCTL 3VFWA 1EJ8A 1CDCA 1ZT1A 4GT0A 1T7VA 2DRUA 1EVUA 4P2OD 2C34A 4FYRA 3RNQB 4F24A 4ZMZA 5CLZA 3QDAA 4BRVA 4XHJC 4D2NA 2WZPD 3HZYB 2K70A 4JM2C 2CJUH 5I2IB 5KUKA 5DA0B 1JZIA 5F1OB 1T3FA 3QUXB 3DTXA 4FQQA 5C0CB 2IMNA 3LKSA 1QACA 3QJTB 3Q43A 4GAGH 1M57B 2F5BH 1FWXA 2C3WA 3POHA 4OTXH 4TUKL 4GUOA 5AVWB 2XVKA 1OF2B 3OLIA 2ENYA 1MW1A 2DH2A 4D8PB 4XPBL 1KBGL 2X1WL 3A67L 2ZXAA 4ZYKB 3TCLA 1NOFA 4IRJB 1EO7A 3N3EA 4J3VA 2G5UA 1UT9A 4XP5H 1HH6A 3MA7B 1KULA 1HCVA 1QNZH 4HXAL 4LFHD 5I76B 1KJ2H 3DX8A 2I32A 3QQNA 4WWNA 3SB3A 1VJSA 1MCSA 1QFUL 3MCLH 3J7HA 4N0RA 4FQLH 4LHUG 1WWAX 3S8WA 2CDFA 4Y19D 1N0LB 1OHZA 1XT5A 2VL4A 3BDXA 5ANME 1FFNB 4Z8FH 1SMAA 3K8KA 1SYSB 4M9OA 2AV7B 1UZ6F 5IM7A 2L7QA 2XFGB 1GOHA 4DW2L 3C5SA 3LNIA 5T1MB 4B9GA 3CHOA 4XBGA 2VXUL 3FO2A 3HC2A 4X80L 5GGTA 2GTZB 1JDAA 5E1GA 2C4XA 1CI3M 3MLYL 4RDQF 1X4ZA 4WHYH 3BO8A 2K6YA 4PJAA 1FHGA 1KIUB 2E75C 4BGLA 1NJ9B 4ENED 3VA2C 1PYWB 4KQ0A 3KYOA 2Y1AA 4IIQB 5IVZB 1URZA 4JM4L 3NESA 4G8EA 4YDKL 1AZZC 2W59A 1QSED 1X9UA 1JGVL 1N70A 2FH8A 2ITDA 5EOCJ 2JXMA 1QSEE 1SN2A 4K7PX 1BJMA 2MMXA 3MBEC 3HS9A 4GMTH 4U6HB 3UPCA 4W9EC 2P5ED 4AX3A 3P2DA 1FYHB 1TQWA 4NO3A 1H6EA 4ZNCD 4HULB 4WAFA 2P5EE 5GHWL 1O75A 4JRYB 1UQSB 2PPAA 2K7PA 4ZO7A 2BIIA 4LSRL 3ZHDA 3HNTL 3ZL4H 5C2BL 4PRPD 2AF2A 5FGSA 3KGSA 1AKJD 2CBOA 1GXEA 2ODIA 1MUJA 2NR6D 2ROXA 4HGWA 4PCYA 4I2XB 1SY6L 3STBA 5D8JL 3U7YL 2GPZA 2JKTM 3KCWA 5GGRB 1NMAL 3D33A 5L0QC 2C1PB 5DSCB 5L8KB 5F93C 1OD7A 1S3RA 1ZLVK 5B8CB 2BP0A 4X6EA 3AQDA 4DP0X 3QXUA 1NGQH 1RY7B 2IQ9L 3ARDD 3CSPA 3QHFL 4OF7A 3U0PB 4J3TA 2ALWA 1NFIB 4RETB 3N43F 1I7TA 3QUYD 4TOYH 1U95B 3VG0H 3SPVA 5CFHA 1LK3H 4KKPA 4AKOA 2JKLA 4WCYH 5K9OA 5ISZE 3SDCC 1MY5A 3I2CL 2HMID 1HSAB 2MCPL 1GZPB 1AXIB 3KBHE 4AL8L 4PV9A 4FQ1H 4ZMAT 3BVXA 3O8XC 4NLAA 3LNDA 1FVEA 2NT1A 5BVPH 2Y7QB 3LKQA 4P06A 2CLRB 4GB9A 1UHVA 4U49A 2CZNA 5A2LH 5GSRB 3SQBA 3AU0A 1AD9A 5D7LD 5EC1A 1MRCH 2WO3B 1ZJBA 2VJ0A 3CDGB 5I8OH 2BHFA 5KG9A 4XP4H 2NY4C 5D7LE 5F3BA 2DH3A 3MGTB 5ELIA 2FYVA 5B22A 2OL3B 2B1HH 1D7DA 1MRDH 2VAAA 3U7WH 3KWTA 2NX5B 1HE7A 1E65A 4HUVA 3P1VA 3LPPA 1LLAA 2QZQA 5IFJA 4LXFA 1J0ZA 1TTGA 1VGEH 3DROB 3P02A 3EFOB 4XE0A 4M4PA 1WFNA 3TNNB 4DHLA 1XH3A 5I8KH 4LLMB 3IJYB 4RMSA 5T5FA 5E8OB 4MAUL 3FAXA 1ZLDA 4E5XG 3X14B 4OSUH 4P9HL 1HQ4B 2GY7B 1N59A 5IW3A 4XMKH 4NQQA 4LL9A 2F8VA 5T1LA 1I9IH 1GYCA 3RDTB 4YS4A 4QHLB 1MFAL 4RWHA 4LLWA 4XN2A 5E6ZA 1AIZA 4OM0L 1ZTXH 2AEWA 4R3SB 5CJOH 5DEFA 1CL7H 3OR7A 5IF0B 3OLGA 1R1CA 4AEIL 1TKWA 5AB1A 5E56A 3QPQD 1CDGA 1CTNA 3TV8A 4PIBA 3FQUB 2WC7A 2Q8AH 3C6LB 5I1CH 4WK0B 2O26U 1CYWA 1ETA1 3QZNA 3L9RA 5L2JB 1NCAL 1JNLH 1A3RH 1RJLA 1IQWH 3CFBB 4H26B 4WW2A 3NTCH 1KGIA 3KHQA 2AJZA 4BZ1H 3NGBC 3MROA 3FT0A 1GYVA 4XP1H 4F9LC 2VDLH 1YG9A 1KIRA 2VTFA 3RRQA 3CZJA 3WEMA 4NFBA 3RWJB 4AM0Q 4DPCX 2DPKA 1E67A 3MNWA 5H35A 5D1ZC 4QXUL 3X1NA 1FN4A 3MV9A 5T3ZD 3ZPDA 5B1KA 1LXMA 4L9LC 1GIGL 2VDML 4KVPA 3S37X 4OBRA 3BIKA 5T3ZE 2DQIL 3PWVA 1OGAD 4X0KB 1YUHA 2COVD 2A4EA 2RB8A 3GSWA 3HLAA 1SDDB 4H8QA 1P7BA 2AZAA 2E7CA 3QZWB 4KVCH 1RMFH 1G1CA 1ZXKA 4KKRA 4TPRL 5EU5A 1THCA 5FF6B 5AYUL 4CBZA 2CNZA 3PP3K 1O6VA 3UTZB 2P8LB 3MRCB 3K6DA 4PJIA 5E00A 1MCEA 3V0IA 3TJEL 1WS7A 3QJHA 5LCVH 2OTWB 3ZTJG 5LDUA 4OI7A 5DUBA 1KB3A 4YHLH 2PP8A 3C09B 5JOFB 1W15A 3PWUB 5IW1A 1BZ7A 2HLFD 2FECI 1SZNA 4E41B 3UL4A 2KUTA 1Z3RA 3KPLB 4JN1L 3ELQA 3EOAB 3TV3H 5EEXA 4Q9BA 4CN1A 5J11C 1RHHB 2OP4L 1E6OL 2KS0A 1KXVA 1A21A 3WU1A 1BA9A 1R46A 2YPKA 4OGAD 1YY8A 3BPCA 4CGTA 2OX5B 4JFZL 5F7DA 5LNEA 3LCYA 3FBKA 3OSKA 2VLKB 3T65B 3VE0A 3JWNE 4NQXB 1AY1L 1NFDB 1IRAY 1G0DA 4NX0A 4UT6A 5AVXB 5E95B 5DJ2B 4PJDF 3AU1B 2NXZB 4YLBA 3DJ9A 4X99A 4W6XB 1WCBB 1G7HA 2LT9A 3IDNA 2XQYG 2OZ4A 3E3QE 5CINH 4NC1C 5L8JB 1JBJA 1K8DB 1F3JA 2K1MA 3CVHB 3MLVH 3QNXA 3FHEA 1ZGLP 1KBVA 3ZKXC 3L95B 4WEBL 1VGKB 3P9WB 2FB4H 1IGFH 4OCRH 3VQMA 3UJIL 1WE5A 3RL1B 4I77H 4EQ3A 2HXAA 3MXVL 3ESVF 1JOIA 3MFFB 1A7BA 2JKXA 1E3FA 3PL6B 1DUYB 3AUWB 4JDTL 3EH1A 5J9PB 4K7PY 3HTLX 3RX5A 2VDQB 4L8CB 1JD7A 4NIKB 1IAIL 2ICES 3PNWB 2EP6A 1RPKA 4RAUA 4KAQL 2WQWA 2FO8A 4PI2A 4J8QA 3WKNA 1DJXA 3GSVB 5TDOA 4JQVC 3X3FL 4I85A 2O5XH 4L8DA 4NRXA 3C87A 1PEZA 4M7ZC 4FNTA 4HWUA 3RB5A 1V3LA 1XGYH 3TN0D 2IH3A 1AQMA 3ARWA 1DQMH 3BPNC 5GRXG 2IADB 5J5EA 1CC3A 4D9RE 1JE6A 32C2A 1OXYA 4WHYG 5F3HB 5I6MA 4U3XA 4N28A 3L3JB 1OW0A 3DMMD 4PYHA 2XY2A 5I5MA 5A6IA 3GIZH 2BSDA 2WNXA 2ARJB 3APNA 4PJ5E 4MD5B 1VDGA 4F2EA 1XIWA 2YEVB 3BVDB 4GBXD 3U82B 4M5ZH 4AEHL 2RIKA 5EUKB 3LJ3A 2WJ5A 4EDXA 2BVPB 3O3AA 5INDA 1JV2B 2FYYA 5KZCB 4EN3C 3P73B 1IBZA 1U8NB 4AQ1A 5H37H 3HZVA 1ZAGA 1ASOA 2MPAH 1DBKL 5JXAH 4XGZB 4ONHB 4YFLF 4KHXH 3E1F1 1Y6MR 1TZHA 3DBXB 3F84A 1BHGA 1H5BB 3R7QA 3T0AA 5CZVH 3I85A 1U8HA 2F6AA 4Q74A 3ZE1B 2J1ZA 1N19A 5JHAA 1DN2A 1GGYA 4FKKA 1KFAH 5D2NA 2IWFA 1AZVA 3DPBA 4WNQB 4Y5YC 3VFPB 3HFMH 3BDBA 4RZCA 3OZKA 4L0PB 5I0WA 1HINH 5C8JB 3W2DH 1INDH 3KJ6L 3X17A 5IESL 5KOVC 4LDCA 5KYYA 3VXUB 1DQJB 1T04A 2I24N 3OAZK 2LHAA 5C0ND 3VI4F 3X2QB 4JJOA 1GC1H 4HHWA 1YYLL 1K6QL 1QSFD 1A0QL 4ZXBB 1AP2A 5IMLA 5DLLA 2H5UA 3UBFA 5FM4A 2QGCA 2A1WH 4UT7L 5A3IC 5K9KB 4DTGH 5KUMA 3QEGL 5BPPA 4IJTA 5DJCB 4M43H 1SOKA 2ZXGA 1JPSH 3UC0H 3BZDA 2HRGA 2ZCZA 4XNUL 3FT1A 3QO1B 1E7VA 3C6SB 3VXQA 3HC4L 4LOUC 2OCFD 5E2VH 3UERA 4DNLA 3PG2A 1S9YB 4RAHA 4P2CG 4NN5C 3IJHA 4ERSL 1JP5A 2NTSP 4QYOA 2F2HA 2R0WL 1BD2D 2ICEB 1HL4A 1XF5A 2P7TB 3P2TA 3C5JB 2GKIA 3KPQA 1J9RA 4HHAB 1BD2E 2ZX8A 4CN6A 3EGSB 1NC4D 1HHGB 1CGYA 5L7XL 3CDFA 4IOSA 5DI8B 1GGUA 3RZCB 2ADFL 2H26A 4APQB 3RVTD 4CVZB 4TRPL 2ADJB 3S3CB 4HDIA 1WBYB 3U4BH 5F88B 2W0PA 1SOXA 1MKFA 3NIFE 5HHMD 2QTVA 2X4TA 1AHWC 2BC4A 4N0UE 1YQVH 4YOKA 3KPTA 3QA3B 4XZ4A 3T3PE 3OV6A 2FO1A 2HX8A 2GJZA 1QI3A 2OI9C 1OAZH 5HDQH 2OYLA 5SX5K 2NY0B 3WOVA 1U3HC 3KPNB 1BJ8A 1IC7H 4X6CA 2CUHA 2NY3C 3BP7A 4Z3FA 5KVFL 4EI5A 3QJXA 4DH2A 4ZUSA 1Y1DA 2F54D 3BP6A 1TCRB 4RGNB 3LIZA 2XZCH 3ARGC 3QNYA 3F58H 2P8PA 1AXTL 4ODVL 2V9RA 3U1QA 2F54E 3RNKA 2AAAA 1V3MA 2ATPA 4UUJB 3QIBB 3DC0A 5AYTA 4HUUA 1WCQA 4JB9L 2FJHB 5DZVA 3DSFH 4G7YL 2IFFH 4P99A 3KGTA 3QIWD 4FP8H 1UM5L 2QSCL 2AQSA 2ZF9A 5TDPA 1BQUA 4N26A 4AJ0A 2GK0A 1UT2A 5AAPA 3ZUNC 4QT5A 4AZ8A 1TVBA 1RULH 2F53D 1NMCB 2B59B 4Y1AE 5SWZA 4HZLB 4G9FA 5B39B 2CRYA 2V8MA 2F53E 2DWDA 2GT9B 3F00A 3PWLB 4QRQB 1NCDH 2ZPKH 3LD8C 4DGVH 4AIEA 4X7SH 4JRFA 4AXWA 4G5ZL 3LQAH 4HXBL 1JZJA 3FT2A 4U1KB 4F58L 3MNMA 5JXEA 4CUCA 2Y1ZA 2ZCKH 3BEWA 3BSZL 1Z2KA 2X4PA 3IGAB 2JB5L 3PV6A 4M02A 4A67A 2EUWA 5LGKA 2WN2A 1B4TA 2EDKA 5IMMA 3K80A 1DEEB 3L6FB 1VPOL 2FR4A 4IOIB 4J3OF 5J56B 4C83B 2ZXWB 5ABDE 1JPTH 2F9BT 1RERA 2A6IB 3CDZB 2FATH 4AM0A 4O51A 3RY5A 1A4CA 4PJBB 3Q1EA 2BHZA 3WEBA 3WTXA 2IOMA 3EJZD 3FS9A 3P4MA 4YSAA 3FQWA 4ZD3L 4HUCA 5J1AA 5E4AA 2FSEB 1C8QA 1ZSDB 1KBKA 4DO4A 43CAB 3BAKA 4M62H 4ZSOB 2Y7LA 2JJSA 4UOJA 2VLRA 2K0RA 4ISVB 1MCFA 1F56A 1ET8A 1IM3A 2OV0A 2E56A 2C9RA 1N6QL 1JZ8A 1KXQE 4KY1H 1WO2A 4RBPH 4Y8DC 3SDDD 2AQTA 2X4RB 3O3DA 3R1GH 1W6LA 4XPAL 5FA4A 1HZHL 3WFZA 1UOLA 3KMDA 2AC0A 3TO4B 3UTTA 1SFDA 1YMMD 2X4SB 2AQ2A 1NCOA 3QDHA 4NZTH 2ZX7A 4GOSA 1YMME 1FL6A 1AGFB 3QUXC 4IRSD 4LHUD 3NDYE 5E6YA 3O2DH 2EO9A 1EZVX 3O0LA 4HVBA 1AACA 4HAFA 1KIQB 3OJVC 4JFQB 2ZOOA 2NNXA 3IWUA 4JRXA 1I4FB 1E3ZA 3QG6B 3TFBA 3ZL2A 3X3GH 3FU9A 3W81A 2XQYA 3NJIA 4MJ5B 3WY1A 4ZODA 3NCFB 4IRJC 4JDEB 3WI9A 4MXQD 4KMTL 4BUGA 4PR5B 3DV6A 3BQUD 2FCBA 3S36X 3IRCA 2A0LD 3OJMB 5MEOB 5ALBL 2GJJA 2UZPA 4ESKA 4LKXB 1ILSA 5HHVH 3A3YB 5KOMC 4PRHA 3BSHA 1NLBH 1JGEA 2BDNH 4NKIH 3TA4D 5DJ8A 4K5PA 2IOIA 3L3HA 3NFPA 3QEUB 3H9YA 4JE0A 4K2UL 1PZ2A 4XVJH 1QHPA 4KX8A 1FFRA 1XGPA 4JDVB 4L4VA 1F4XL 5BXFA 1KJ2A 2CH8A 5HY9B 1CU4H 4WW1A 4G1MB 4XE5B 3IGLA 3KAAA 1IL1B 5FUCE 1E27A 3H7BB 15C8H 4BQBA 4QXWA 3TEYA 2XPYA 5IVNA 1OP3K 4C57C 2H1PL 1ZVNA 3FUNA 1NCIA 1CFSA 5GIRB 2FNWA 2AK4A 2YEZA 4RA3A 1JMXA 3FQNA 4XOBA 5E08L 3FB7B 1L9NA 1RLWA 4WJ5A 4YAQA 2O5ZL 5FOBA 4Z3HA 3NSCA 2VABB 5KBDA 1GTFA 2AQPA 2WYZA 4NO0A 4TSAL 2CCWA 2IH8A 1C16B 1QI4A 4CU7A 2W07A 4IIQC 2AEIT 1FPTH 1XH1A 1OTTD 1H9VA 5GGQL 3W9EA 1SEQL 5I1KH 5E8PB 3TA3A 3WKPA 1M7DB 4FJ6A 2EIJB 4Y19B 2MSPA 4WFGD 2OK0H 2VSMB 3ZKMD 1FIGH 1OM9A 1SHSA 1TENA 1T21A 5E1IA 2QVKA 2XFXA 1T0PB 5C0EB 5KJRH 2NQCA 4WFGE 1DQLL 4PJEF 5T33H 3UFIA 3HRPA 3ZKND 4PJ7A 1S7VB 2DMCA 2MRYA 2Q5BA 3JTSA 3JT2A 1CICB 1EPFA 3LKRB 3ARVA 1ZHLB 2ZXQA 4DGIL 2DQEH 4S2SB 2IAMD 4NRYB 1OSPL 5I82A 1PZSA 2AKRA 4N0FA 1QA9B 1ZT4B 2ZYSA 5CLXA 2ZCHH 3O2WL 1TU2B 3DOSA 5B8CC 4POZC 4ZMVA 1IV8A 4P5RA 5DCCA 3CSYB 1BFTA 1K85A 4AGPA 2RD0A 4LVHB 3CC5B 2KL6A 3AWGA 5I1AA 4NPYA 2D7NA 5IROC 4JPKL 1BAGA 1LP9E 1ML0A 2J57A 4MSWB 1WFJA 4J4PD 1MFVA 1Z9NA 5CSGA 2C3HA 3DRQA 4P0DA 3UJTL 4QHKI 4UNTA 2D3NA 2EIDA 2Y72A 3BJ91 1PG7W 3SQRA 1USQA 1BDYA 1R0AL 2CKBL 3T0EE 5JW5A 3JUZA 4BDVA 1GW0A 3MRPA 4QWWD 2VN4A 2BRQA 3GSQA 4X6BA 5ABZA 4S1DD 1N3NA 5EDSA 4J5VA 3IMWA 4HH9B 4AC4A 2APFA 1QO3A 3FTGB 4I3GA 3EFFA 4JCWA 4W81A 4Y2DA 4PRPB 1WC7A 2Y7OA 4UQ3B 4WI3A 1A6PA 3BYTA 4KPHH 2D0GA 4K8RC 4OCWL 2G2NA 3RFZB 3TO2B 1TJHL 2QPFA 3L9BA 1QRNE 2X28A 3QIUD 3MRNA 1B4RA 1I1FA 4XMLL 1F4AA 4JEGB 4JY4A 4WK2B 2Y7SA 3CFDB 1T5XB 3ULVC 5JQHC 1R6VA 1LEKA 4PJGA