2LLYA

Nmr structures of the transmembrane domains of the nachr a4 subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
134
Chain Sequence
b'EELPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSSVSPSIGEYLLFTMIFVTLSIVITVFVLNVHHRSPETHTGGGGGIDRIFLWMFIIVCLLGTVGLFLPPWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit alpha-4
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 36
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2llyA01
3JAFA 1OEDE 3UQ4A 3LSVA 2YKSA 4ZZBA 3UQ7A 3JADA 3RQWA 2M6IA 4ILCA 2VL0A 2BG9E 3EI0A 2LM2A 2KSRA 3TLSA 1OEDB 2XQ7A 5HCJA 4HFDA 4ILAA 5LG3A 1OEDC 4NPPA 4HFCA 3UU5A 3P4WA 4TWFA 2XQ9A 4QH4A 3TLUA 4IREA 4HFEA 2BG9B 5HEUA 4HFBA 4X5TA 5HEOA 3TLWA 2BG9C 4TNWA 5CFBA 3RQUA 4F8HA 4TWHA 3UU8A 2XQAA 2XQ4A 2YOEA 4A98A 5HEJA 2MAWA 4QH1A 2XQ8A 2XQ6A 3TLTA 4Z91A 2XQ5A 4IL4A 3EHZA 1OEDA 5IUXA 3ZKRA 4QH5A 3TLVA 2YN6A 4TNVA 4LMKA 5L47A 4Z90A 2M6BA 3UUBA 3JAEA 4ILBA 5HEGA 4TWDA 4COFA 2BG9A 4HFIA 5L4EA 3RIAA 2LKGA 4LMJA 3RHWA 2XQ3A 3EAMA 5L4HA 5J0ZA 3P50A 4HFHA 3UU3A 3UU4A 3UU6A 4A97A 2LKHA 3RIFA 2LLYA 3RI5A 5HEHA 5HCMA 4ZZCA 4IL9A 4LMLA
chains in the Genus database with same CATH superfamily
3KV6A 4DUZT 5L3BB 3O4XE 4HE8A 1O3XA 4DR4T 5FXXA 3CX6B 1KEYA 3CQCB 3PUZF 3FXDB 3TLSA 5LGNB 4M1PA 4DV2T 2UXNB 3AEGA 2X0LB 3VHLA 3UT5E 1I94T 5FXZA 4UF0A 1KF6A 2WWUA 4ERRA 2VKJA 5EZYE 4QH1A 4IIJE 3UUNA 4QWNB 2K24A 2V7KA 4HWDA 2GK9A 2ODVA 2BKNA 3E08A 5JRCB 1MMGA 2VQFT 1M62A 3AE1A 3MACA 3D0TA 3CQGB 4ISSA 1CUNA 4A56A 2UXCT 3PV0F 5H6QB 4HFHA 5DABA 3UU3A 1S94A 3HA4A 2UUCT 3RIFA 3QK6A 3E0ZA 2Q9QA 4XAXB 4NUUA 3AEFA 1SA0E 2E5LT 1ZHCA 4QX8B 3Q5DA 4H63V 3AE6A 4ZOLE 4IDZA 3CIRA 5BMVE 4CQIA 1QLBA 3SOLA 1XDPA 4HFDA 3RGLA 2V7IA 3ONXA 3N9NA 2D0TA 2IW5B 1HG5A 1SHZC 5HXEA 2N1GA 3RF1A 4BAYB 2B1EA 5F5WA 5LOVE 4CN1A 4TWHA 5DQVA 2V7LA 1UURA 3C50A 4PFOA 4EIWA 1HS7A 2ZLYA 4DO0A 5IUXA 2WMNA 1T98A 4UVAB 3T1HT 3KDSE 4JLEA 3RYHE 3SFEA 4YY3T 3SS1A 2DL1A 2QVAA 4EZ4A 3RHWA 3T1YT 3ONLC 4OYKA 5JDGA 3PUAA 2YK0A 4DV1T 2XAJB 4HTEA 2JIWA 5AQFB 1D1BA 4PK4A 4KBMB 3KVAA 4O4HE 3WAKA 2LT3A 3JADA 2BBJA 2LJLA 4IE5A 3ABVA 1NAFA 4O8SA 4B3RT 1MMNA 2PFVA 4IE6A 4AQYT 4QH4A 4X1YE 2D9DA 2K9AA 4HFBA 5LCYA 2AXDS 4WYVA 4U2ZA 1XNQT 3JC6D 2WU2A 5CFBA 3EVYA 2WMOA 1AJ3A 2YOEA 4NXMT 5FVLA 3UFEA 4PJNA 2XQ6A 5EK3A 4AKIA 1KNPA 5LHHB 2V6XA 3ZC1A 1NENA 2CXFA 4ASKA 3DJBA 4H63H 1N32T 3NWIA 2HN2A 2J62A 4LMKA 4B3ST 1GQEA 1U5PA 5HEGA 1T72A 4L5GA 1UUSA 3RC8A 1J1JA 4GK5E 1U4QA 3ZMVB 2V7MA 4ILUA 2LSKA 2L3LA 5DJQC 4YTPA 1OXZA 2XAFB 1HG2A 3C4WA 4KX6A 3QNUA 1ZV4X 2H7VC 2K3WA 3J7Yq 4H9RC 5HEHA 4E7SA 4OHFA 3EABA 5IHYA 3JC6C 3Q9DA 4LF9T 2AE9A 2NTXA 2KWHA 2ZM6T 3C51A 1J5ET 3LK42 2FJDA 2XSAA 1W0AA 2J1DG 1XNRT 2BS4A 4O4IE 1OEDB 4AISA 1YD8G 4G2AA 2CWOA 2MOZA 3P4WA 1VOMA 4PK5A 3VR8A 3V5UA 4OYJA 2PBIA 2BG9B 1VCTA 3O1HA 2V1DB 1WR0A 4EGWA 4F8HA 2WBLA 3IEEA 2XQAA 4HN9A 3QB5K 4L0RA 5C3JA 2XQ4A 2KINB 4DR7T 1MMAA 4QX7B 3RRCA 4GYSA 5ABFB 3HR0A 4DMWA 2XQ5A 2LOSA 3KFWX 3RYFE 4DIDB 3AA6B 3OTOT 2Y48B 3AA0B 4MALA 3QUJA 3P8CD 3GN5A 1YKHB 5AQIB 4UEMA 1DU2A 5BR8T 2XUEA 5L4EA 2QA7A 3L8RA 4DUYT 3FZHB 1FIOA 1WR6A 2FJEA 3CWZB 3P7IA 1IBKT 4I4TE 5JDLA 4Q25A 4QHOA 4G63A 3NRYA 5HXRA 3LK2B 2C0SA 1XWMA 5J2UE 2IC6A 3AAEB 5HXSA 3MXZA 2V6YB 3UQ4A 3CX7B 3UQ7A 5C8YE 3SRZA 4X66T 4KI0F 5ABEA 2QRXA 4ILCA 3KV4A 4AXPA 2WU5A 1Y01A 2FBWA 5LG3A 5LGTB 4Z8XA 3KVBA 3ZMTB 4LF7T 3KV9A 4X5TA 4JV5T 3P4RA 4K0KT 3C4ZA 4DNDA 3UFGA 2J47A 3ZSSA 2V8SV 3LDQB 2CWYA 4Z91A 4H9PC 3KBUA 5JTGA 4IL4A 4YT0A 5JH7E 1IJ5A 2XAQB 3L3PA 2CPTA 2WDVA 2IC9A 2BS3A 4TNVA 5AQOB 2W63A 2MBGA 3LK3B 4O4JE 1XDOA 2V5DA 3ESLA 4JI7T 4EEBA 4X20E 4ZXLA 2LHNA 1WYCA 2XPKA 2VL8A 4UV8B 3F57A 1MNDA 2HHHT 3OYXA 4C90A 4UVCB 4DBRA 4ANJA 1W09A 3N5LA 5FY0A 3S4UA 4JYAT 4YHHT 2G0UA 3KINB 1IBMT 2YINA 3RIUC 4LFCT 3GA8A 4WBNE 2WDRA 2JMKA 1W0BA 4TV9E 2W00A 3N9OA 2WP9A 4ZI2D 2Y8DA 2FJAA 3DTOA 2W67A 2LRLA 2WZIA 5LHIB 4JI4T 3NKZA 3ZMSB 1T8BA 4BJNA 4AQGA 4JI1T 5L3CB 4DR5T 4IE7A 2LE8A 4I43B 3PDYA 3ZN0B 3CVRA 1HNZT 1XMQT 2CBIA 5JDFA 5AQPB 2BKOA 2XSBA 2I59A 3ZKRA 4WZXA 3IA3A 4UV9B 4UXNB 4P0AA 1LVKA 2ZM8A 1WYBA 2LKGA 5AQNB 4LMJA 5FNVE 2YU1A 3ZSTA 3K3NA 1KNRA 5F3JA 4U33A 2VQET 4ZI2C 4PJJA 3AE4A 2E9XB 2BZBA 3ZT5A 4CN4A 3UUMA 3K8PC 2WWVA 4JI6T 2X67A 3I0QA 5HWXA 3AA1B 4ZEYA 1YQ3A 3LG7A 4ZZBA 1N33T 5JR9B 3ZCIA 4YSZA 1Y64B 2PTFA 3ZCJA 3E22E 4H9QC 4GKJT 3HKDE 2N2NA 4DR3T 2V26A 2V6YA 1WLXA 3ZT7A 1HNXT 4LF6T 3W15B 3M3ZB 4NPPA 3UU5A 2LSIA 1LKXA 4EZHA 3LFMA 2HPJA 5KMGP 1ZOYA 1XMOT 4CXXA 1I6ZA 5CJ5A 2XAHB 2B76A 2P9BA 3P4SA 3RIUA 4TZ4C 3TLTA 1N36T 2Z6EA 4CI3B 4O4LE 2DWKA 5AQRB 3UTKA 2WQYA 4ZHQE 3UUXB 3SWHA 1W9RA 5E0OA 2QYWA 3ZC0A 4MFRA 1ZKEA 2XM2A 5J0ZA 3M65A 3VKHA 4HGAA 4ZI3D 1FMVA 4LF5T 2JQ9A 2VKHA 3ETVA 3R84B 5LXTE 2UUAT 4JI2T 4LMLA 3FBZA 4ZS3A 3OJAA 4U31A 2UU9T 2LSJA 3O9XA 4DR2T 3AE8A 2WAUA 2X0YA 2XJ7A 3FZFB 2A9UA 5FMNA 3BQKA 4IREA 5LYJE 3CX8B 3TLWA 3VRBA 4LF4T 3I0OA 3PUVF 4UELA 4JI5T 3T8OA 5LMUT 4B3MT 1M7KA 5CA1E 2WSSV 1D0XA 4EYUA 1FEWA 3NZQA 1UX4A 1J5WA 4AI6A 5ETWA 2VVNA 2X9HA 4LFAT 4ZI3C 2WZHA 3L39A 3RH3A 4QH5A 5HYAA 4TN7B 3AE5A 4WNKA 2H88A 5L47A 5LBQB 2X0HA 1VCSA 3UUBA 3JAEA 1NWMX 4COFA 3BQLA 4X1KE 3ZPOA 5KX5E 1WFDA 3FB2A 5FYMA 3Q5EA 3NRXA 4QXHB 1UCUA 2IUBA 5FY7A 2ACZA 4O2BE 1G8XA 3ZYKA 4IT4A 3UU6A 4MLKA 2LLYA 1HNWT 2RPAA 1KNZA 1YW0A 5JRCA 3LJCA 4WBOA 5AQKB 2NW9A 3AAAB 3LSVA 2EHOB 1E2AA 4YTNA 3U78A 4KUMB 1WCRA 5FL0A 2JJ9A 3HKEE 4UVBB 2W2UA 3J9X1 4LFBT 2BDEA 1D1CA 3ONJA 3FZLB 4CI1B 1YKEB 4HFVA 2KZ7B 5AFUL 2D2SA 2DNXA 2CXDA 4X62T 2X68A 1G73A 3IF8B 1ZP0A 2OA5A 4I55E 3RRWA 4HWCA 2WCAA 4CI2B 3AXJB 1T7SA 2V7JA 4MBQA 4EYYR 2D0UA 3QC9A 2M6BA 4YJ2E 3RPUA 3AVRA 3AVSA 2X66A 4YSYA 2XM1A 4HFIA 3EDVA 4PAGA 3RIAA 3TKLB 2VASA 1BR1A 2OLTA 1IAPA 4EOZB 2LSGA 1HR0T 4X65T 2CA5A 1L0VA 4DV4T 2LKHA 4KP3C 1D1AA 4UF0B 3PUXF 5HAXA 3QOFA 1D0YA 4PJMA 2KMFA 3PE0A 4AKGA 3FXEB 3HKCE 2VK9A 2BKPA 2M6IA 1EZ3A 4AKLA 1LRZA 4DV6T 3Q5WA 5HCJA 2JQHA 4TUYE 1OEDC 3R6NA 4HFCA 1D0ZA 3TLUA 1E7PA 4HFEA 2NW8A 3HKBE 5FP3A 3H3AA 5HEOA 3RKOA 2BG9C 4B6XA 3RQUA 1X9BA 1HX8A 4JEHB 3FZKB 2VB6A 3QB5A 4K0UA 1BR2A 3ZYLA 3ZJ1A 1Z8UA 4IHJE 3AE9A 4DV7T 3N2KE 3MZKB 4YXDA 2X9XA 2HN1A 2YN6A 2LOPA 2IMLA 4U7IA 2JMHA 3FBLA 3OVUA 3B13A 2UUBT 3FHNA 4BJMA 2XQ3A 2N9DA 3WI3A 3Q5XA 3EAMA 3PUSA 1BR0A 1HCIA 4HWFA 3Q2MA 4JI0T 5LBMA 4ZZCA 4ADZA 2VKOA 3AECA 3G06A 3B57A 2X9YA 5AQQB 1SUMB 5LJMA 5FY1A 5A1LA 4I50E 3ANWB 3PU8A 3EDUA 4MHCA 4ILAA 3I9YA 3RLFF 4GIWA 4DV0T 4CXYA 2D5UA 2XTLA 3AE7A 4PW8A 3MA9A 3PUWF 4YSXA 3UU8A 3I1AA 2NW7A 2DWGA 4QKNA 2WS3A 1VRBA 2XQ8A 4H9NC 4OX9T 3H37A 3BQIA 2YDSA 1OEDA 1N34T 3ZMZB 5AQLB 1HX1B 4EEDA 1SE7A 4IGUA 5HXCA 2ODUA 4JEUB 1S35A 3AXJA 1MIVA 2QGSA 2BG9A 4BA9A 4QXCB 2BVMA 2CM0A 4KMCA 4NXNT 4V1Av 3P4PA 4P1NA 5CA0E 5LMNT 1YQ4A 3F31A 1R8IA 1ZEEA 3AE2A 4KHZF 3P50A 1UK5A 5ABFA 4A97A 2A3DA 2JPFA 1KK7A 3O1IA 2IAKA 5HCMA 2H7OA 1US7B 2LHRA 4HKAA 1MIYA 2JQQA 3OYZA 1CHUA 4U74A 2YKSA 3VR9A 4YJ3E 5CGMA 4IDNA 1HFAA 3AEEA 3KBTA 4N78D 3AB3B 4O2AE 4JUYA 2DHRA 3N2GE 1MMDA 1JNZA 3PJAJ 2KWIB 2E9XD 3NZPA 4P09A 5HEUA 3VRAA 4X64T 4WW0A 2SPCA 1IZNB 4TNWA 2YDQA 2VWAA 2I0MA 2PG8A 4DBQA 1FMWA 5J2TE 3RYIE 4XBFB 2NWBA 4H9OC 3JCFA 3EHZA 2LEHA 3BK9A 5JREA 2W0GA 3K3OA 2ZM2A 4NUVA 4KHPT 3N2OA 5FVKA 2CBJA 2OV9A 3N9PA 3H3MA 2MTQA 3I9WA 3L09A 5LNKA 2RP4A 4FJOA 4DMVA 5GONE 5L4HA 2L9QA 2ACXA 3N9LA 4PFPA 3MKDA 5F8PA 5JQGE 2ZM0A 3PUYF 4HEAA 5AQHB 2E9XC 5FKYA 4IL9A 4CZZB 2X51A 1YXRA 2W61A 3NBXX 4YTMA 4JBWF 5FL1A 5JR9C 4QXBB 3CKDA 1HTJF 1QUUA 2LM2A 5LG4A 3PU3A 1Z0PA 3GN5B 4DV3T 1V9DA 4P0BA 3ZN1B 3ANWA 2H89A 1FJGT 5TAOA 1KFYA 1JNRA 2NP9A 2YU2A 5J1GA 4EAHA 2XHEB 5L3FB 3U3IA 2NR4A 3OBVE 2HPLA 3LBXB 2E2AA 4GYRA 2UXXB 2C5JA 3F2EA 3VU7H 3C64A 2VVSA 2V5CA 5FXWA 1NEKA 2WM9A 5EK4A 4HWIB 2WDQA 1QSDA 4AKHA 3MJXA 3UU4A 4UIGA 3AE3A 2W4XA 3FZMB 4YFSA 3CPZA 5AQVB 3RX6A 2ZMAA 3OPCA 5KDMC 1IJ6A 3ZYMA 2HH7A 5FXVA 3RQWA 4TX5A 4EXTA 4X1IE 1OWAA 2VL0A 5ABGA 3RYCE 2E8IA 2IHR1 5ADXL 3ETUA 4C91A 3ZLIA 3CQXC 5AQTB 5KXJA 5ABHA 2WY2A 2BS2A 3IBPA 3K1SA 2E9XA 5LGUB 4B3TT 2XAGB 2A2FX 3V5SA 2KLQA 2W62A 1E1HB 3AEBA 2R6GF 4CXWA 4LF8T 2EHOD 3IHRA 4YLHA 4PK6A 5JR9A 2UXDT 2DLRA 2CE7A 3B5MA 5JDQA 3OKQA 3KV5A 4DR1T 5CB4E 4TV8E 2LM9A 3TLVA 4OFZA 2RA1A 5JDNA 5HWYA 2VURA 3PUGA 3AEAA 1BR4A 4L9IA 2XY8B 5L2LA 2CMRA 2DI4A 4AQFC 3X1DA 5L3DB 4PJLA 4IE4A 4ZS2A 3K3QC 4H9SE 2KT9A 3RI5A 2BVLA 4GKKT 4IE0A 2LRKA 3PUQA 4DR6T 2XASB 4F6RC 2EHOC 5LHGB 2C5IT 3EI0A 2KSRA 2J4GA 5L3GB 2XQ7A 1IBLT 2JRKA 2WB5A 2M67A 2DCFA 2XQ9A 3CMLA 3SFDA 2MPKA 5EK2A 5C2TA 3VKGA 2YEVC 5IWAT 2C5KT 4U2YA 2XQYA 3AAIA 3PTRB 3C4XA 5HEJA 3WAJA 4YHJA 2PJQA 4JI8T 1HF8A 2VKDA 5M4YA 2CHNA 3NVOA 2A72A 5AQMB 3O1JA 4HWHA 4XZCA 4CN6A 5JVDE 4ILBA 3GWHA 4TWDA 4GK0E 1X79A 4FI5A 3LBXA 1XZYA 5LP6E 3A5XA 4EV6A 4GOUA 5AQSB 4IDOA 2Q9QB 3ZJ2A 4DV5T 2CLYB 4A5XA 2L8KA 4AKRB 5LA6E 2NTYA 2Q9QD 3PJAA 5HXHA 3JAFA 3HI2A 1OEDE 2UXBT 4UR9A 2Y6XA 2FUPA 3EUHA 2CCQA 4OK0A 1H7CA 3ZMUB 5LJNA 2F4VT 5AQUB 5DQWA 1UX5A 2BG9E 3RC3A 5AQJB 2ES0A 4IDPA 2CEAA 4AQFA 4TWFA 3PURA 4PNIA 4U7YA 1UGOA 4E7ZA 3RKGA 5LB7B 4ISTA 5JDMA 2XZEA 2K48A 5L3EB 3DP7A 5H6RB 3N9QA 2H3RA 4I0UA 3ZEFB 1WRDA 2EHOA 2KXPB 5JDHA 4A98A 2W66A 1MIWA 2JQKA 1MNEA 3CK6A 2MAWA 2KNDA 4IDQA 4DVDA 4ZI7E 2FJBA 3HL6A 2YDRA 2CRBA 2K5BB 4NIQA 2Q9QC 2CLYC 4AIUA 4Z90A 1B7TA 3AA7B 5AQGB 2NOXA 1LVFA 2X9WA 3ZT6A 3A8YC 3GMIA 2I6HA 4EB6E 3MK7C 3N9MA 2CHOA 4U72A 2CXLA 2IDOB 4J2CA 3UULA 4JI3T 3C98B 4U3CA 2E5VA 2BBHA 2IIUA 3AEDA 3P4QA 5IYZE 2LSYA 2MYSA 3A7MA
chains in the Genus database with same CATH topology
3JAFA 1OEDE 3UQ4A 3LSVA 2YKSA 4ZZBA 3UQ7A 3JADA 3RQWA 2M6IA 4ILCA 2VL0A 2BG9E 3EI0A 2LM2A 2KSRA 3TLSA 1OEDB 2XQ7A 5HCJA 4HFDA 4ILAA 5LG3A 1OEDC 4NPPA 4HFCA 3UU5A 3P4WA 4TWFA 2XQ9A 4QH4A 3TLUA 4IREA 4HFEA 2BG9B 5HEUA 4HFBA 4X5TA 5HEOA 3TLWA 2BG9C 4TNWA 5CFBA 3RQUA 4F8HA 4TWHA 3UU8A 2XQAA 2XQ4A 2YOEA 4A98A 5HEJA 2MAWA 4QH1A 2XQ8A 2XQ6A 3TLTA 4Z91A 2XQ5A 4IL4A 3EHZA 1OEDA 5IUXA 3ZKRA 4QH5A 3TLVA 2YN6A 4TNVA 4LMKA 5L47A 4Z90A 2M6BA 3UUBA 3JAEA 4ILBA 5HEGA 4TWDA 4COFA 2BG9A 4HFIA 5L4EA 3RIAA 2LKGA 4LMJA 3RHWA 2XQ3A 3EAMA 5L4HA 5J0ZA 3P50A 4HFHA 3UU3A 3UU4A 3UU6A 4A97A 2LKHA 3RIFA 2LLYA 3RI5A 5HEHA 5HCMA 4ZZCA 4IL9A 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAF A;  1OED E;  3UQ4 A;  3LSV A;  2YKS A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQW A;  2M6I A;  4ILC A;  2VL0 A;  2BG9 E;  3EI0 A;  2LM2 A;  2KSR A;  3TLS A;  1OED B;  2XQ7 A;  5HCJ A;  4HFD A;  4ILA A;  5LG3 A;  1OED C;  4NPP A;  4HFC A;  3UU5 A;  3P4W A;  4TWF A;  2XQ9 A;  4QH4 A;  3TLU A;  4IRE A;  4HFE A;  2BG9 B;  5HEU A;  4HFB A;  4X5T A;  5HEO A;  3TLW A;  2BG9 C;  4TNW A;  5CFB A;  3RQU A;  4F8H A;  4TWH A;  3UU8 A;  2XQA A;  2XQ4 A;  2YOE A;  4A98 A;  5HEJ A;  2MAW A;  4QH1 A;  2XQ8 A;  2XQ6 A;  3TLT A;  4Z91 A;  2XQ5 A;  4IL4 A;  3EHZ A;  1OED A;  5IUX A;  3ZKR A;  4QH5 A;  3TLV A;  2YN6 A;  4TNV A;  4LMK A;  5L47 A;  4Z90 A;  2M6B A;  3UUB A;  3JAE A;  4ILB A;  5HEG A;  4TWD A;  4COF A;  2BG9 A;  4HFI A;  5L4E A;  3RIA A;  2LKG A;  4LMJ A;  3RHW A;  2XQ3 A;  3EAM A;  5L4H A;  5J0Z A;  3P50 A;  4HFH A;  3UU3 A;  3UU4 A;  3UU6 A;  4A97 A;  2LKH A;  3RIF A;  2LLY A;  3RI5 A;  5HEH A;  5HCM A;  4ZZC A;  4IL9 A;  4LML A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  4DUZ T;  5L3B B;  3O4X E;  4HE8 A;  1O3X A;  4DR4 T;  5FXX A;  3CX6 B;  1KEY A;  3CQC B;  3PUZ F;  3FXD B;  3TLS A;  5LGN B;  4M1P A;  4DV2 T;  2UXN B;  3AEG A;  2X0L B;  3VHL A;  3UT5 E;  1I94 T;  5FXZ A;  4UF0 A;  1KF6 A;  2WWU A;  4ERR A;  2VKJ A;  5EZY E;  4QH1 A;  4IIJ E;  3UUN A;  4QWN B;  2K24 A;  2V7K A;  4HWD A;  2GK9 A;  2ODV A;  2BKN A;  3E08 A;  5JRC B;  1MMG A;  2VQF T;  1M62 A;  3AE1 A;  3MAC A;  3D0T A;  3CQG B;  4ISS A;  1CUN A;  4A56 A;  2UXC T;  3PV0 F;  5H6Q B;  4HFH A;  5DAB A;  3UU3 A;  1S94 A;  3HA4 A;  2UUC T;  3RIF A;  3QK6 A;  3E0Z A;  2Q9Q A;  4XAX B;  4NUU A;  3AEF A;  1SA0 E;  2E5L T;  1ZHC A;  4QX8 B;  3Q5D A;  4H63 V;  3AE6 A;  4ZOL E;  4IDZ A;  3CIR A;  5BMV E;  4CQI A;  1QLB A;  3SOL A;  1XDP A;  4HFD A;  3RGL A;  2V7I A;  3ONX A;  3N9N A;  2D0T A;  2IW5 B;  1HG5 A;  1SHZ C;  5HXE A;  2N1G A;  3RF1 A;  4BAY B;  2B1E A;  5F5W A;  5LOV E;  4CN1 A;  4TWH A;  5DQV A;  2V7L A;  1UUR A;  3C50 A;  4PFO A;  4EIW A;  1HS7 A;  2ZLY A;  4DO0 A;  5IUX A;  2WMN A;  1T98 A;  4UVA B;  3T1H T;  3KDS E;  4JLE A;  3RYH E;  3SFE A;  4YY3 T;  3SS1 A;  2DL1 A;  2QVA A;  4EZ4 A;  3RHW A;  3T1Y T;  3ONL C;  4OYK A;  5JDG A;  3PUA A;  2YK0 A;  4DV1 T;  2XAJ B;  4HTE A;  2JIW A;  5AQF B;  1D1B A;  4PK4 A;  4KBM B;  3KVA A;  4O4H E;  3WAK A;  2LT3 A;  3JAD A;  2BBJ A;  2LJL A;  4IE5 A;  3ABV A;  1NAF A;  4O8S A;  4B3R T;  1MMN A;  2PFV A;  4IE6 A;  4AQY T;  4QH4 A;  4X1Y E;  2D9D A;  2K9A A;  4HFB A;  5LCY A;  2AXD S;  4WYV A;  4U2Z A;  1XNQ T;  3JC6 D;  2WU2 A;  5CFB A;  3EVY A;  2WMO A;  1AJ3 A;  2YOE A;  4NXM T;  5FVL A;  3UFE A;  4PJN A;  2XQ6 A;  5EK3 A;  4AKI A;  1KNP A;  5LHH B;  2V6X A;  3ZC1 A;  1NEN A;  2CXF A;  4ASK A;  3DJB A;  4H63 H;  1N32 T;  3NWI A;  2HN2 A;  2J62 A;  4LMK A;  4B3S T;  1GQE A;  1U5P A;  5HEG A;  1T72 A;  4L5G A;  1UUS A;  3RC8 A;  1J1J A;  4GK5 E;  1U4Q A;  3ZMV B;  2V7M A;  4ILU A;  2LSK A;  2L3L A;  5DJQ C;  4YTP A;  1OXZ A;  2XAF B;  1HG2 A;  3C4W A;  4KX6 A;  3QNU A;  1ZV4 X;  2H7V C;  2K3W A;  3J7Y q;  4H9R C;  5HEH A;  4E7S A;  4OHF A;  3EAB A;  5IHY A;  3JC6 C;  3Q9D A;  4LF9 T;  2AE9 A;  2NTX A;  2KWH A;  2ZM6 T;  3C51 A;  1J5E T;  3LK4 2;  2FJD A;  2XSA A;  1W0A A;  2J1D G;  1XNR T;  2BS4 A;  4O4I E;  1OED B;  4AIS A;  1YD8 G;  4G2A A;  2CWO A;  2MOZ A;  3P4W A;  1VOM A;  4PK5 A;  3VR8 A;  3V5U A;  4OYJ A;  2PBI A;  2BG9 B;  1VCT A;  3O1H A;  2V1D B;  1WR0 A;  4EGW A;  4F8H A;  2WBL A;  3IEE A;  2XQA A;  4HN9 A;  3QB5 K;  4L0R A;  5C3J A;  2XQ4 A;  2KIN B;  4DR7 T;  1MMA A;  4QX7 B;  3RRC A;  4GYS A;  5ABF B;  3HR0 A;  4DMW A;  2XQ5 A;  2LOS A;  3KFW X;  3RYF E;  4DID B;  3AA6 B;  3OTO T;  2Y48 B;  3AA0 B;  4MAL A;  3QUJ A;  3P8C D;  3GN5 A;  1YKH B;  5AQI B;  4UEM A;  1DU2 A;  5BR8 T;  2XUE A;  5L4E A;  2QA7 A;  3L8R A;  4DUY T;  3FZH B;  1FIO A;  1WR6 A;  2FJE A;  3CWZ B;  3P7I A;  1IBK T;  4I4T E;  5JDL A;  4Q25 A;  4QHO A;  4G63 A;  3NRY A;  5HXR A;  3LK2 B;  2C0S A;  1XWM A;  5J2U E;  2IC6 A;  3AAE B;  5HXS A;  3MXZ A;  2V6Y B;  3UQ4 A;  3CX7 B;  3UQ7 A;  5C8Y E;  3SRZ A;  4X66 T;  4KI0 F;  5ABE A;  2QRX A;  4ILC A;  3KV4 A;  4AXP A;  2WU5 A;  1Y01 A;  2FBW A;  5LG3 A;  5LGT B;  4Z8X A;  3KVB A;  3ZMT B;  4LF7 T;  3KV9 A;  4X5T A;  4JV5 T;  3P4R A;  4K0K T;  3C4Z A;  4DND A;  3UFG A;  2J47 A;  3ZSS A;  2V8S V;  3LDQ B;  2CWY A;  4Z91 A;  4H9P C;  3KBU A;  5JTG A;  4IL4 A;  4YT0 A;  5JH7 E;  1IJ5 A;  2XAQ B;  3L3P A;  2CPT A;  2WDV A;  2IC9 A;  2BS3 A;  4TNV A;  5AQO B;  2W63 A;  2MBG A;  3LK3 B;  4O4J E;  1XDO A;  2V5D A;  3ESL A;  4JI7 T;  4EEB A;  4X20 E;  4ZXL A;  2LHN A;  1WYC A;  2XPK A;  2VL8 A;  4UV8 B;  3F57 A;  1MND A;  2HHH T;  3OYX A;  4C90 A;  4UVC B;  4DBR A;  4ANJ A;  1W09 A;  3N5L A;  5FY0 A;  3S4U A;  4JYA T;  4YHH T;  2G0U A;  3KIN B;  1IBM T;  2YIN A;  3RIU C;  4LFC T;  3GA8 A;  4WBN E;  2WDR A;  2JMK A;  1W0B A;  4TV9 E;  2W00 A;  3N9O A;  2WP9 A;  4ZI2 D;  2Y8D A;  2FJA A;  3DTO A;  2W67 A;  2LRL A;  2WZI A;  5LHI B;  4JI4 T;  3NKZ A;  3ZMS B;  1T8B A;  4BJN A;  4AQG A;  4JI1 T;  5L3C B;  4DR5 T;  4IE7 A;  2LE8 A;  4I43 B;  3PDY A;  3ZN0 B;  3CVR A;  1HNZ T;  1XMQ T;  2CBI A;  5JDF A;  5AQP B;  2BKO A;  2XSB A;  2I59 A;  3ZKR A;  4WZX A;  3IA3 A;  4UV9 B;  4UXN B;  4P0A A;  1LVK A;  2ZM8 A;  1WYB A;  2LKG A;  5AQN B;  4LMJ A;  5FNV E;  2YU1 A;  3ZST A;  3K3N A;  1KNR A;  5F3J A;  4U33 A;  2VQE T;  4ZI2 C;  4PJJ A;  3AE4 A;  2E9X B;  2BZB A;  3ZT5 A;  4CN4 A;  3UUM A;  3K8P C;  2WWV A;  4JI6 T;  2X67 A;  3I0Q A;  5HWX A;  3AA1 B;  4ZEY A;  1YQ3 A;  3LG7 A;  4ZZB A;  1N33 T;  5JR9 B;  3ZCI A;  4YSZ A;  1Y64 B;  2PTF A;  3ZCJ A;  3E22 E;  4H9Q C;  4GKJ T;  3HKD E;  2N2N A;  4DR3 T;  2V26 A;  2V6Y A;  1WLX A;  3ZT7 A;  1HNX T;  4LF6 T;  3W15 B;  3M3Z B;  4NPP A;  3UU5 A;  2LSI A;  1LKX A;  4EZH A;  3LFM A;  2HPJ A;  5KMG P;  1ZOY A;  1XMO T;  4CXX A;  1I6Z A;  5CJ5 A;  2XAH B;  2B76 A;  2P9B A;  3P4S A;  3RIU A;  4TZ4 C;  3TLT A;  1N36 T;  2Z6E A;  4CI3 B;  4O4L E;  2DWK A;  5AQR B;  3UTK A;  2WQY A;  4ZHQ E;  3UUX B;  3SWH A;  1W9R A;  5E0O A;  2QYW A;  3ZC0 A;  4MFR A;  1ZKE A;  2XM2 A;  5J0Z A;  3M65 A;  3VKH A;  4HGA A;  4ZI3 D;  1FMV A;  4LF5 T;  2JQ9 A;  2VKH A;  3ETV A;  3R84 B;  5LXT E;  2UUA T;  4JI2 T;  4LML A;  3FBZ A;  4ZS3 A;  3OJA A;  4U31 A;  2UU9 T;  2LSJ A;  3O9X A;  4DR2 T;  3AE8 A;  2WAU A;  2X0Y A;  2XJ7 A;  3FZF B;  2A9U A;  5FMN A;  3BQK A;  4IRE A;  5LYJ E;  3CX8 B;  3TLW A;  3VRB A;  4LF4 T;  3I0O A;  3PUV F;  4UEL A;  4JI5 T;  3T8O A;  5LMU T;  4B3M T;  1M7K A;  5CA1 E;  2WSS V;  1D0X A;  4EYU A;  1FEW A;  3NZQ A;  1UX4 A;  1J5W A;  4AI6 A;  5ETW A;  2VVN A;  2X9H A;  4LFA T;  4ZI3 C;  2WZH A;  3L39 A;  3RH3 A;  4QH5 A;  5HYA A;  4TN7 B;  3AE5 A;  4WNK A;  2H88 A;  5L47 A;  5LBQ B;  2X0H A;  1VCS A;  3UUB A;  3JAE A;  1NWM X;  4COF A;  3BQL A;  4X1K E;  3ZPO A;  5KX5 E;  1WFD A;  3FB2 A;  5FYM A;  3Q5E A;  3NRX A;  4QXH B;  1UCU A;  2IUB A;  5FY7 A;  2ACZ A;  4O2B E;  1G8X A;  3ZYK A;  4IT4 A;  3UU6 A;  4MLK A;  2LLY A;  1HNW T;  2RPA A;  1KNZ A;  1YW0 A;  5JRC A;  3LJC A;  4WBO A;  5AQK B;  2NW9 A;  3AAA B;  3LSV A;  2EHO B;  1E2A A;  4YTN A;  3U78 A;  4KUM B;  1WCR A;  5FL0 A;  2JJ9 A;  3HKE E;  4UVB B;  2W2U A;  3J9X 1;  4LFB T;  2BDE A;  1D1C A;  3ONJ A;  3FZL B;  4CI1 B;  1YKE B;  4HFV A;  2KZ7 B;  5AFU L;  2D2S A;  2DNX A;  2CXD A;  4X62 T;  2X68 A;  1G73 A;  3IF8 B;  1ZP0 A;  2OA5 A;  4I55 E;  3RRW A;  4HWC A;  2WCA A;  4CI2 B;  3AXJ B;  1T7S A;  2V7J A;  4MBQ A;  4EYY R;  2D0U A;  3QC9 A;  2M6B A;  4YJ2 E;  3RPU A;  3AVR A;  3AVS A;  2X66 A;  4YSY A;  2XM1 A;  4HFI A;  3EDV A;  4PAG A;  3RIA A;  3TKL B;  2VAS A;  1BR1 A;  2OLT A;  1IAP A;  4EOZ B;  2LSG A;  1HR0 T;  4X65 T;  2CA5 A;  1L0V A;  4DV4 T;  2LKH A;  4KP3 C;  1D1A A;  4UF0 B;  3PUX F;  5HAX A;  3QOF A;  1D0Y A;  4PJM A;  2KMF A;  3PE0 A;  4AKG A;  3FXE B;  3HKC E;  2VK9 A;  2BKP A;  2M6I A;  1EZ3 A;  4AKL A;  1LRZ A;  4DV6 T;  3Q5W A;  5HCJ A;  2JQH A;  4TUY E;  1OED C;  3R6N A;  4HFC A;  1D0Z A;  3TLU A;  1E7P A;  4HFE A;  2NW8 A;  3HKB E;  5FP3 A;  3H3A A;  5HEO A;  3RKO A;  2BG9 C;  4B6X A;  3RQU A;  1X9B A;  1HX8 A;  4JEH B;  3FZK B;  2VB6 A;  3QB5 A;  4K0U A;  1BR2 A;  3ZYL A;  3ZJ1 A;  1Z8U A;  4IHJ E;  3AE9 A;  4DV7 T;  3N2K E;  3MZK B;  4YXD A;  2X9X A;  2HN1 A;  2YN6 A;  2LOP A;  2IML A;  4U7I A;  2JMH A;  3FBL A;  3OVU A;  3B13 A;  2UUB T;  3FHN A;  4BJM A;  2XQ3 A;  2N9D A;  3WI3 A;  3Q5X A;  3EAM A;  3PUS A;  1BR0 A;  1HCI A;  4HWF A;  3Q2M A;  4JI0 T;  5LBM A;  4ZZC A;  4ADZ A;  2VKO A;  3AEC A;  3G06 A;  3B57 A;  2X9Y A;  5AQQ B;  1SUM B;  5LJM A;  5FY1 A;  5A1L A;  4I50 E;  3ANW B;  3PU8 A;  3EDU A;  4MHC A;  4ILA A;  3I9Y A;  3RLF F;  4GIW A;  4DV0 T;  4CXY A;  2D5U A;  2XTL A;  3AE7 A;  4PW8 A;  3MA9 A;  3PUW F;  4YSX A;  3UU8 A;  3I1A A;  2NW7 A;  2DWG A;  4QKN A;  2WS3 A;  1VRB A;  2XQ8 A;  4H9N C;  4OX9 T;  3H37 A;  3BQI A;  2YDS A;  1OED A;  1N34 T;  3ZMZ B;  5AQL B;  1HX1 B;  4EED A;  1SE7 A;  4IGU A;  5HXC A;  2ODU A;  4JEU B;  1S35 A;  3AXJ A;  1MIV A;  2QGS A;  2BG9 A;  4BA9 A;  4QXC B;  2BVM A;  2CM0 A;  4KMC A;  4NXN T;  4V1A v;  3P4P A;  4P1N A;  5CA0 E;  5LMN T;  1YQ4 A;  3F31 A;  1R8I A;  1ZEE A;  3AE2 A;  4KHZ F;  3P50 A;  1UK5 A;  5ABF A;  4A97 A;  2A3D A;  2JPF A;  1KK7 A;  3O1I A;  2IAK A;  5HCM A;  2H7O A;  1US7 B;  2LHR A;  4HKA A;  1MIY A;  2JQQ A;  3OYZ A;  1CHU A;  4U74 A;  2YKS A;  3VR9 A;  4YJ3 E;  5CGM A;  4IDN A;  1HFA A;  3AEE A;  3KBT A;  4N78 D;  3AB3 B;  4O2A E;  4JUY A;  2DHR A;  3N2G E;  1MMD A;  1JNZ A;  3PJA J;  2KWI B;  2E9X D;  3NZP A;  4P09 A;  5HEU A;  3VRA A;  4X64 T;  4WW0 A;  2SPC A;  1IZN B;  4TNW A;  2YDQ A;  2VWA A;  2I0M A;  2PG8 A;  4DBQ A;  1FMW A;  5J2T E;  3RYI E;  4XBF B;  2NWB A;  4H9O C;  3JCF A;  3EHZ A;  2LEH A;  3BK9 A;  5JRE A;  2W0G A;  3K3O A;  2ZM2 A;  4NUV A;  4KHP T;  3N2O A;  5FVK A;  2CBJ A;  2OV9 A;  3N9P A;  3H3M A;  2MTQ A;  3I9W A;  3L09 A;  5LNK A;  2RP4 A;  4FJO A;  4DMV A;  5GON E;  5L4H A;  2L9Q A;  2ACX A;  3N9L A;  4PFP A;  3MKD A;  5F8P A;  5JQG E;  2ZM0 A;  3PUY F;  4HEA A;  5AQH B;  2E9X C;  5FKY A;  4IL9 A;  4CZZ B;  2X51 A;  1YXR A;  2W61 A;  3NBX X;  4YTM A;  4JBW F;  5FL1 A;  5JR9 C;  4QXB B;  3CKD A;  1HTJ F;  1QUU A;  2LM2 A;  5LG4 A;  3PU3 A;  1Z0P A;  3GN5 B;  4DV3 T;  1V9D A;  4P0B A;  3ZN1 B;  3ANW A;  2H89 A;  1FJG T;  5TAO A;  1KFY A;  1JNR A;  2NP9 A;  2YU2 A;  5J1G A;  4EAH A;  2XHE B;  5L3F B;  3U3I A;  2NR4 A;  3OBV E;  2HPL A;  3LBX B;  2E2A A;  4GYR A;  2UXX B;  2C5J A;  3F2E A;  3VU7 H;  3C64 A;  2VVS A;  2V5C A;  5FXW A;  1NEK A;  2WM9 A;  5EK4 A;  4HWI B;  2WDQ A;  1QSD A;  4AKH A;  3MJX A;  3UU4 A;  4UIG A;  3AE3 A;  2W4X A;  3FZM B;  4YFS A;  3CPZ A;  5AQV B;  3RX6 A;  2ZMA A;  3OPC A;  5KDM C;  1IJ6 A;  3ZYM A;  2HH7 A;  5FXV A;  3RQW A;  4TX5 A;  4EXT A;  4X1I E;  1OWA A;  2VL0 A;  5ABG A;  3RYC E;  2E8I A;  2IHR 1;  5ADX L;  3ETU A;  4C91 A;  3ZLI A;  3CQX C;  5AQT B;  5KXJ A;  5ABH A;  2WY2 A;  2BS2 A;  3IBP A;  3K1S A;  2E9X A;  5LGU B;  4B3T T;  2XAG B;  2A2F X;  3V5S A;  2KLQ A;  2W62 A;  1E1H B;  3AEB A;  2R6G F;  4CXW A;  4LF8 T;  2EHO D;  3IHR A;  4YLH A;  4PK6 A;  5JR9 A;  2UXD T;  2DLR A;  2CE7 A;  3B5M A;  5JDQ A;  3OKQ A;  3KV5 A;  4DR1 T;  5CB4 E;  4TV8 E;  2LM9 A;  3TLV A;  4OFZ A;  2RA1 A;  5JDN A;  5HWY A;  2VUR A;  3PUG A;  3AEA A;  1BR4 A;  4L9I A;  2XY8 B;  5L2L A;  2CMR A;  2DI4 A;  4AQF C;  3X1D A;  5L3D B;  4PJL A;  4IE4 A;  4ZS2 A;  3K3Q C;  4H9S E;  2KT9 A;  3RI5 A;  2BVL A;  4GKK T;  4IE0 A;  2LRK A;  3PUQ A;  4DR6 T;  2XAS B;  4F6R C;  2EHO C;  5LHG B;  2C5I T;  3EI0 A;  2KSR A;  2J4G A;  5L3G B;  2XQ7 A;  1IBL T;  2JRK A;  2WB5 A;  2M67 A;  2DCF A;  2XQ9 A;  3CML A;  3SFD A;  2MPK A;  5EK2 A;  5C2T A;  3VKG A;  2YEV C;  5IWA T;  2C5K T;  4U2Y A;  2XQY A;  3AAI A;  3PTR B;  3C4X A;  5HEJ A;  3WAJ A;  4YHJ A;  2PJQ A;  4JI8 T;  1HF8 A;  2VKD A;  5M4Y A;  2CHN A;  3NVO A;  2A72 A;  5AQM B;  3O1J A;  4HWH A;  4XZC A;  4CN6 A;  5JVD E;  4ILB A;  3GWH A;  4TWD A;  4GK0 E;  1X79 A;  4FI5 A;  3LBX A;  1XZY A;  5LP6 E;  3A5X A;  4EV6 A;  4GOU A;  5AQS B;  4IDO A;  2Q9Q B;  3ZJ2 A;  4DV5 T;  2CLY B;  4A5X A;  2L8K A;  4AKR B;  5LA6 E;  2NTY A;  2Q9Q D;  3PJA A;  5HXH A;  3JAF A;  3HI2 A;  1OED E;  2UXB T;  4UR9 A;  2Y6X A;  2FUP A;  3EUH A;  2CCQ A;  4OK0 A;  1H7C A;  3ZMU B;  5LJN A;  2F4V T;  5AQU B;  5DQW A;  1UX5 A;  2BG9 E;  3RC3 A;  5AQJ B;  2ES0 A;  4IDP A;  2CEA A;  4AQF A;  4TWF A;  3PUR A;  4PNI A;  4U7Y A;  1UGO A;  4E7Z A;  3RKG A;  5LB7 B;  4IST A;  5JDM A;  2XZE A;  2K48 A;  5L3E B;  3DP7 A;  5H6R B;  3N9Q A;  2H3R A;  4I0U A;  3ZEF B;  1WRD A;  2EHO A;  2KXP B;  5JDH A;  4A98 A;  2W66 A;  1MIW A;  2JQK A;  1MNE A;  3CK6 A;  2MAW A;  2KND A;  4IDQ A;  4DVD A;  4ZI7 E;  2FJB A;  3HL6 A;  2YDR A;  2CRB A;  2K5B B;  4NIQ A;  2Q9Q C;  2CLY C;  4AIU A;  4Z90 A;  1B7T A;  3AA7 B;  5AQG B;  2NOX A;  1LVF A;  2X9W A;  3ZT6 A;  3A8Y C;  3GMI A;  2I6H A;  4EB6 E;  3MK7 C;  3N9M A;  2CHO A;  4U72 A;  2CXL A;  2IDO B;  4J2C A;  3UUL A;  4JI3 T;  3C98 B;  4U3C A;  2E5V A;  2BBH A;  2IIU A;  3AED A;  3P4Q A;  5IYZ E;  2LSY A;  2MYS A;  3A7M A; 
#chains in the Genus database with same CATH homology
 3JAF A;  1OED E;  3UQ4 A;  3LSV A;  2YKS A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQW A;  2M6I A;  4ILC A;  2VL0 A;  2BG9 E;  3EI0 A;  2LM2 A;  2KSR A;  3TLS A;  1OED B;  2XQ7 A;  5HCJ A;  4HFD A;  4ILA A;  5LG3 A;  1OED C;  4NPP A;  4HFC A;  3UU5 A;  3P4W A;  4TWF A;  2XQ9 A;  4QH4 A;  3TLU A;  4IRE A;  4HFE A;  2BG9 B;  5HEU A;  4HFB A;  4X5T A;  5HEO A;  3TLW A;  2BG9 C;  4TNW A;  5CFB A;  3RQU A;  4F8H A;  4TWH A;  3UU8 A;  2XQA A;  2XQ4 A;  2YOE A;  4A98 A;  5HEJ A;  2MAW A;  4QH1 A;  2XQ8 A;  2XQ6 A;  3TLT A;  4Z91 A;  2XQ5 A;  4IL4 A;  3EHZ A;  1OED A;  5IUX A;  3ZKR A;  4QH5 A;  3TLV A;  2YN6 A;  4TNV A;  4LMK A;  5L47 A;  4Z90 A;  2M6B A;  3UUB A;  3JAE A;  4ILB A;  5HEG A;  4TWD A;  4COF A;  2BG9 A;  4HFI A;  5L4E A;  3RIA A;  2LKG A;  4LMJ A;  3RHW A;  2XQ3 A;  3EAM A;  5L4H A;  5J0Z A;  3P50 A;  4HFH A;  3UU3 A;  3UU4 A;  3UU6 A;  4A97 A;  2LKH A;  3RIF A;  2LLY A;  3RI5 A;  5HEH A;  5HCM A;  4ZZC A;  4IL9 A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...