2LLYA

Nmr structures of the transmembrane domains of the nachr a4 subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
134
Chain Sequence
EELPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSSVSPSIGEYLLFTMIFVTLSIVITVFVLNVHHRSPETHTGGGGGIDRIFLWMFIIVCLLGTVGLFLPPWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit alpha-4
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 36
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2llyA01
2XQ6A 2LKHA 3UU8A 4HFIA 3UU5A 3EHZA 3RHWA 4HFHA 2XQ4A 4F8HA 3RIFA 5HEUA 3JAFA 3P50A 4IL4A 2XQ5A 5HEGA 3EI0A 4HFEA 5HCMA 5HEOA 3TLUA 1OEDA 4LMLA 2LLYA 2BG9C 4X5TA 3LSVA 3TLWA 5HCJA 4NPPA 4HFBA 2LKGA 4COFA 5L47A 5J0ZA 2M6BA 3UUBA 1OEDC 3UU4A 4HFDA 4TNWA 5HEHA 4LMJA 4Z91A 1OEDB 3TLVA 3UU3A 4LMKA 5LG3A 2BG9E 3P4WA 4TNVA 3EAMA 4QH4A 5IUXA 5L4EA 2XQ8A 4ILAA 3RQWA 5HEJA 4QH5A 2MAWA 2XQ9A 4HFCA 4Z90A 4ILCA 2LM2A 2VL0A 4QH1A 2YKSA 4A97A 1OEDE 2XQ7A 3RIAA 4ILBA 4IREA 4IL9A 4TWFA 2XQAA 4ZZBA 3UQ7A 3JADA 3RQUA 4ZZCA 4TWHA 2YN6A 3JAEA 3UU6A 3RI5A 5L4HA 5CFBA 3TLTA 2KSRA 2YOEA 4TWDA 3TLSA 3UQ4A 2XQ3A 4A98A 3ZKRA 2M6IA 2BG9A 2BG9B
chains in the Genus database with same CATH superfamily
4ZI2D 2LJLA 3RHWA 4JI6T 2XQ4A 1OWAA 1IZNB 1HTJF 4YSYA 2A9UA 2BG9C 4JI8T 1MIVA 5LOVE 4AQFC 2N1GA 4C90A 4BJMA 4DUZT 3DTOA 4IHJE 5F3JA 2N2NA 4DUYT 4KHZF 4X1YE 2CCQA 2OA5A 2CRBA 4PW8A 3ZN0B 3NRXA 4GK5E 3KFWX 3AE3A 1FJGT 2FJAA 4JI1T 5IHYA 3NKZA 5LA6E 2WCAA 4QXBB 4YFSA 1YKHB 4MBQA 3HKEE 3PV0F 4ZI2C 4F6RC 4IDQA 3ZT6A 1T98A 4DR4T 2Y48B 3UU6A 5L2LA 4YHHT 2IHR1 3RI5A 5L4HA 2LT3A 4AQYT 5AQQB 4H9PC 4YSZA 2CXLA 3ZJ1A 5CJ5A 4I0UA 3N9PA 4HFIA 4DV5T 1NAFA 3KVAA 2ZMAA 4GKJT 4NUUA 2WU2A 3JAFA 1AJ3A 4WBOA 2XM1A 4X65T 2XQ5A 5HWYA 3SFDA 3AEAA 3WAKA 1EZ3A 4PFOA 4X1KE 5BMVE 4PK6A 2JJ9A 2VKHA 3I0QA 4U2ZA 3AEEA 4KHPT 2BBHA 1LVKA 2ES0A 5DABA 3UU4A 4HFDA 3QB5K 3AA0B 4TNWA 5F8PA 3J9X1 4Z91A 3KV5A 1ZKEA 1HR0T 1UUSA 2I0MA 5L3BB 2XAGB 4PK4A 3RQWA 2PG8A 1JNRA 4JUYA 3LG7A 2XASB 3FBZA 5LHIB 2YEVC 1MNEA 4LF6T 4H63V 1WYCA 1OEDE 2XQ7A 2CA5A 5JDHA 2XQAA 4TV8E 3VKHA 4IIJE 2X66A 3N2KE 5AQGB 2ODVA 4FJOA 4OYJA 3ZKRA 2J1DG 3AEGA 5F5WA 2RPAA 2M6IA 5FXWA 2W00A 3OKQA 2H3RA 4P0AA 4AQGA 3KV4A 1W09A 3FXEB 5JDGA 3ZCIA 2QRXA 2NW8A 3MKDA 1MMDA 4N78D 2HPLA 4IDNA 2LLYA 3SFEA 4QXCB 1G73A 1G8XA 2UXBT 3LSVA 4V1Av 3RIUA 3ZN1B 3RKGA 2VWAA 2SPCA 2HHHT 4AKRB 2H7VC 2IIUA 4YT0A 4GKKT 2BZBA 1BR0A 1WCRA 1UGOA 4WZXA 3KINB 4KI0F 3C4WA 3VR9A 5HWXA 3P4WA 3CPZA 4HKAA 2VQET 4XAXB 3PUYF 3KBTA 2DI4A 3JCFA 2MAWA 5ABHA 2CXDA 3QOFA 3RGLA 5AQSB 4DMVA 2CLYB 3PUZF 2IW5B 2G0UA 2KXPB 4ZZCA 3RQUA 2YN6A 2XQYA 5L3DB 3MZKB 3GN5B 3A5XA 4UF0B 3ZYKA 4GOUA 3AEBA 3N9QA 3O1IA 1WRDA 5IWAT 2Y8DA 1MMNA 3HKCE 2NR4A 3GMIA 5H6QB 4DVDA 2KLQA 3EUHA 2FJBA 2ACXA 2V7KA 2ZM6T 5C2TA 3VKGA 2AE9A 4EXTA 4UELA 5FXZA 2FJDA 5HXHA 2XJ7A 1T8BA 1HFAA 1Z0PA 2F4VT 2D9DA 3K3QC 1WR0A 5ABEA 4QX8B 3F31A 4LMJA 1OEDB 3VRAA 1BR4A 2VK9A 4LMKA 3AA6B 1BR1A 5JR9C 3GN5A 1S35A 4IE6A 5FL0A 2B76A 3LK42 1CHUA 3H3AA 4Z90A 4DV4T 3K3NA 3UUXB 3O1JA 4YXDA 2C0SA 1SE7A 3AE8A 5J2UE 1KNPA 2CBJA 2Q9QB 5HXRA 3E0ZA 4H63H 1VCSA 3PURA 4CN6A 2JRKA 3CMLA 4KMCA 4LFCT 2KWIB 4TUYE 2BG9B 1N33T 3FZLB 4PFPA 3NVOA 3FBLA 4WNKA 3ZMUB 2KWHA 1OEDA 1MNDA 1J5ET 1WLXA 3D0TA 1GQEA 1SHZC 4L9IA 3HA4A 4MHCA 4U7YA 2E2AA 3HI2A 3ONJA 5J0ZA 1W0BA 4JI5T 3RYHE 3UUBA 3IA3A 2X0YA 4YY3T 4OHFA 4HEAA 3CQCB 5JDNA 2Q9QA 2ZM2A 2FJEA 4IDZA 2PBIA 4H9RC 4QH4A 4E7SA 2XQ8A 2LHRA 3AAAB 2BKPA 1ZHCA 5JQGE 2E9XD 5A1LA 5JREA 2LM2A 3AA1B 5AQJB 3ANWA 2PJQA 1HCIA 2JQQA 3NWIA 2CHNA 3RKOA 4PJNA 4AQFA 2KINB 4KUMB 2IMLA 4HN9A 4AKLA 4IGUA 2MYSA 2XAQB 2KSRA 4UR9A 4C91A 3TLSA 2WDRA 1US7B 4CI3B 3QNUA 2UUCT 1T72A 2W67A 3AB3B 2UXNB 4H9QC 2LOPA 2C5IT 3CIRA 1HNWT 3N9MA 4IDPA 1M7KA 2X51A 1NENA 4LFBT 4U33A 3MACA 3UULA 4DV1T 1YW0A 3N2GE 3WAJA 4JI7T 1Z8UA 4QXHB 2L3LA 4X5TA 4A56A 3K3OA 4COFA 4AKIA 2E9XC 2IUBA 3ZT5A 4U7IA 3OBVE 2DCFA 1D0YA 2V1DB 4A5XA 3PJAA 5LBMA 2DNXA 2YK0A 3T8OA 3RRWA 2VVSA 5LG3A 4DBRA 2YINA 2NTYA 3L39A 3DP7A 2CBIA 1MIYA 3V5SA 3AE4A 1VRBA 4U72A 3QB5A 1XDPA 3GWHA 4DR2T 3AVRA 2UUBT 4KBMB 2YKSA 2BVMA 2XPKA 2YDSA 3RPUA 2UU9T 2W63A 5H6RB 4ISTA 5AFUL 3RYFE 3P4RA 4O8SA 2MTQA 3O9XA 3F57A 1HG5A 2HN2A 5CFBA 4AKGA 2I6HA 1Y64B 2FBWA 4IE4A 3PE0A 4X64T 1ZOYA 3EHZA 1HNZT 4F8HA 4JI2T 3KDSE 3FZMB 4CXYA 2BKOA 5L3CB 2UUAT 3AE2A 1LKXA 4HWDA 2IDOB 2JQ9A 4EZHA 2E8IA 2LSIA 2M6BA 1W0AA 2J4GA 3AE1A 5AQFB 2WMOA 3Q2MA 5LP6E 5FY0A 3PUAA 1D0XA 3PU3A 4QKNA 4X1IE 3BK9A 4HTEA 4X66T 5DJQC 3M65A 5AQVB 3OYZA 4UV8B 4G63A 4LF5T 3OJAA 1KEYA 3RIAA 3JC6D 1NEKA 3LBXB 2LRKA 2XM2A 3PUVF 5DQVA 3LK3B 1U4QA 3PJAJ 4TX5A 4U3CA 3Q9DA 5LGNB 3ZC1A 4M1PA 1H7CA 2LSKA 3NZQA 5ETWA 5CA0E 3RX6A 1IAPA 3A8YC 2YU2A 2LKHA 1D0ZA 3ZYLA 4YTNA 3RH3A 3RIFA 3P50A 3H3MA 4DNDA 3M3ZB 2V5DA 1QUUA 1R8IA 3PUXF 4ZI3D 3HR0A 2VKDA 1WR6A 3TLWA 2A3DA 4CN4A 4ZOLE 2GK9A 4B6XA 5LGTB 2NTXA 1D1BA 4DV2T 3ZSSA 5LB7B 1KFYA 5AQHB 2JQKA 3JC6C 3N5LA 3U78A 1I94T 3R6NA 1X9BA 4Z8XA 1NWMX 1WYBA 2BG9E 3FZKB 4UVCB 3RLFF 4OFZA 4PAGA 3A7MA 3EABA 3SWHA 2DLRA 4TZ4C 4ERRA 5JRCB 2IC6A 3UQ7A 3JADA 2W62A 4B3TT 4ILUA 2L8KA 4CI2B 4UVAB 2VASA 3OVUA 4IT4A 2BVLA 1IBKT 4ZI3C 2QGSA 5HAXA 3SS1A 1LVFA 2WZIA 4I55E 2WS3A 4I50E 4QWNB 2LEHA 2XTLA 2D0TA 4UV9B 2I59A 2WM9A 3AVSA 3KV6A 4NUVA 3SOLA 3P4QA 4AIUA 4LMLA 2WSSV 1FEWA 2CEAA 1JNZA 2XAFB 2X0HA 4NIQA 4O4IE 5KDMC 2EHOB 4QX7B 4IE5A 2HH7A 4EZ4A 2J47A 2B1EA 3L8RA 3ETUA 2VURA 4NXMT 5JRCA 4BA9A 4CXWA 3RIUC 1DU2A 3MA9A 3UTKA 3N9NA 2QVAA 3EAMA 2X9XA 1L0VA 3AE6A 3J7Yq 2K3WA 3B13A 4OK0A 2V7IA 5JTGA 3K8PC 2ZLYA 2CHOA 5ABFB 3W15B 2LSJA 5AQRB 4TWFA 3F2EA 1XMOT 2LHNA 4UF0A 5J1GA 4TV9E 5LMNT 3HKBE 4O2AE 4PNIA 3PDYA 3TLTA 2W2UA 2D5UA 4A98A 4JI4T 2RP4A 2EHOA 3C4ZA 1YD8G 4U2YA 5BR8T 2JIWA 2XQ6A 2UXCT 1B7TA 1M62A 2DHRA 1E2AA 3EI0A 4P1NA 4AKHA 2WB5A 3BQLA 1IJ5A 2L9QA 4PJJA 5LBQB 1HX1B 5LHGB 2WP9A 5LJMA 5ABFA 1V9DA 5KX5E 2R6GF 3ZYMA 3CKDA 1HX8A 5HXSA 2DL1A 3RC8A 3ZEFB 2VKJA 5TAOA 5LYJE 2JPFA 4DR7T 5FMNA 2WDQA 3FXDB 2XUEA 2BDEA 3CQXC 4JI3T 2KZ7B 1O3XA 2V26A 3K1SA 2LRLA 2K9AA 3Q5EA 4U31A 2E5LT 4LF4T 4IL9A 5ABGA 4TWHA 1XNQT 4YJ2E 3OPCA 1UURA 2K24A 4EAHA 1OXZA 1KK7A 2PTFA 4EB6E 2YU1A 4NXNT 4ASKA 3AXJB 1N34T 4LF8T 3QUJA 3ZSTA 2BG9A 3ZMTB 1YQ4A 3N2OA 5LGUB 3I0OA 2Q9QD 4H9SE 2BS3A 4EYUA 4HFHA 1W9RA 5HEUA 1HNXT 5IYZE 5L3GB 5HCMA 1MMAA 1KF6A 4YLHA 5C3JA 2NOXA 2WZHA 2ZM0A 3CX7B 1ZV4X 3ZC0A 2LSGA 4K0KT 1YQ3A 4UVBB 4JI0T 4MFRA 2ZM8A 1OEDC 2BKNA 2KNDA 3T1YT 1X79A 3UT5E 4UIGA 3RC3A 2WWVA 3CQGB 4KX6A 1IBMT 4LF9T 3TLVA 2W4XA 3O1HA 4JEHB 2ODUA 3AAIA 4WW0A 2LSYA 3P4PA 5L4EA 3S4UA 3KV9A 3FZHB 3AE5A 4BAYB 2LM9A 2N9DA 1YXRA 3C4XA 3AXJA 4DV6T 4HWHA 5EZYE 1E7PA 5AQOB 2VL0A 2E5VA 2HN1A 1FMWA 4ILBA 2Q9QC 4PJMA 5JDFA 4ZZBA 2DWKA 4E7ZA 4PJLA 3AA7B 4HE8A 2W66A 5HXEA 4ISSA 2H88A 2X67A 5ADXL 1QSDA 3PU8A 5AQIB 3I9WA 2C5KT 4U74A 4ZS3A 2Z6EA 3T1HT 5FY1A 2JMHA 2VB6A 4YTMA 4CZZB 1Y01A 3PUGA 4ZEYA 3MK7C 1ZP0A 3LDQB 3EDUA 4LF7T 4TN7B 4MALA 3I9YA 1WFDA 2LOSA 3P7IA 5E0OA 1FMVA 5HEGA 5HEOA 5FNVE 3C50A 2H89A 5AQPB 4EEDA 3P8CD 3EDVA 4ZXLA 4HWIB 3LK2B 2PFVA 3R84B 4OYKA 5FP3A 2LKGA 2W61A 4GYRA 5JH7E 5JDLA 2VKOA 3Q5WA 2BBJA 4BJNA 5LHHB 1XDOA 1XWMA 3BQKA 1LRZA 4LFAT 4O4JE 5FKYA 2VQFT 3CX8B 1IJ6A 4IE0A 3CVRA 3ZJ2A 1J5WA 3PTRB 5HEJA 1YKEB 5LCYA 3IF8B 2MPKA 4DIDB 4IDOA 3U3IA 4EOZB 2CE7A 2D2SA 4I4TE 4ILCA 3WI3A 4J2CA 3DJBA 5JVDE 4H9NC 2XAHB 4DBQA 1XMQT 4X20E 3ZMVB 1SUMB 2A2FX 3NBXX 4AI6A 4TWDA 1ZEEA 4QHOA 4O2BE 5AQMB 3O4XE 2V7LA 3IHRA 4B3MT 1KNRA 3B57A 2BS2A 1BR2A 2KMFA 1XNRT 2XHEB 5LMUT 4WYVA 4CN1A 2K5BB 2V7JA 4HFBA 4UXNB 3FHNA 2CWOA 3AEDA 4JLEA 5LJNA 2OV9A 1N36T 4H9OC 5AQLB 3ZT7A 5M4YA 4EV6A 5CA1E 3C51A 4O4HE 2ACZA 3N9LA 3L09A 2CWYA 4YJ3E 2XAJB 3X1DA 3ONLC 2WQYA 3MJXA 4DR5T 2M67A 4B3ST 4I43B 4MLKA 3HKDE 5JR9B 3OTOT 3CK6A 3C98B 4HFCA 2V6YB 3RRCA 4DV7T 2WWUA 5AQKB 3UFEA 4G2AA 3LBXA 1CUNA 3E22E 4CQIA 3JAEA 4P09A 3ZLIA 1KNZA 3P4SA 1VOMA 2NW7A 3RYIE 3ZPOA 2YOEA 4AISA 4XBFB 1N32T 1SA0E 4HFVA 5AQNB 4OX9T 3SRZA 3TKLB 2WAUA 2MOZA 5EK2A 3KVBA 5EK3A 4DV3T 4ZHQE 2UXXB 1QLBA 2IC9A 5HCJA 2BS4A 4HWCA 3ZMSB 5JR9A 5LG4A 5L47A 4EGWA 2V6YA 5FVLA 4K0UA 2C5JA 5FYMA 2VVNA 5FVKA 4AXPA 2H7OA 3NRYA 5FXVA 2MBGA 2XZEA 4EIWA 2J62A 3LFMA 2X9YA 4TNVA 2HPJA 5IUXA 3ETVA 4ILAA 2NW9A 2X9HA 1UX4A 4QH5A 1MMGA 2V6XA 5HXCA 1VCTA 3KBUA 5KXJA 3UUNA 2DWGA 2XSBA 4EEBA 4GIWA 2V8SV 2CMRA 3UUMA 4DR3T 3UFGA 4PK5A 4P0BA 2KT9A 2VL8A 2JQHA 2W0GA 4DO0A 4IE7A 2X0LB 4DR1T 3EVYA 2X68A 3UU5A 5GONE 4ZS2A 4DR6T 4XZCA 3QC9A 2AXDS 4YTPA 4HFEA 3N9OA 4L0RA 5JDMA 2NP9A 1IBLT 3H37A 5EK4A 2V5CA 4L5GA 3Q5XA 4O4LE 4JEUB 4CXXA 4UEMA 3AE7A 2Y6XA 1HG2A 2E9XB 4Q25A 4GYSA 5DQWA 3PUSA 3UU3A 2EHOD 1E1HB 4ADZA 1T7SA 5FY7A 4X62T 1I6ZA 1UK5A 3ABVA 5AQTB 4QH1A 3V5UA 5L3EB 1MIWA 2NWBA 2WMNA 3ANWB 2LE8A 4B3RT 3Q5DA 2OLTA 4CI1B 1UCUA 5LXTE 1D1CA 2CLYC 3NZPA 1J1JA 5AQUB 3UQ4A 2JMKA 2YDRA 3L3PA 3RYCE 1HF8A 5L3FB 5C8YE 4DV0T 4WBNE 5HYAA 3RF1A 3ESLA 3ONXA 4KP3C 2CPTA 2XY8B 1FIOA 3UU8A 3HL6A 3C64A 2E9XA 2XSAA 4JBWF 2K48A 3B5MA 4IL4A 4ANJA 3FZFB 4YHJA 2P9BA 3TLUA 5KMGP 2RA1A 2EHOC 3GA8A 3IEEA 5FXXA 4NPPA 4HWFA 4ZI7E 2QYWA 3E08A 2YDQA 3AEFA 3FB2A 3QK6A 4DMWA 3BQIA 4GK0E 5LNKA 2X9WA 3PUWF 4EYYR 4FI5A 4JV5T 5FL1A 5HEHA 2QA7A 2UXDT 2WY2A 3OYXA 3LJCA 3I1AA 2WDVA 1U5PA 4HGAA 2D0UA 3G06A 2IAKA 3MXZA 3CWZB 2XQ9A 3AAEB 2WBLA 5CB4E 1S94A 3VR8A 3ZCJA 1D1AA 4A97A 4IREA 3VHLA 3VU7H 3AECA 2FUPA 2WU5A 3AE9A 2CM0A 1UX5A 1XZYA 5J2TE 1HS7A 3CX6B 5CGMA 2V7MA 2CXFA 2A72A 4JYAT 2XQ3A 3PUQA 5JDQA 3ZMZB 3IBPA 4YSXA 3VRBA
chains in the Genus database with same CATH topology
2XQ6A 2LKHA 3UU8A 4HFIA 3UU5A 3EHZA 3RHWA 4HFHA 2XQ4A 4F8HA 3RIFA 5HEUA 3JAFA 3P50A 4IL4A 2XQ5A 5HEGA 3EI0A 4HFEA 5HCMA 5HEOA 3TLUA 1OEDA 4LMLA 2LLYA 2BG9C 4X5TA 3LSVA 3TLWA 5HCJA 4NPPA 4HFBA 2LKGA 4COFA 5L47A 5J0ZA 2M6BA 3UUBA 1OEDC 3UU4A 4HFDA 4TNWA 5HEHA 4LMJA 4Z91A 1OEDB 3TLVA 3UU3A 4LMKA 5LG3A 2BG9E 3P4WA 4TNVA 3EAMA 4QH4A 5IUXA 5L4EA 2XQ8A 4ILAA 3RQWA 5HEJA 4QH5A 2MAWA 2XQ9A 4HFCA 4Z90A 4ILCA 2LM2A 2VL0A 4QH1A 2YKSA 4A97A 1OEDE 2XQ7A 3RIAA 4ILBA 4IREA 4IL9A 4TWFA 2XQAA 4ZZBA 3UQ7A 3JADA 3RQUA 4ZZCA 4TWHA 2YN6A 3JAEA 3UU6A 3RI5A 5L4HA 5CFBA 3TLTA 2KSRA 2YOEA 4TWDA 3TLSA 3UQ4A 2XQ3A 4A98A 3ZKRA 2M6IA 2BG9A 2BG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ6 A;  2LKH A;  3UU8 A;  4HFI A;  3UU5 A;  3EHZ A;  3RHW A;  4HFH A;  2XQ4 A;  4F8H A;  3RIF A;  5HEU A;  3JAF A;  3P50 A;  4IL4 A;  2XQ5 A;  5HEG A;  3EI0 A;  4HFE A;  5HCM A;  5HEO A;  3TLU A;  1OED A;  4LML A;  2LLY A;  2BG9 C;  4X5T A;  3LSV A;  3TLW A;  5HCJ A;  4NPP A;  4HFB A;  2LKG A;  4COF A;  5L47 A;  5J0Z A;  2M6B A;  3UUB A;  1OED C;  3UU4 A;  4HFD A;  4TNW A;  5HEH A;  4LMJ A;  4Z91 A;  1OED B;  3TLV A;  3UU3 A;  4LMK A;  5LG3 A;  2BG9 E;  3P4W A;  4TNV A;  3EAM A;  4QH4 A;  5IUX A;  5L4E A;  2XQ8 A;  4ILA A;  3RQW A;  5HEJ A;  4QH5 A;  2MAW A;  2XQ9 A;  4HFC A;  4Z90 A;  4ILC A;  2LM2 A;  2VL0 A;  4QH1 A;  2YKS A;  4A97 A;  1OED E;  2XQ7 A;  3RIA A;  4ILB A;  4IRE A;  4IL9 A;  4TWF A;  2XQA A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQU A;  4ZZC A;  4TWH A;  2YN6 A;  3JAE A;  3UU6 A;  3RI5 A;  5L4H A;  5CFB A;  3TLT A;  2KSR A;  2YOE A;  4TWD A;  3TLS A;  3UQ4 A;  2XQ3 A;  4A98 A;  3ZKR A;  2M6I A;  2BG9 A;  2BG9 B; 
#chains in the Genus database with same CATH topology
 4ZI2 D;  2LJL A;  3RHW A;  4JI6 T;  2XQ4 A;  1OWA A;  1IZN B;  1HTJ F;  4YSY A;  2A9U A;  2BG9 C;  4JI8 T;  1MIV A;  5LOV E;  4AQF C;  2N1G A;  4C90 A;  4BJM A;  4DUZ T;  3DTO A;  4IHJ E;  5F3J A;  2N2N A;  4DUY T;  4KHZ F;  4X1Y E;  2CCQ A;  2OA5 A;  2CRB A;  4PW8 A;  3ZN0 B;  3NRX A;  4GK5 E;  3KFW X;  3AE3 A;  1FJG T;  2FJA A;  4JI1 T;  5IHY A;  3NKZ A;  5LA6 E;  2WCA A;  4QXB B;  4YFS A;  1YKH B;  4MBQ A;  3HKE E;  3PV0 F;  4ZI2 C;  4F6R C;  4IDQ A;  3ZT6 A;  1T98 A;  4DR4 T;  2Y48 B;  3UU6 A;  5L2L A;  4YHH T;  2IHR 1;  3RI5 A;  5L4H A;  2LT3 A;  4AQY T;  5AQQ B;  4H9P C;  4YSZ A;  2CXL A;  3ZJ1 A;  5CJ5 A;  4I0U A;  3N9P A;  4HFI A;  4DV5 T;  1NAF A;  3KVA A;  2ZMA A;  4GKJ T;  4NUU A;  2WU2 A;  3JAF A;  1AJ3 A;  4WBO A;  2XM1 A;  4X65 T;  2XQ5 A;  5HWY A;  3SFD A;  3AEA A;  3WAK A;  1EZ3 A;  4PFO A;  4X1K E;  5BMV E;  4PK6 A;  2JJ9 A;  2VKH A;  3I0Q A;  4U2Z A;  3AEE A;  4KHP T;  2BBH A;  1LVK A;  2ES0 A;  5DAB A;  3UU4 A;  4HFD A;  3QB5 K;  3AA0 B;  4TNW A;  5F8P A;  3J9X 1;  4Z91 A;  3KV5 A;  1ZKE A;  1HR0 T;  1UUS A;  2I0M A;  5L3B B;  2XAG B;  4PK4 A;  3RQW A;  2PG8 A;  1JNR A;  4JUY A;  3LG7 A;  2XAS B;  3FBZ A;  5LHI B;  2YEV C;  1MNE A;  4LF6 T;  4H63 V;  1WYC A;  1OED E;  2XQ7 A;  2CA5 A;  5JDH A;  2XQA A;  4TV8 E;  3VKH A;  4IIJ E;  2X66 A;  3N2K E;  5AQG B;  2ODV A;  4FJO A;  4OYJ A;  3ZKR A;  2J1D G;  3AEG A;  5F5W A;  2RPA A;  2M6I A;  5FXW A;  2W00 A;  3OKQ A;  2H3R A;  4P0A A;  4AQG A;  3KV4 A;  1W09 A;  3FXE B;  5JDG A;  3ZCI A;  2QRX A;  2NW8 A;  3MKD A;  1MMD A;  4N78 D;  2HPL A;  4IDN A;  2LLY A;  3SFE A;  4QXC B;  1G73 A;  1G8X A;  2UXB T;  3LSV A;  4V1A v;  3RIU A;  3ZN1 B;  3RKG A;  2VWA A;  2SPC A;  2HHH T;  4AKR B;  2H7V C;  2IIU A;  4YT0 A;  4GKK T;  2BZB A;  1BR0 A;  1WCR A;  1UGO A;  4WZX A;  3KIN B;  4KI0 F;  3C4W A;  3VR9 A;  5HWX A;  3P4W A;  3CPZ A;  4HKA A;  2VQE T;  4XAX B;  3PUY F;  3KBT A;  2DI4 A;  3JCF A;  2MAW A;  5ABH A;  2CXD A;  3QOF A;  3RGL A;  5AQS B;  4DMV A;  2CLY B;  3PUZ F;  2IW5 B;  2G0U A;  2KXP B;  4ZZC A;  3RQU A;  2YN6 A;  2XQY A;  5L3D B;  3MZK B;  3GN5 B;  3A5X A;  4UF0 B;  3ZYK A;  4GOU A;  3AEB A;  3N9Q A;  3O1I A;  1WRD A;  5IWA T;  2Y8D A;  1MMN A;  3HKC E;  2NR4 A;  3GMI A;  5H6Q B;  4DVD A;  2KLQ A;  3EUH A;  2FJB A;  2ACX A;  2V7K A;  2ZM6 T;  5C2T A;  3VKG A;  2AE9 A;  4EXT A;  4UEL A;  5FXZ A;  2FJD A;  5HXH A;  2XJ7 A;  1T8B A;  1HFA A;  1Z0P A;  2F4V T;  2D9D A;  3K3Q C;  1WR0 A;  5ABE A;  4QX8 B;  3F31 A;  4LMJ A;  1OED B;  3VRA A;  1BR4 A;  2VK9 A;  4LMK A;  3AA6 B;  1BR1 A;  5JR9 C;  3GN5 A;  1S35 A;  4IE6 A;  5FL0 A;  2B76 A;  3LK4 2;  1CHU A;  3H3A A;  4Z90 A;  4DV4 T;  3K3N A;  3UUX B;  3O1J A;  4YXD A;  2C0S A;  1SE7 A;  3AE8 A;  5J2U E;  1KNP A;  2CBJ A;  2Q9Q B;  5HXR A;  3E0Z A;  4H63 H;  1VCS A;  3PUR A;  4CN6 A;  2JRK A;  3CML A;  4KMC A;  4LFC T;  2KWI B;  4TUY E;  2BG9 B;  1N33 T;  3FZL B;  4PFP A;  3NVO A;  3FBL A;  4WNK A;  3ZMU B;  2KWH A;  1OED A;  1MND A;  1J5E T;  1WLX A;  3D0T A;  1GQE A;  1SHZ C;  4L9I A;  3HA4 A;  4MHC A;  4U7Y A;  2E2A A;  3HI2 A;  3ONJ A;  5J0Z A;  1W0B A;  4JI5 T;  3RYH E;  3UUB A;  3IA3 A;  2X0Y A;  4YY3 T;  4OHF A;  4HEA A;  3CQC B;  5JDN A;  2Q9Q A;  2ZM2 A;  2FJE A;  4IDZ A;  2PBI A;  4H9R C;  4QH4 A;  4E7S A;  2XQ8 A;  2LHR A;  3AAA B;  2BKP A;  1ZHC A;  5JQG E;  2E9X D;  5A1L A;  5JRE A;  2LM2 A;  3AA1 B;  5AQJ B;  3ANW A;  2PJQ A;  1HCI A;  2JQQ A;  3NWI A;  2CHN A;  3RKO A;  4PJN A;  4AQF A;  2KIN B;  4KUM B;  2IML A;  4HN9 A;  4AKL A;  4IGU A;  2MYS A;  2XAQ B;  2KSR A;  4UR9 A;  4C91 A;  3TLS A;  2WDR A;  1US7 B;  4CI3 B;  3QNU A;  2UUC T;  1T72 A;  2W67 A;  3AB3 B;  2UXN B;  4H9Q C;  2LOP A;  2C5I T;  3CIR A;  1HNW T;  3N9M A;  4IDP A;  1M7K A;  2X51 A;  1NEN A;  4LFB T;  4U33 A;  3MAC A;  3UUL A;  4DV1 T;  1YW0 A;  3N2G E;  3WAJ A;  4JI7 T;  1Z8U A;  4QXH B;  2L3L A;  4X5T A;  4A56 A;  3K3O A;  4COF A;  4AKI A;  2E9X C;  2IUB A;  3ZT5 A;  4U7I A;  3OBV E;  2DCF A;  1D0Y A;  2V1D B;  4A5X A;  3PJA A;  5LBM A;  2DNX A;  2YK0 A;  3T8O A;  3RRW A;  2VVS A;  5LG3 A;  4DBR A;  2YIN A;  2NTY A;  3L39 A;  3DP7 A;  2CBI A;  1MIY A;  3V5S A;  3AE4 A;  1VRB A;  4U72 A;  3QB5 A;  1XDP A;  3GWH A;  4DR2 T;  3AVR A;  2UUB T;  4KBM B;  2YKS A;  2BVM A;  2XPK A;  2YDS A;  3RPU A;  2UU9 T;  2W63 A;  5H6R B;  4IST A;  5AFU L;  3RYF E;  3P4R A;  4O8S A;  2MTQ A;  3O9X A;  3F57 A;  1HG5 A;  2HN2 A;  5CFB A;  4AKG A;  2I6H A;  1Y64 B;  2FBW A;  4IE4 A;  3PE0 A;  4X64 T;  1ZOY A;  3EHZ A;  1HNZ T;  4F8H A;  4JI2 T;  3KDS E;  3FZM B;  4CXY A;  2BKO A;  5L3C B;  2UUA T;  3AE2 A;  1LKX A;  4HWD A;  2IDO B;  2JQ9 A;  4EZH A;  2E8I A;  2LSI A;  2M6B A;  1W0A A;  2J4G A;  3AE1 A;  5AQF B;  2WMO A;  3Q2M A;  5LP6 E;  5FY0 A;  3PUA A;  1D0X A;  3PU3 A;  4QKN A;  4X1I E;  3BK9 A;  4HTE A;  4X66 T;  5DJQ C;  3M65 A;  5AQV B;  3OYZ A;  4UV8 B;  4G63 A;  4LF5 T;  3OJA A;  1KEY A;  3RIA A;  3JC6 D;  1NEK A;  3LBX B;  2LRK A;  2XM2 A;  3PUV F;  5DQV A;  3LK3 B;  1U4Q A;  3PJA J;  4TX5 A;  4U3C A;  3Q9D A;  5LGN B;  3ZC1 A;  4M1P A;  1H7C A;  2LSK A;  3NZQ A;  5ETW A;  5CA0 E;  3RX6 A;  1IAP A;  3A8Y C;  2YU2 A;  2LKH A;  1D0Z A;  3ZYL A;  4YTN A;  3RH3 A;  3RIF A;  3P50 A;  3H3M A;  4DND A;  3M3Z B;  2V5D A;  1QUU A;  1R8I A;  3PUX F;  4ZI3 D;  3HR0 A;  2VKD A;  1WR6 A;  3TLW A;  2A3D A;  4CN4 A;  4ZOL E;  2GK9 A;  4B6X A;  5LGT B;  2NTX A;  1D1B A;  4DV2 T;  3ZSS A;  5LB7 B;  1KFY A;  5AQH B;  2JQK A;  3JC6 C;  3N5L A;  3U78 A;  1I94 T;  3R6N A;  1X9B A;  4Z8X A;  1NWM X;  1WYB A;  2BG9 E;  3FZK B;  4UVC B;  3RLF F;  4OFZ A;  4PAG A;  3A7M A;  3EAB A;  3SWH A;  2DLR A;  4TZ4 C;  4ERR A;  5JRC B;  2IC6 A;  3UQ7 A;  3JAD A;  2W62 A;  4B3T T;  4ILU A;  2L8K A;  4CI2 B;  4UVA B;  2VAS A;  3OVU A;  4IT4 A;  2BVL A;  1IBK T;  4ZI3 C;  2QGS A;  5HAX A;  3SS1 A;  1LVF A;  2WZI A;  4I55 E;  2WS3 A;  4I50 E;  4QWN B;  2LEH A;  2XTL A;  2D0T A;  4UV9 B;  2I59 A;  2WM9 A;  3AVS A;  3KV6 A;  4NUV A;  3SOL A;  3P4Q A;  4AIU A;  4LML A;  2WSS V;  1FEW A;  2CEA A;  1JNZ A;  2XAF B;  2X0H A;  4NIQ A;  4O4I E;  5KDM C;  2EHO B;  4QX7 B;  4IE5 A;  2HH7 A;  4EZ4 A;  2J47 A;  2B1E A;  3L8R A;  3ETU A;  2VUR A;  4NXM T;  5JRC A;  4BA9 A;  4CXW A;  3RIU C;  1DU2 A;  3MA9 A;  3UTK A;  3N9N A;  2QVA A;  3EAM A;  2X9X A;  1L0V A;  3AE6 A;  3J7Y q;  2K3W A;  3B13 A;  4OK0 A;  2V7I A;  5JTG A;  3K8P C;  2ZLY A;  2CHO A;  5ABF B;  3W15 B;  2LSJ A;  5AQR B;  4TWF A;  3F2E A;  1XMO T;  2LHN A;  4UF0 A;  5J1G A;  4TV9 E;  5LMN T;  3HKB E;  4O2A E;  4PNI A;  3PDY A;  3TLT A;  2W2U A;  2D5U A;  4A98 A;  4JI4 T;  2RP4 A;  2EHO A;  3C4Z A;  1YD8 G;  4U2Y A;  5BR8 T;  2JIW A;  2XQ6 A;  2UXC T;  1B7T A;  1M62 A;  2DHR A;  1E2A A;  3EI0 A;  4P1N A;  4AKH A;  2WB5 A;  3BQL A;  1IJ5 A;  2L9Q A;  4PJJ A;  5LBQ B;  1HX1 B;  5LHG B;  2WP9 A;  5LJM A;  5ABF A;  1V9D A;  5KX5 E;  2R6G F;  3ZYM A;  3CKD A;  1HX8 A;  5HXS A;  2DL1 A;  3RC8 A;  3ZEF B;  2VKJ A;  5TAO A;  5LYJ E;  2JPF A;  4DR7 T;  5FMN A;  2WDQ A;  3FXD B;  2XUE A;  2BDE A;  3CQX C;  4JI3 T;  2KZ7 B;  1O3X A;  2V26 A;  3K1S A;  2LRL A;  2K9A A;  3Q5E A;  4U31 A;  2E5L T;  4LF4 T;  4IL9 A;  5ABG A;  4TWH A;  1XNQ T;  4YJ2 E;  3OPC A;  1UUR A;  2K24 A;  4EAH A;  1OXZ A;  1KK7 A;  2PTF A;  4EB6 E;  2YU1 A;  4NXN T;  4ASK A;  3AXJ B;  1N34 T;  4LF8 T;  3QUJ A;  3ZST A;  2BG9 A;  3ZMT B;  1YQ4 A;  3N2O A;  5LGU B;  3I0O A;  2Q9Q D;  4H9S E;  2BS3 A;  4EYU A;  4HFH A;  1W9R A;  5HEU A;  1HNX T;  5IYZ E;  5L3G B;  5HCM A;  1MMA A;  1KF6 A;  4YLH A;  5C3J A;  2NOX A;  2WZH A;  2ZM0 A;  3CX7 B;  1ZV4 X;  3ZC0 A;  2LSG A;  4K0K T;  1YQ3 A;  4UVB B;  4JI0 T;  4MFR A;  2ZM8 A;  1OED C;  2BKN A;  2KND A;  3T1Y T;  1X79 A;  3UT5 E;  4UIG A;  3RC3 A;  2WWV A;  3CQG B;  4KX6 A;  1IBM T;  4LF9 T;  3TLV A;  2W4X A;  3O1H A;  4JEH B;  2ODU A;  3AAI A;  4WW0 A;  2LSY A;  3P4P A;  5L4E A;  3S4U A;  3KV9 A;  3FZH B;  3AE5 A;  4BAY B;  2LM9 A;  2N9D A;  1YXR A;  3C4X A;  3AXJ A;  4DV6 T;  4HWH A;  5EZY E;  1E7P A;  5AQO B;  2VL0 A;  2E5V A;  2HN1 A;  1FMW A;  4ILB A;  2Q9Q C;  4PJM A;  5JDF A;  4ZZB A;  2DWK A;  4E7Z A;  4PJL A;  3AA7 B;  4HE8 A;  2W66 A;  5HXE A;  4ISS A;  2H88 A;  2X67 A;  5ADX L;  1QSD A;  3PU8 A;  5AQI B;  3I9W A;  2C5K T;  4U74 A;  4ZS3 A;  2Z6E A;  3T1H T;  5FY1 A;  2JMH A;  2VB6 A;  4YTM A;  4CZZ B;  1Y01 A;  3PUG A;  4ZEY A;  3MK7 C;  1ZP0 A;  3LDQ B;  3EDU A;  4LF7 T;  4TN7 B;  4MAL A;  3I9Y A;  1WFD A;  2LOS A;  3P7I A;  5E0O A;  1FMV A;  5HEG A;  5HEO A;  5FNV E;  3C50 A;  2H89 A;  5AQP B;  4EED A;  3P8C D;  3EDV A;  4ZXL A;  4HWI B;  3LK2 B;  2PFV A;  3R84 B;  4OYK A;  5FP3 A;  2LKG A;  2W61 A;  4GYR A;  5JH7 E;  5JDL A;  2VKO A;  3Q5W A;  2BBJ A;  4BJN A;  5LHH B;  1XDO A;  1XWM A;  3BQK A;  1LRZ A;  4LFA T;  4O4J E;  5FKY A;  2VQF T;  3CX8 B;  1IJ6 A;  4IE0 A;  3CVR A;  3ZJ2 A;  1J5W A;  3PTR B;  5HEJ A;  1YKE B;  5LCY A;  3IF8 B;  2MPK A;  4DID B;  4IDO A;  3U3I A;  4EOZ B;  2CE7 A;  2D2S A;  4I4T E;  4ILC A;  3WI3 A;  4J2C A;  3DJB A;  5JVD E;  4H9N C;  2XAH B;  4DBQ A;  1XMQ T;  4X20 E;  3ZMV B;  1SUM B;  2A2F X;  3NBX X;  4AI6 A;  4TWD A;  1ZEE A;  4QHO A;  4O2B E;  5AQM B;  3O4X E;  2V7L A;  3IHR A;  4B3M T;  1KNR A;  3B57 A;  2BS2 A;  1BR2 A;  2KMF A;  1XNR T;  2XHE B;  5LMU T;  4WYV A;  4CN1 A;  2K5B B;  2V7J A;  4HFB A;  4UXN B;  3FHN A;  2CWO A;  3AED A;  4JLE A;  5LJN A;  2OV9 A;  1N36 T;  4H9O C;  5AQL B;  3ZT7 A;  5M4Y A;  4EV6 A;  5CA1 E;  3C51 A;  4O4H E;  2ACZ A;  3N9L A;  3L09 A;  2CWY A;  4YJ3 E;  2XAJ B;  3X1D A;  3ONL C;  2WQY A;  3MJX A;  4DR5 T;  2M67 A;  4B3S T;  4I43 B;  4MLK A;  3HKD E;  5JR9 B;  3OTO T;  3CK6 A;  3C98 B;  4HFC A;  2V6Y B;  3RRC A;  4DV7 T;  2WWU A;  5AQK B;  3UFE A;  4G2A A;  3LBX A;  1CUN A;  3E22 E;  4CQI A;  3JAE A;  4P09 A;  3ZLI A;  1KNZ A;  3P4S A;  1VOM A;  2NW7 A;  3RYI E;  3ZPO A;  2YOE A;  4AIS A;  4XBF B;  1N32 T;  1SA0 E;  4HFV A;  5AQN B;  4OX9 T;  3SRZ A;  3TKL B;  2WAU A;  2MOZ A;  5EK2 A;  3KVB A;  5EK3 A;  4DV3 T;  4ZHQ E;  2UXX B;  1QLB A;  2IC9 A;  5HCJ A;  2BS4 A;  4HWC A;  3ZMS B;  5JR9 A;  5LG4 A;  5L47 A;  4EGW A;  2V6Y A;  5FVL A;  4K0U A;  2C5J A;  5FYM A;  2VVN A;  5FVK A;  4AXP A;  2H7O A;  3NRY A;  5FXV A;  2MBG A;  2XZE A;  4EIW A;  2J62 A;  3LFM A;  2X9Y A;  4TNV A;  2HPJ A;  5IUX A;  3ETV A;  4ILA A;  2NW9 A;  2X9H A;  1UX4 A;  4QH5 A;  1MMG A;  2V6X A;  5HXC A;  1VCT A;  3KBU A;  5KXJ A;  3UUN A;  2DWG A;  2XSB A;  4EEB A;  4GIW A;  2V8S V;  2CMR A;  3UUM A;  4DR3 T;  3UFG A;  4PK5 A;  4P0B A;  2KT9 A;  2VL8 A;  2JQH A;  2W0G A;  4DO0 A;  4IE7 A;  2X0L B;  4DR1 T;  3EVY A;  2X68 A;  3UU5 A;  5GON E;  4ZS2 A;  4DR6 T;  4XZC A;  3QC9 A;  2AXD S;  4YTP A;  4HFE A;  3N9O A;  4L0R A;  5JDM A;  2NP9 A;  1IBL T;  3H37 A;  5EK4 A;  2V5C A;  4L5G A;  3Q5X A;  4O4L E;  4JEU B;  4CXX A;  4UEM A;  3AE7 A;  2Y6X A;  1HG2 A;  2E9X B;  4Q25 A;  4GYS A;  5DQW A;  3PUS A;  3UU3 A;  2EHO D;  1E1H B;  4ADZ A;  1T7S A;  5FY7 A;  4X62 T;  1I6Z A;  1UK5 A;  3ABV A;  5AQT B;  4QH1 A;  3V5U A;  5L3E B;  1MIW A;  2NWB A;  2WMN A;  3ANW B;  2LE8 A;  4B3R T;  3Q5D A;  2OLT A;  4CI1 B;  1UCU A;  5LXT E;  1D1C A;  2CLY C;  3NZP A;  1J1J A;  5AQU B;  3UQ4 A;  2JMK A;  2YDR A;  3L3P A;  3RYC E;  1HF8 A;  5L3F B;  5C8Y E;  4DV0 T;  4WBN E;  5HYA A;  3RF1 A;  3ESL A;  3ONX A;  4KP3 C;  2CPT A;  2XY8 B;  1FIO A;  3UU8 A;  3HL6 A;  3C64 A;  2E9X A;  2XSA A;  4JBW F;  2K48 A;  3B5M A;  4IL4 A;  4ANJ A;  3FZF B;  4YHJ A;  2P9B A;  3TLU A;  5KMG P;  2RA1 A;  2EHO C;  3GA8 A;  3IEE A;  5FXX A;  4NPP A;  4HWF A;  4ZI7 E;  2QYW A;  3E08 A;  2YDQ A;  3AEF A;  3FB2 A;  3QK6 A;  4DMW A;  3BQI A;  4GK0 E;  5LNK A;  2X9W A;  3PUW F;  4EYY R;  4FI5 A;  4JV5 T;  5FL1 A;  5HEH A;  2QA7 A;  2UXD T;  2WY2 A;  3OYX A;  3LJC A;  3I1A A;  2WDV A;  1U5P A;  4HGA A;  2D0U A;  3G06 A;  2IAK A;  3MXZ A;  3CWZ B;  2XQ9 A;  3AAE B;  2WBL A;  5CB4 E;  1S94 A;  3VR8 A;  3ZCJ A;  1D1A A;  4A97 A;  4IRE A;  3VHL A;  3VU7 H;  3AEC A;  2FUP A;  2WU5 A;  3AE9 A;  2CM0 A;  1UX5 A;  1XZY A;  5J2T E;  1HS7 A;  3CX6 B;  5CGM A;  2V7M A;  2CXF A;  2A72 A;  4JYA T;  2XQ3 A;  3PUQ A;  5JDQ A;  3ZMZ B;  3IBP A;  4YSX A;  3VRB A; 
#chains in the Genus database with same CATH homology
 2XQ6 A;  2LKH A;  3UU8 A;  4HFI A;  3UU5 A;  3EHZ A;  3RHW A;  4HFH A;  2XQ4 A;  4F8H A;  3RIF A;  5HEU A;  3JAF A;  3P50 A;  4IL4 A;  2XQ5 A;  5HEG A;  3EI0 A;  4HFE A;  5HCM A;  5HEO A;  3TLU A;  1OED A;  4LML A;  2LLY A;  2BG9 C;  4X5T A;  3LSV A;  3TLW A;  5HCJ A;  4NPP A;  4HFB A;  2LKG A;  4COF A;  5L47 A;  5J0Z A;  2M6B A;  3UUB A;  1OED C;  3UU4 A;  4HFD A;  4TNW A;  5HEH A;  4LMJ A;  4Z91 A;  1OED B;  3TLV A;  3UU3 A;  4LMK A;  5LG3 A;  2BG9 E;  3P4W A;  4TNV A;  3EAM A;  4QH4 A;  5IUX A;  5L4E A;  2XQ8 A;  4ILA A;  3RQW A;  5HEJ A;  4QH5 A;  2MAW A;  2XQ9 A;  4HFC A;  4Z90 A;  4ILC A;  2LM2 A;  2VL0 A;  4QH1 A;  2YKS A;  4A97 A;  1OED E;  2XQ7 A;  3RIA A;  4ILB A;  4IRE A;  4IL9 A;  4TWF A;  2XQA A;  4ZZB A;  3UQ7 A;  3JAD A;  3RQU A;  4ZZC A;  4TWH A;  2YN6 A;  3JAE A;  3UU6 A;  3RI5 A;  5L4H A;  5CFB A;  3TLT A;  2KSR A;  2YOE A;  4TWD A;  3TLS A;  3UQ4 A;  2XQ3 A;  4A98 A;  3ZKR A;  2M6I A;  2BG9 A;  2BG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...