2LLYA

Nmr structures of the transmembrane domains of the nachr a4 subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
134
Chain Sequence
b'EELPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSSVSPSIGEYLLFTMIFVTLSIVITVFVLNVHHRSPETHTGGGGGIDRIFLWMFIIVCLLGTVGLFLPPWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit alpha-4
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 36
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2llyA01
3UUBA 3JAFA 4IL9A 5HEGA 2LLYA 4LMJA 3TLUA 2XQ6A 4LMLA 4TNVA 3RHWA 5L4HA 3EI0A 3RI5A 4ILAA 3TLVA 3RQUA 1OEDC 5L47A 2KSRA 3TLTA 2BG9E 2XQ3A 2BG9A 4TWFA 3RQWA 2YOEA 3UU3A 5HCJA 4ZZBA 4TWHA 4NPPA 3EAMA 4IREA 2M6IA 5HEUA 4TWDA 1OEDE 4HFEA 4TNWA 1OEDA 2M6BA 2XQ9A 4COFA 5HEHA 3LSVA 2YKSA 5CFBA 4QH4A 3UU5A 3UU8A 2XQ4A 3ZKRA 4A97A 4QH1A 3JADA 2VL0A 2YN6A 4X5TA 3UU4A 3UQ4A 3P4WA 5HEJA 3UU6A 3TLSA 5J0ZA 3EHZA 4HFDA 3RIFA 5HCMA 3TLWA 2BG9B 4IL4A 4ILCA 5IUXA 4HFIA 2LKHA 4ILBA 3JAEA 4F8HA 2XQ8A 3P50A 3RIAA 4HFBA 5L4EA 4Z91A 4Z90A 2LKGA 4HFCA 4HFHA 2MAWA 1OEDB 2XQ5A 5HEOA 2XQAA 4A98A 3UQ7A 2XQ7A 2LM2A 4LMKA 2BG9C 5LG3A 4ZZCA 4QH5A
chains in the Genus database with same CATH superfamily
2LLYA 4ISSA 2X0HA 3JC6D 4I4TE 5JDQA 3AA6B 3O4XE 3P4RA 3UTKA 4TN7B 2ZM2A 3IBPA 3NBXX 5L47A 4WW0A 4U2ZA 2KSRA 5DABA 4EGWA 2WDVA 5JQGE 5FL0A 3VR8A 2K24A 3IHRA 1J1JA 4IDNA 3RC3A 3SRZA 2JQHA 3EAMA 5LGTB 3V5UA 2K9AA 4P0AA 5L3EB 1NENA 4TV9E 2L9QA 1D1AA 4AKHA 3K3OA 4HFDA 5LBMA 4C90A 2BG9B 1T7SA 1WFDA 3PUGA 2W63A 3DJBA 5DQVA 5L2LA 3ZCJA 1ZP0A 2XM2A 3ZMSB 2D5UA 2PJQA 4QX8B 1NWMX 2NW8A 4QXCB 5FXXA 1Z0PA 4ASKA 4HWDA 5FYMA 2QRXA 1KK7A 3WAJA 5KMGP 4IHJE 3ZSSA 1KFYA 1WLXA 3KBTA 3F2EA 1OEDC 2FUPA 1S94A 4AIUA 1KEYA 5HAXA 2WB5A 4U31A 3ZT7A 4LF5T 2QVAA 4UVCB 1ZEEA 4UEMA 2XM1A 4ZZBA 5JDMA 3DP7A 2XQYA 3GMIA 5DQWA 1XWMA 4YHJA 5C2TA 2KLQA 4QWNB 5AQMB 4PJJA 1OEDA 4COFA 5LNKA 2UXCT 1UK5A 2DHRA 2CBIA 4OHFA 5H6RB 3P8CD 3CX6B 4PK5A 4WBNE 2YU2A 3EUHA 3PJAJ 2UU9T 2CXFA 2V7IA 4DV6T 2PFVA 1HFAA 2V5CA 5IUXA 5JRCA 2WDRA 3L09A 3QB5K 4KMCA 3NZPA 2ZMAA 2W62A 2LT3A 3OTOT 2CLYB 4NUUA 1WRDA 2XQAA 5JDNA 3HKDE 3KVBA 3Q5DA 4JBWF 4IGUA 2YDRA 2EHOD 2CXDA 3N9LA 1QLBA 2W2UA 3JAFA 5HEGA 5JREA 2FBWA 2OA5A 5JH7E 4YTPA 4UR9A 2W61A 3NRYA 3F31A 2IAKA 2J4GA 3UUXB 2XZEA 2V7JA 4X65T 1JNZA 1L0VA 2LSIA 4LFBT 1XNQT 4GKJT 4PNIA 3AE3A 4LFCT 3N2GE 4DR4T 2YOEA 4JLEA 4UVBB 2RPAA 4JI1T 4JYAT 4TWDA 3PUZF 3ZT5A 4MHCA 4EIWA 1OXZA 4DR1T 2YEVC 2BS3A 3ZMZB 4K0KT 2N1GA 1E2AA 2CCQA 3RYIE 2CMRA 2WCAA 3D0TA 3OBVE 5HXEA 5EK4A 4A56A 2B1EA 4E7SA 3CMLA 5DJQC 4ZEYA 4DMVA 3C4ZA 3ZMVB 3B5MA 5L3FB 1FIOA 3EHZA 3RKGA 4X20E 3I1AA 2MBGA 3IEEA 3RF1A 1HNWT 2WU2A 3B57A 4NXNT 4DIDB 4HFIA 4Q25A 1MIVA 2YU1A 3I0QA 1HCIA 1U5PA 3W15B 1X9BA 3QUJA 4HN9A 2Y8DA 3LK2B 5JRCB 4A98A 3E0ZA 2E9XA 4YTMA 2OV9A 5AQKB 5TAOA 1W0BA 4CZZB 4HTEA 3V5SA 3RRCA 4PFOA 5FY7A 1W09A 5F8PA 4B3RT 2WS3A 3K8PC 3E08A 3PU3A 3NKZA 2V8SV 3HKCE 4YJ3E 2BKPA 1SA0E 2BS2A 5JR9C 4PK6A 5HEUA 5LXTE 4JI8T 1WCRA 2H3RA 4JI0T 4HKAA 2IDOB 2YKSA 3PUAA 3ZJ1A 2XQ4A 1UX4A 2XPKA 2D0TA 1J5WA 5GONE 5ABFA 3O9XA 3O1JA 3C4WA 3CK6A 3AE2A 3KV4A 2VQET 4DO0A 4NIQA 4AQGA 4PJMA 2X68A 2MYSA 1HNZT 5ABGA 4YSXA 1MNDA 3N9MA 3ANWB 2E5VA 3Q5WA 4EZHA 3C51A 3CKDA 4GK0E 3MKDA 4IE4A 2P9BA 5FNVE 1QSDA 3VR9A 4LF7T 2IMLA 4U33A 3KBUA 2CWYA 2BVMA 2M67A 3UUBA 3OYXA 4IL9A 3JC6C 1D1CA 4MLKA 4UXNB 3I9YA 2IC9A 5AQPB 4JI5T 1JNRA 3TLVA 2V7KA 2ZLYA 3U3IA 4QXBB 4IE7A 4MFRA 5LHGB 2NP9A 2LHRA 4LF8T 2V1DB 4IDQA 3K3NA 1HX1B 2VKDA 2XTLA 4CXYA 4UELA 5CGMA 3VHLA 5JDFA 2D0UA 4F6RC 3BQLA 2FJBA 4ZHQE 3M3ZB 3TKLB 3LSVA 1HX8A 2BVLA 5AQLB 2NR4A 3ZPOA 2WP9A 3H3AA 3UU4A 3UT5E 2BKNA 4OYKA 1IBLT 1LVFA 4AXPA 3HR0A 2LHNA 1S35A 1XDPA 4DUYT 5L3CB 1B7TA 4LF6T 3QB5A 2BKOA 4OFZA 3PU8A 2LSGA 1VCTA 3RX6A 4YT0A 1YD8G 3F57A 3PUSA 5HXRA 5LG3A 3AE4A 1CUNA 3N2KE 3FBLA 1KNZA 4H9OC 5AQUB 2CXLA 1SHZC 4ANJA 3ZC0A 2XUEA 4JI2T 2W0GA 2QGSA 3LBXA 3SOLA 1LVKA 3RH3A 5J1GA 3ZCIA 4AQFA 3SWHA 4MBQA 5AQGB 1HNXT 2MPKA 4N78D 2KXPB 4ZI3D 5CA1E 2M6BA 3O1IA 4CN6A 4H9SE 4X1IE 4QH4A 4BAYB 3PDYA 3AEBA 2CHOA 4U2YA 4A97A 1Z8UA 4DBRA 4YHHT 1OWAA 5BMVE 5E0OA 4QHOA 3TLSA 5JDHA 2HN2A 3UFEA 5ETWA 1MMDA 3NWIA 2CWOA 3Q9DA 2J62A 3RIAA 2DLRA 4K0UA 2XAFB 5AQTB 2Z6EA 1US7B 2MAWA 3PTRB 1CHUA 3KDSE 1BR4A 5FP3A 1FMVA 2EHOC 4P0BA 3IA3A 4LMLA 3ZYKA 4GIWA 3PV0F 5L4HA 3EI0A 1IJ6A 4X62T 4DUZT 4LF9T 2XASB 5FVLA 4J2CA 3HI2A 3TLTA 4ZS3A 5JDLA 1LKXA 4IT4A 4YTNA 2JQKA 4OK0A 3VKHA 4HWCA 5LMUT 2LOPA 2KNDA 3A5XA 4NPPA 2Q9QB 3A7MA 3LBXB 5ABEA 3RC8A 2B76A 2CHNA 4H9NC 4YLHA 5LJNA 1VOMA 3CIRA 4UF0A 2HHHT 4LFAT 2FJAA 2XAGB 4V1Av 5LCYA 4ZI2D 3EDUA 4ZI7E 1FJGT 3M65A 3N9QA 3RIFA 2A9UA 4IL4A 3AE1A 2DNXA 3RKOA 3ZEFB 3Q5XA 1WYCA 4EB6E 4U72A 4YSYA 2IW5B 2KT9A 4KP3C 2J47A 3HKBE 4DV5T 4HFCA 2V7LA 2PTFA 3VKGA 1XMOT 2K48A 4DV0T 3N9NA 4WYVA 3AE8A 3A8YC 2ES0A 2YK0A 2NW7A 4ILAA 4E7ZA 1R8IA 2E2AA 4WZXA 2XSAA 3MZKB 1SUMB 3AVRA 3K3QC 2C0SA 5ABHA 2I59A 2X51A 4OYJA 4EOZB 3UUNA 3CVRA 4CQIA 1GQEA 2XHEB 3H37A 3SS1A 2FJEA 2W4XA 4HWHA 2X0YA 4H63H 2LSKA 2G0UA 3N9OA 4O2BE 2FJDA 3O1HA 1HS7A 4AKLA 3QC9A 4CI1B 2WZIA 4BA9A 1U4QA 3ZMUB 3KV5A 3EABA 4CXWA 4UF0B 4U74A 2Y6XA 2RA1A 4HEAA 4ERRA 4GK5E 3S4UA 4I0UA 1KNRA 4Z90A 5LGNB 1OEDB 2D2SA 2DWGA 2XQ5A 4G2AA 1UGOA 3ONLC 2JQQA 4LMKA 5J2UE 1D0XA 4JEUB 5KX5E 1IJ5A 1ZKEA 2WY2A 3OVUA 3ZLIA 5IHYA 2W66A 3P4PA 2JIWA 2BG9E 3SFEA 3ZYLA 1M7KA 5LG4A 1YKEB 4O4LE 3KFWX 2W67A 1M62A 5CB4E 4YFSA 3RPUA 4CN4A 1W9RA 4WNKA 4P1NA 2XQ9A 2X0LB 4Z8XA 4IDPA 5CFBA 3T1YT 1DU2A 4JI7T 2K5BB 3ZKRA 4B3TT 5AQSB 4X5TA 1IAPA 4X1KE 4AKGA 2VQFT 1I94T 1NEKA 5AQHB 5FXZA 3BQIA 2CEAA 2V26A 4KUMB 2CBJA 4KBMB 5JDGA 2CM0A 2VKHA 4A5XA 4GYSA 1YW0A 2RP4A 5JVDE 5C3JA 3P7IA 2WU5A 2PBIA 4HFVA 1Y64B 4TX5A 5JR9A 2LKGA 2AE9A 2I6HA 4QXHB 4O4HE 2WMNA 3FXEB 4JUYA 3UQ7A 2XQ7A 2LSYA 1EZ3A 3N2OA 1W0AA 1HF8A 3RHWA 5H6QB 5AQIB 3EDVA 1N36T 3H3MA 3RQUA 5HYAA 3EVYA 4DR2T 1ZOYA 2WSSV 3Q5EA 3I0OA 2HH7A 3UU3A 3IF8B 3ZMTB 4EZ4A 2IC6A 2H7OA 4ZI3C 4PFPA 3CPZA 4AKIA 2E9XB 2HPJA 2E9XD 4TUYE 3UU8A 2BS4A 3L39A 4XBFB 3ONXA 2NOXA 2CE7A 4U7YA 1IZNB 3FZFB 4PK4A 4P09A 1NAFA 1HG2A 5LP6E 1XNRT 4X1YE 3AB3B 3ESLA 2CA5A 3ZN0B 1G8XA 3NZQA 5AFUL 4L0RA 3AA7B 1BR0A 4ADZA 3T8OA 4L5GA 3J9X1 5HEOA 5LGUB 3P4SA 4DNDA 5KDMC 2X9HA 1UUSA 2BG9C 5ABFB 3LK3B 2D9DA 2X9WA 5AQFB 4X64T 2A3DA 4QKNA 2WM9A 2ZM0A 3WI3A 4CN1A 1Y01A 3QK6A 4TV8E 4QX7B 2WBLA 4C91A 5KXJA 3FZKB 4UV8B 2MOZA 2L3LA 5LA6E 5LMNT 2XQ3A 2BG9A 4XZCA 4I43B 4HWIB 4IDOA 3RYFE 4GYRA 2UXNB 4WBOA 2R6GF 4YXDA 3AE7A 5FXWA 2XJ7A 3AA1B 4TWHA 3RGLA 4IREA 4EV6A 2WQYA 3BK9A 1I6ZA 3AEGA 2UUCT 5IWAT 2V6XA 3P4WA 4ZI2C 1MMGA 2ODVA 4ZOLE 3PE0A 5ADXL 2VKOA 4FI5A 2H88A 3T1HT 4AI6A 4DR7T 2IIUA 3C50A 5FVKA 5A1LA 4GKKT 3MACA 3E22E 2X9XA 4PJNA 3AE9A 1T98A 4O2AE 3I9WA 2VVSA 2BDEA 5AQQB 3LG7A 3PURA 3FXDB 4DV2T 2KMFA 3AEDA 1MMAA 5JTGA 3KV9A 3RLFF 2E5LT 2YINA 4TNVA 1SE7A 1N33T 4AKRB 1ZV4X 3RI5A 2VKJA 2CLYC 2LM9A 5BR8T 3L3PA 4DV7T 2N2NA 3QNUA 4IDZA 3MJXA 2KWIB 5LHHB 3HKEE 4DV4T 3P4QA 2HN1A 2C5IT 4H63V 2W00A 3RIUC 2V6YA 1N32T 2KINB 2SPCA 3AEEA 1J5ET 3VU7H 2EHOA 1KNPA 4QH1A 3J7Yq 2KZ7B 3PJAA 4O8SA 4U3CA 3UQ4A 3X1DA 5HEJA 5HWXA 3FZHB 2PG8A 4PAGA 3RIUA 2JMKA 3OJAA 3ONJA 2JMHA 3C4XA 2NW9A 2BZBA 2Q9QD 1MMNA 3GN5A 1WR0A 1XDOA 4HGAA 2WWVA 1VCSA 2XAJB 4LF4T 4KHZF 3ABVA 1D0ZA 4IE6A 5HXCA 4BJMA 3LFMA 3R6NA 5LBQB 2WZHA 2ODUA 4QH5A 4NXMT 4H9QC 2WDQA 4LMJA 4FJOA 4UV9B 1G73A 2XAQB 5M4YA 4JI3T 5L3DB 4CI2B 3C98B 2GK9A 2Y48B 4GOUA 4MALA 4KX6A 3ZJ2A 2WAUA 4TWFA 3ETVA 5CJ5A 1T8BA 5LJMA 1YKHB 4O4JE 5HCJA 3ZYMA 4EYYR 3OYZA 4HFEA 4TNWA 3RRWA 5C8YE 3KINB 4H9RC 1VRBA 3WAKA 1HTJF 2C5KT 2VURA 2VL8A 3KVAA 2JJ9A 3RYHE 2V6YB 3OKQA 2K3WA 3NVOA 1E1HB 1BR1A 3TLWA 1IBMT 2EHOB 3JCFA 1IBKT 3HA4A 3CQGB 3Q2MA 5L3GB 4CI3B 2J1DG 3JAEA 4F8HA 3CQXC 3P50A 2YDSA 4HE8A 4PJLA 4JI6T 5L4EA 3UUMA 4EYUA 4DV1T 2VASA 3KV6A 3C64A 5F5WA 3GWHA 2AXDS 1AJ3A 2UXXB 4DR3T 3CQCB 2E8IA 3GN5B 4HWFA 2LEHA 2LM2A 4X66T 4L9IA 2XSBA 1WR6A 4PW8A 3FHNA 4U7IA 3MK7C 4YY3T 4TZ4C 3TLUA 4G63A 2XQ6A 4YSZA 2H7VC 2UXBT 4UIGA 3L8RA 5HXSA 3ZC1A 5L3BB 5CA0E 1FEWA 5F3JA 5AQJB 2V5DA 3FZLB 3G06A 2CRBA 2DI4A 2LRKA 3GA8A 4KI0F 2QA7A 3FB2A 4NUVA 2ACZA 5HWYA 3ANWA 4BJNA 4AQYT 2A2FX 4OX9T 2F4VT 1LRZA 2H89A 5HEHA 2E9XC 5FL1A 1D0YA 5LHIB 2VL0A 4IIJE 2JQ9A 2VK9A 3UU6A 3CX8B 2LOSA 3UFGA 3MA9A 5J0ZA 2ZM8A 4H9PC 3PUYF 4JI4T 2LRLA 1V9DA 5HCMA 2VB6A 3FBZA 3N9PA 2IUBA 1FMWA 4M1PA 5FY1A 3AAIA 2XQ8A 3CWZB 4B3ST 4IE5A 4EAHA 3AEFA 2UUBT 4B3MT 4I50E 2JPFA 3N5LA 5FY0A 3PUVF 1BR2A 3LK42 3ZT6A 1XMQT 2VVNA 4ZZCA 2YDQA 3UULA 3PUQA 3PUXF 3VRBA 2C5JA 1MIWA 5EZYE 3LDQB 4DVDA 2X67A 1UURA 1D1BA 2BBHA 3VRAA 4AISA 1X79A 2DCFA 4B6XA 3ZSTA 1T72A 2V7MA 1ZHCA 4IE0A 4ZS2A 3FZMB 3RYCE 5IYZE 3LJCA 3UU5A 1UCUA 3CX7B 2UUAT 3JADA 2A72A 2X9YA 4YJ2E 5AQNB 2ACXA 1O3XA 1XZYA 2DL1A 2VWAA 3U78A 3AXJA 1N34T 2LKHA 3ETUA 3MXZA 4ILBA 5LYJE 1MIYA 1YQ4A 1YXRA 4HFHA 3AECA 2OLTA 2LE8A 5AQRB 2XY8B 2X66A 4JEHB 2DWKA 2HPLA 2BBJA 5AQVB 1KF6A 2ZM6T 1QUUA 2CPTA 3QOFA 3DTOA 4I55E 4ZXLA 4KHPT 3OPCA 2NTYA 3AVSA 1E7PA 4EEDA 3AA0B 3RQWA 3ZN1B 2MTQA 4ISTA 5FKYA 4JV5T 2WWUA 5JR9B 2LSJA 5FXVA 5LOVE 3B13A 2M6IA 5J2TE 2XAHB 1OEDE 2UXDT 4CXXA 5LB7B 4DV3T 5EK3A 1YQ3A 2JRKA 4EXTA 2N9DA 3R84B 1HR0T 4EEBA 2YN6A 3AE5A 3AAAB 4DR5T 4XAXB 1WYBA 2WMOA 2Q9QC 1HG5A 1MNEA 2KWHA 2QYWA 5FMNA 3AE6A 2NTXA 3K1SA 4ILCA 1H7CA 3AEAA 1UX5A 4O4IE 4DBQA 4ILUA 4AQFC 2NWBA 2I0MA 3SFDA 4HFBA 2L8KA 5HXHA 4DMWA 2IHR1 3AAEB 5EK2A 4Z91A 3PUWF 3NRXA 3AXJB 2Q9QA 3HL6A 4DR6T 4UVAB 5AQOB 2LJLA 3BQKA
chains in the Genus database with same CATH topology
3UUBA 3JAFA 4IL9A 5HEGA 2LLYA 4LMJA 3TLUA 2XQ6A 4LMLA 4TNVA 3RHWA 5L4HA 3EI0A 3RI5A 4ILAA 3TLVA 3RQUA 1OEDC 5L47A 2KSRA 3TLTA 2BG9E 2XQ3A 2BG9A 4TWFA 3RQWA 2YOEA 3UU3A 5HCJA 4ZZBA 4TWHA 4NPPA 3EAMA 4IREA 2M6IA 5HEUA 4TWDA 1OEDE 4HFEA 4TNWA 1OEDA 2M6BA 2XQ9A 4COFA 5HEHA 3LSVA 2YKSA 5CFBA 4QH4A 3UU5A 3UU8A 2XQ4A 3ZKRA 4A97A 4QH1A 3JADA 2VL0A 2YN6A 4X5TA 3UU4A 3UQ4A 3P4WA 5HEJA 3UU6A 3TLSA 5J0ZA 3EHZA 4HFDA 3RIFA 5HCMA 3TLWA 2BG9B 4IL4A 4ILCA 5IUXA 4HFIA 2LKHA 4ILBA 3JAEA 4F8HA 2XQ8A 3P50A 3RIAA 4HFBA 5L4EA 4Z91A 4Z90A 2LKGA 4HFCA 4HFHA 2MAWA 1OEDB 2XQ5A 5HEOA 2XQAA 4A98A 3UQ7A 2XQ7A 2LM2A 4LMKA 2BG9C 5LG3A 4ZZCA 4QH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUB A;  3JAF A;  4IL9 A;  5HEG A;  2LLY A;  4LMJ A;  3TLU A;  2XQ6 A;  4LML A;  4TNV A;  3RHW A;  5L4H A;  3EI0 A;  3RI5 A;  4ILA A;  3TLV A;  3RQU A;  1OED C;  5L47 A;  2KSR A;  3TLT A;  2BG9 E;  2XQ3 A;  2BG9 A;  4TWF A;  3RQW A;  2YOE A;  3UU3 A;  5HCJ A;  4ZZB A;  4TWH A;  4NPP A;  3EAM A;  4IRE A;  2M6I A;  5HEU A;  4TWD A;  1OED E;  4HFE A;  4TNW A;  1OED A;  2M6B A;  2XQ9 A;  4COF A;  5HEH A;  3LSV A;  2YKS A;  5CFB A;  4QH4 A;  3UU5 A;  3UU8 A;  2XQ4 A;  3ZKR A;  4A97 A;  4QH1 A;  3JAD A;  2VL0 A;  2YN6 A;  4X5T A;  3UU4 A;  3UQ4 A;  3P4W A;  5HEJ A;  3UU6 A;  3TLS A;  5J0Z A;  3EHZ A;  4HFD A;  3RIF A;  5HCM A;  3TLW A;  2BG9 B;  4IL4 A;  4ILC A;  5IUX A;  4HFI A;  2LKH A;  4ILB A;  3JAE A;  4F8H A;  2XQ8 A;  3P50 A;  3RIA A;  4HFB A;  5L4E A;  4Z91 A;  4Z90 A;  2LKG A;  4HFC A;  4HFH A;  2MAW A;  1OED B;  2XQ5 A;  5HEO A;  2XQA A;  4A98 A;  3UQ7 A;  2XQ7 A;  2LM2 A;  4LMK A;  2BG9 C;  5LG3 A;  4ZZC A;  4QH5 A; 
#chains in the Genus database with same CATH topology
 2LLY A;  4ISS A;  2X0H A;  3JC6 D;  4I4T E;  5JDQ A;  3AA6 B;  3O4X E;  3P4R A;  3UTK A;  4TN7 B;  2ZM2 A;  3IBP A;  3NBX X;  5L47 A;  4WW0 A;  4U2Z A;  2KSR A;  5DAB A;  4EGW A;  2WDV A;  5JQG E;  5FL0 A;  3VR8 A;  2K24 A;  3IHR A;  1J1J A;  4IDN A;  3RC3 A;  3SRZ A;  2JQH A;  3EAM A;  5LGT B;  3V5U A;  2K9A A;  4P0A A;  5L3E B;  1NEN A;  4TV9 E;  2L9Q A;  1D1A A;  4AKH A;  3K3O A;  4HFD A;  5LBM A;  4C90 A;  2BG9 B;  1T7S A;  1WFD A;  3PUG A;  2W63 A;  3DJB A;  5DQV A;  5L2L A;  3ZCJ A;  1ZP0 A;  2XM2 A;  3ZMS B;  2D5U A;  2PJQ A;  4QX8 B;  1NWM X;  2NW8 A;  4QXC B;  5FXX A;  1Z0P A;  4ASK A;  4HWD A;  5FYM A;  2QRX A;  1KK7 A;  3WAJ A;  5KMG P;  4IHJ E;  3ZSS A;  1KFY A;  1WLX A;  3KBT A;  3F2E A;  1OED C;  2FUP A;  1S94 A;  4AIU A;  1KEY A;  5HAX A;  2WB5 A;  4U31 A;  3ZT7 A;  4LF5 T;  2QVA A;  4UVC B;  1ZEE A;  4UEM A;  2XM1 A;  4ZZB A;  5JDM A;  3DP7 A;  2XQY A;  3GMI A;  5DQW A;  1XWM A;  4YHJ A;  5C2T A;  2KLQ A;  4QWN B;  5AQM B;  4PJJ A;  1OED A;  4COF A;  5LNK A;  2UXC T;  1UK5 A;  2DHR A;  2CBI A;  4OHF A;  5H6R B;  3P8C D;  3CX6 B;  4PK5 A;  4WBN E;  2YU2 A;  3EUH A;  3PJA J;  2UU9 T;  2CXF A;  2V7I A;  4DV6 T;  2PFV A;  1HFA A;  2V5C A;  5IUX A;  5JRC A;  2WDR A;  3L09 A;  3QB5 K;  4KMC A;  3NZP A;  2ZMA A;  2W62 A;  2LT3 A;  3OTO T;  2CLY B;  4NUU A;  1WRD A;  2XQA A;  5JDN A;  3HKD E;  3KVB A;  3Q5D A;  4JBW F;  4IGU A;  2YDR A;  2EHO D;  2CXD A;  3N9L A;  1QLB A;  2W2U A;  3JAF A;  5HEG A;  5JRE A;  2FBW A;  2OA5 A;  5JH7 E;  4YTP A;  4UR9 A;  2W61 A;  3NRY A;  3F31 A;  2IAK A;  2J4G A;  3UUX B;  2XZE A;  2V7J A;  4X65 T;  1JNZ A;  1L0V A;  2LSI A;  4LFB T;  1XNQ T;  4GKJ T;  4PNI A;  3AE3 A;  4LFC T;  3N2G E;  4DR4 T;  2YOE A;  4JLE A;  4UVB B;  2RPA A;  4JI1 T;  4JYA T;  4TWD A;  3PUZ F;  3ZT5 A;  4MHC A;  4EIW A;  1OXZ A;  4DR1 T;  2YEV C;  2BS3 A;  3ZMZ B;  4K0K T;  2N1G A;  1E2A A;  2CCQ A;  3RYI E;  2CMR A;  2WCA A;  3D0T A;  3OBV E;  5HXE A;  5EK4 A;  4A56 A;  2B1E A;  4E7S A;  3CML A;  5DJQ C;  4ZEY A;  4DMV A;  3C4Z A;  3ZMV B;  3B5M A;  5L3F B;  1FIO A;  3EHZ A;  3RKG A;  4X20 E;  3I1A A;  2MBG A;  3IEE A;  3RF1 A;  1HNW T;  2WU2 A;  3B57 A;  4NXN T;  4DID B;  4HFI A;  4Q25 A;  1MIV A;  2YU1 A;  3I0Q A;  1HCI A;  1U5P A;  3W15 B;  1X9B A;  3QUJ A;  4HN9 A;  2Y8D A;  3LK2 B;  5JRC B;  4A98 A;  3E0Z A;  2E9X A;  4YTM A;  2OV9 A;  5AQK B;  5TAO A;  1W0B A;  4CZZ B;  4HTE A;  3V5S A;  3RRC A;  4PFO A;  5FY7 A;  1W09 A;  5F8P A;  4B3R T;  2WS3 A;  3K8P C;  3E08 A;  3PU3 A;  3NKZ A;  2V8S V;  3HKC E;  4YJ3 E;  2BKP A;  1SA0 E;  2BS2 A;  5JR9 C;  4PK6 A;  5HEU A;  5LXT E;  4JI8 T;  1WCR A;  2H3R A;  4JI0 T;  4HKA A;  2IDO B;  2YKS A;  3PUA A;  3ZJ1 A;  2XQ4 A;  1UX4 A;  2XPK A;  2D0T A;  1J5W A;  5GON E;  5ABF A;  3O9X A;  3O1J A;  3C4W A;  3CK6 A;  3AE2 A;  3KV4 A;  2VQE T;  4DO0 A;  4NIQ A;  4AQG A;  4PJM A;  2X68 A;  2MYS A;  1HNZ T;  5ABG A;  4YSX A;  1MND A;  3N9M A;  3ANW B;  2E5V A;  3Q5W A;  4EZH A;  3C51 A;  3CKD A;  4GK0 E;  3MKD A;  4IE4 A;  2P9B A;  5FNV E;  1QSD A;  3VR9 A;  4LF7 T;  2IML A;  4U33 A;  3KBU A;  2CWY A;  2BVM A;  2M67 A;  3UUB A;  3OYX A;  4IL9 A;  3JC6 C;  1D1C A;  4MLK A;  4UXN B;  3I9Y A;  2IC9 A;  5AQP B;  4JI5 T;  1JNR A;  3TLV A;  2V7K A;  2ZLY A;  3U3I A;  4QXB B;  4IE7 A;  4MFR A;  5LHG B;  2NP9 A;  2LHR A;  4LF8 T;  2V1D B;  4IDQ A;  3K3N A;  1HX1 B;  2VKD A;  2XTL A;  4CXY A;  4UEL A;  5CGM A;  3VHL A;  5JDF A;  2D0U A;  4F6R C;  3BQL A;  2FJB A;  4ZHQ E;  3M3Z B;  3TKL B;  3LSV A;  1HX8 A;  2BVL A;  5AQL B;  2NR4 A;  3ZPO A;  2WP9 A;  3H3A A;  3UU4 A;  3UT5 E;  2BKN A;  4OYK A;  1IBL T;  1LVF A;  4AXP A;  3HR0 A;  2LHN A;  1S35 A;  1XDP A;  4DUY T;  5L3C B;  1B7T A;  4LF6 T;  3QB5 A;  2BKO A;  4OFZ A;  3PU8 A;  2LSG A;  1VCT A;  3RX6 A;  4YT0 A;  1YD8 G;  3F57 A;  3PUS A;  5HXR A;  5LG3 A;  3AE4 A;  1CUN A;  3N2K E;  3FBL A;  1KNZ A;  4H9O C;  5AQU B;  2CXL A;  1SHZ C;  4ANJ A;  3ZC0 A;  2XUE A;  4JI2 T;  2W0G A;  2QGS A;  3LBX A;  3SOL A;  1LVK A;  3RH3 A;  5J1G A;  3ZCI A;  4AQF A;  3SWH A;  4MBQ A;  5AQG B;  1HNX T;  2MPK A;  4N78 D;  2KXP B;  4ZI3 D;  5CA1 E;  2M6B A;  3O1I A;  4CN6 A;  4H9S E;  4X1I E;  4QH4 A;  4BAY B;  3PDY A;  3AEB A;  2CHO A;  4U2Y A;  4A97 A;  1Z8U A;  4DBR A;  4YHH T;  1OWA A;  5BMV E;  5E0O A;  4QHO A;  3TLS A;  5JDH A;  2HN2 A;  3UFE A;  5ETW A;  1MMD A;  3NWI A;  2CWO A;  3Q9D A;  2J62 A;  3RIA A;  2DLR A;  4K0U A;  2XAF B;  5AQT B;  2Z6E A;  1US7 B;  2MAW A;  3PTR B;  1CHU A;  3KDS E;  1BR4 A;  5FP3 A;  1FMV A;  2EHO C;  4P0B A;  3IA3 A;  4LML A;  3ZYK A;  4GIW A;  3PV0 F;  5L4H A;  3EI0 A;  1IJ6 A;  4X62 T;  4DUZ T;  4LF9 T;  2XAS B;  5FVL A;  4J2C A;  3HI2 A;  3TLT A;  4ZS3 A;  5JDL A;  1LKX A;  4IT4 A;  4YTN A;  2JQK A;  4OK0 A;  3VKH A;  4HWC A;  5LMU T;  2LOP A;  2KND A;  3A5X A;  4NPP A;  2Q9Q B;  3A7M A;  3LBX B;  5ABE A;  3RC8 A;  2B76 A;  2CHN A;  4H9N C;  4YLH A;  5LJN A;  1VOM A;  3CIR A;  4UF0 A;  2HHH T;  4LFA T;  2FJA A;  2XAG B;  4V1A v;  5LCY A;  4ZI2 D;  3EDU A;  4ZI7 E;  1FJG T;  3M65 A;  3N9Q A;  3RIF A;  2A9U A;  4IL4 A;  3AE1 A;  2DNX A;  3RKO A;  3ZEF B;  3Q5X A;  1WYC A;  4EB6 E;  4U72 A;  4YSY A;  2IW5 B;  2KT9 A;  4KP3 C;  2J47 A;  3HKB E;  4DV5 T;  4HFC A;  2V7L A;  2PTF A;  3VKG A;  1XMO T;  2K48 A;  4DV0 T;  3N9N A;  4WYV A;  3AE8 A;  3A8Y C;  2ES0 A;  2YK0 A;  2NW7 A;  4ILA A;  4E7Z A;  1R8I A;  2E2A A;  4WZX A;  2XSA A;  3MZK B;  1SUM B;  3AVR A;  3K3Q C;  2C0S A;  5ABH A;  2I59 A;  2X51 A;  4OYJ A;  4EOZ B;  3UUN A;  3CVR A;  4CQI A;  1GQE A;  2XHE B;  3H37 A;  3SS1 A;  2FJE A;  2W4X A;  4HWH A;  2X0Y A;  4H63 H;  2LSK A;  2G0U A;  3N9O A;  4O2B E;  2FJD A;  3O1H A;  1HS7 A;  4AKL A;  3QC9 A;  4CI1 B;  2WZI A;  4BA9 A;  1U4Q A;  3ZMU B;  3KV5 A;  3EAB A;  4CXW A;  4UF0 B;  4U74 A;  2Y6X A;  2RA1 A;  4HEA A;  4ERR A;  4GK5 E;  3S4U A;  4I0U A;  1KNR A;  4Z90 A;  5LGN B;  1OED B;  2D2S A;  2DWG A;  2XQ5 A;  4G2A A;  1UGO A;  3ONL C;  2JQQ A;  4LMK A;  5J2U E;  1D0X A;  4JEU B;  5KX5 E;  1IJ5 A;  1ZKE A;  2WY2 A;  3OVU A;  3ZLI A;  5IHY A;  2W66 A;  3P4P A;  2JIW A;  2BG9 E;  3SFE A;  3ZYL A;  1M7K A;  5LG4 A;  1YKE B;  4O4L E;  3KFW X;  2W67 A;  1M62 A;  5CB4 E;  4YFS A;  3RPU A;  4CN4 A;  1W9R A;  4WNK A;  4P1N A;  2XQ9 A;  2X0L B;  4Z8X A;  4IDP A;  5CFB A;  3T1Y T;  1DU2 A;  4JI7 T;  2K5B B;  3ZKR A;  4B3T T;  5AQS B;  4X5T A;  1IAP A;  4X1K E;  4AKG A;  2VQF T;  1I94 T;  1NEK A;  5AQH B;  5FXZ A;  3BQI A;  2CEA A;  2V26 A;  4KUM B;  2CBJ A;  4KBM B;  5JDG A;  2CM0 A;  2VKH A;  4A5X A;  4GYS A;  1YW0 A;  2RP4 A;  5JVD E;  5C3J A;  3P7I A;  2WU5 A;  2PBI A;  4HFV A;  1Y64 B;  4TX5 A;  5JR9 A;  2LKG A;  2AE9 A;  2I6H A;  4QXH B;  4O4H E;  2WMN A;  3FXE B;  4JUY A;  3UQ7 A;  2XQ7 A;  2LSY A;  1EZ3 A;  3N2O A;  1W0A A;  1HF8 A;  3RHW A;  5H6Q B;  5AQI B;  3EDV A;  1N36 T;  3H3M A;  3RQU A;  5HYA A;  3EVY A;  4DR2 T;  1ZOY A;  2WSS V;  3Q5E A;  3I0O A;  2HH7 A;  3UU3 A;  3IF8 B;  3ZMT B;  4EZ4 A;  2IC6 A;  2H7O A;  4ZI3 C;  4PFP A;  3CPZ A;  4AKI A;  2E9X B;  2HPJ A;  2E9X D;  4TUY E;  3UU8 A;  2BS4 A;  3L39 A;  4XBF B;  3ONX A;  2NOX A;  2CE7 A;  4U7Y A;  1IZN B;  3FZF B;  4PK4 A;  4P09 A;  1NAF A;  1HG2 A;  5LP6 E;  1XNR T;  4X1Y E;  3AB3 B;  3ESL A;  2CA5 A;  3ZN0 B;  1G8X A;  3NZQ A;  5AFU L;  4L0R A;  3AA7 B;  1BR0 A;  4ADZ A;  3T8O A;  4L5G A;  3J9X 1;  5HEO A;  5LGU B;  3P4S A;  4DND A;  5KDM C;  2X9H A;  1UUS A;  2BG9 C;  5ABF B;  3LK3 B;  2D9D A;  2X9W A;  5AQF B;  4X64 T;  2A3D A;  4QKN A;  2WM9 A;  2ZM0 A;  3WI3 A;  4CN1 A;  1Y01 A;  3QK6 A;  4TV8 E;  4QX7 B;  2WBL A;  4C91 A;  5KXJ A;  3FZK B;  4UV8 B;  2MOZ A;  2L3L A;  5LA6 E;  5LMN T;  2XQ3 A;  2BG9 A;  4XZC A;  4I43 B;  4HWI B;  4IDO A;  3RYF E;  4GYR A;  2UXN B;  4WBO A;  2R6G F;  4YXD A;  3AE7 A;  5FXW A;  2XJ7 A;  3AA1 B;  4TWH A;  3RGL A;  4IRE A;  4EV6 A;  2WQY A;  3BK9 A;  1I6Z A;  3AEG A;  2UUC T;  5IWA T;  2V6X A;  3P4W A;  4ZI2 C;  1MMG A;  2ODV A;  4ZOL E;  3PE0 A;  5ADX L;  2VKO A;  4FI5 A;  2H88 A;  3T1H T;  4AI6 A;  4DR7 T;  2IIU A;  3C50 A;  5FVK A;  5A1L A;  4GKK T;  3MAC A;  3E22 E;  2X9X A;  4PJN A;  3AE9 A;  1T98 A;  4O2A E;  3I9W A;  2VVS A;  2BDE A;  5AQQ B;  3LG7 A;  3PUR A;  3FXD B;  4DV2 T;  2KMF A;  3AED A;  1MMA A;  5JTG A;  3KV9 A;  3RLF F;  2E5L T;  2YIN A;  4TNV A;  1SE7 A;  1N33 T;  4AKR B;  1ZV4 X;  3RI5 A;  2VKJ A;  2CLY C;  2LM9 A;  5BR8 T;  3L3P A;  4DV7 T;  2N2N A;  3QNU A;  4IDZ A;  3MJX A;  2KWI B;  5LHH B;  3HKE E;  4DV4 T;  3P4Q A;  2HN1 A;  2C5I T;  4H63 V;  2W00 A;  3RIU C;  2V6Y A;  1N32 T;  2KIN B;  2SPC A;  3AEE A;  1J5E T;  3VU7 H;  2EHO A;  1KNP A;  4QH1 A;  3J7Y q;  2KZ7 B;  3PJA A;  4O8S A;  4U3C A;  3UQ4 A;  3X1D A;  5HEJ A;  5HWX A;  3FZH B;  2PG8 A;  4PAG A;  3RIU A;  2JMK A;  3OJA A;  3ONJ A;  2JMH A;  3C4X A;  2NW9 A;  2BZB A;  2Q9Q D;  1MMN A;  3GN5 A;  1WR0 A;  1XDO A;  4HGA A;  2WWV A;  1VCS A;  2XAJ B;  4LF4 T;  4KHZ F;  3ABV A;  1D0Z A;  4IE6 A;  5HXC A;  4BJM A;  3LFM A;  3R6N A;  5LBQ B;  2WZH A;  2ODU A;  4QH5 A;  4NXM T;  4H9Q C;  2WDQ A;  4LMJ A;  4FJO A;  4UV9 B;  1G73 A;  2XAQ B;  5M4Y A;  4JI3 T;  5L3D B;  4CI2 B;  3C98 B;  2GK9 A;  2Y48 B;  4GOU A;  4MAL A;  4KX6 A;  3ZJ2 A;  2WAU A;  4TWF A;  3ETV A;  5CJ5 A;  1T8B A;  5LJM A;  1YKH B;  4O4J E;  5HCJ A;  3ZYM A;  4EYY R;  3OYZ A;  4HFE A;  4TNW A;  3RRW A;  5C8Y E;  3KIN B;  4H9R C;  1VRB A;  3WAK A;  1HTJ F;  2C5K T;  2VUR A;  2VL8 A;  3KVA A;  2JJ9 A;  3RYH E;  2V6Y B;  3OKQ A;  2K3W A;  3NVO A;  1E1H B;  1BR1 A;  3TLW A;  1IBM T;  2EHO B;  3JCF A;  1IBK T;  3HA4 A;  3CQG B;  3Q2M A;  5L3G B;  4CI3 B;  2J1D G;  3JAE A;  4F8H A;  3CQX C;  3P50 A;  2YDS A;  4HE8 A;  4PJL A;  4JI6 T;  5L4E A;  3UUM A;  4EYU A;  4DV1 T;  2VAS A;  3KV6 A;  3C64 A;  5F5W A;  3GWH A;  2AXD S;  1AJ3 A;  2UXX B;  4DR3 T;  3CQC B;  2E8I A;  3GN5 B;  4HWF A;  2LEH A;  2LM2 A;  4X66 T;  4L9I A;  2XSB A;  1WR6 A;  4PW8 A;  3FHN A;  4U7I A;  3MK7 C;  4YY3 T;  4TZ4 C;  3TLU A;  4G63 A;  2XQ6 A;  4YSZ A;  2H7V C;  2UXB T;  4UIG A;  3L8R A;  5HXS A;  3ZC1 A;  5L3B B;  5CA0 E;  1FEW A;  5F3J A;  5AQJ B;  2V5D A;  3FZL B;  3G06 A;  2CRB A;  2DI4 A;  2LRK A;  3GA8 A;  4KI0 F;  2QA7 A;  3FB2 A;  4NUV A;  2ACZ A;  5HWY A;  3ANW A;  4BJN A;  4AQY T;  2A2F X;  4OX9 T;  2F4V T;  1LRZ A;  2H89 A;  5HEH A;  2E9X C;  5FL1 A;  1D0Y A;  5LHI B;  2VL0 A;  4IIJ E;  2JQ9 A;  2VK9 A;  3UU6 A;  3CX8 B;  2LOS A;  3UFG A;  3MA9 A;  5J0Z A;  2ZM8 A;  4H9P C;  3PUY F;  4JI4 T;  2LRL A;  1V9D A;  5HCM A;  2VB6 A;  3FBZ A;  3N9P A;  2IUB A;  1FMW A;  4M1P A;  5FY1 A;  3AAI A;  2XQ8 A;  3CWZ B;  4B3S T;  4IE5 A;  4EAH A;  3AEF A;  2UUB T;  4B3M T;  4I50 E;  2JPF A;  3N5L A;  5FY0 A;  3PUV F;  1BR2 A;  3LK4 2;  3ZT6 A;  1XMQ T;  2VVN A;  4ZZC A;  2YDQ A;  3UUL A;  3PUQ A;  3PUX F;  3VRB A;  2C5J A;  1MIW A;  5EZY E;  3LDQ B;  4DVD A;  2X67 A;  1UUR A;  1D1B A;  2BBH A;  3VRA A;  4AIS A;  1X79 A;  2DCF A;  4B6X A;  3ZST A;  1T72 A;  2V7M A;  1ZHC A;  4IE0 A;  4ZS2 A;  3FZM B;  3RYC E;  5IYZ E;  3LJC A;  3UU5 A;  1UCU A;  3CX7 B;  2UUA T;  3JAD A;  2A72 A;  2X9Y A;  4YJ2 E;  5AQN B;  2ACX A;  1O3X A;  1XZY A;  2DL1 A;  2VWA A;  3U78 A;  3AXJ A;  1N34 T;  2LKH A;  3ETU A;  3MXZ A;  4ILB A;  5LYJ E;  1MIY A;  1YQ4 A;  1YXR A;  4HFH A;  3AEC A;  2OLT A;  2LE8 A;  5AQR B;  2XY8 B;  2X66 A;  4JEH B;  2DWK A;  2HPL A;  2BBJ A;  5AQV B;  1KF6 A;  2ZM6 T;  1QUU A;  2CPT A;  3QOF A;  3DTO A;  4I55 E;  4ZXL A;  4KHP T;  3OPC A;  2NTY A;  3AVS A;  1E7P A;  4EED A;  3AA0 B;  3RQW A;  3ZN1 B;  2MTQ A;  4IST A;  5FKY A;  4JV5 T;  2WWU A;  5JR9 B;  2LSJ A;  5FXV A;  5LOV E;  3B13 A;  2M6I A;  5J2T E;  2XAH B;  1OED E;  2UXD T;  4CXX A;  5LB7 B;  4DV3 T;  5EK3 A;  1YQ3 A;  2JRK A;  4EXT A;  2N9D A;  3R84 B;  1HR0 T;  4EEB A;  2YN6 A;  3AE5 A;  3AAA B;  4DR5 T;  4XAX B;  1WYB A;  2WMO A;  2Q9Q C;  1HG5 A;  1MNE A;  2KWH A;  2QYW A;  5FMN A;  3AE6 A;  2NTX A;  3K1S A;  4ILC A;  1H7C A;  3AEA A;  1UX5 A;  4O4I E;  4DBQ A;  4ILU A;  4AQF C;  2NWB A;  2I0M A;  3SFD A;  4HFB A;  2L8K A;  5HXH A;  4DMW A;  2IHR 1;  3AAE B;  5EK2 A;  4Z91 A;  3PUW F;  3NRX A;  3AXJ B;  2Q9Q A;  3HL6 A;  4DR6 T;  4UVA B;  5AQO B;  2LJL A;  3BQK A; 
#chains in the Genus database with same CATH homology
 3UUB A;  3JAF A;  4IL9 A;  5HEG A;  2LLY A;  4LMJ A;  3TLU A;  2XQ6 A;  4LML A;  4TNV A;  3RHW A;  5L4H A;  3EI0 A;  3RI5 A;  4ILA A;  3TLV A;  3RQU A;  1OED C;  5L47 A;  2KSR A;  3TLT A;  2BG9 E;  2XQ3 A;  2BG9 A;  4TWF A;  3RQW A;  2YOE A;  3UU3 A;  5HCJ A;  4ZZB A;  4TWH A;  4NPP A;  3EAM A;  4IRE A;  2M6I A;  5HEU A;  4TWD A;  1OED E;  4HFE A;  4TNW A;  1OED A;  2M6B A;  2XQ9 A;  4COF A;  5HEH A;  3LSV A;  2YKS A;  5CFB A;  4QH4 A;  3UU5 A;  3UU8 A;  2XQ4 A;  3ZKR A;  4A97 A;  4QH1 A;  3JAD A;  2VL0 A;  2YN6 A;  4X5T A;  3UU4 A;  3UQ4 A;  3P4W A;  5HEJ A;  3UU6 A;  3TLS A;  5J0Z A;  3EHZ A;  4HFD A;  3RIF A;  5HCM A;  3TLW A;  2BG9 B;  4IL4 A;  4ILC A;  5IUX A;  4HFI A;  2LKH A;  4ILB A;  3JAE A;  4F8H A;  2XQ8 A;  3P50 A;  3RIA A;  4HFB A;  5L4E A;  4Z91 A;  4Z90 A;  2LKG A;  4HFC A;  4HFH A;  2MAW A;  1OED B;  2XQ5 A;  5HEO A;  2XQA A;  4A98 A;  3UQ7 A;  2XQ7 A;  2LM2 A;  4LMK A;  2BG9 C;  5LG3 A;  4ZZC A;  4QH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...