2LM2A

Nmr structures of the transmembrane domains of the achr b2 subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NAEEEPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSSDSPSVGEYLMFTMVLVTFSIVTSVCVLNVHHRSPETHTGGGGGIDRLFLWIFVFVCVFGTIGMFLQPLFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit beta-2
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2lm2A01
1OEDB 2BG9A 4ILAA 3P50A 5CFBA 4HFBA 3P4WA 4COFA 4TWDA 4QH4A 2LM2A 3JAEA 2YKSA 2M6IA 4ZZBA 3UQ4A 1OEDC 2MAWA 3UU8A 5J0ZA 4QH1A 3JADA 2YOEA 4A98A 3UU5A 2BG9B 5LG3A 4Z90A 3EI0A 5HEGA 3TLVA 3RQWA 5HCMA 4IREA 4LMLA 3TLUA 2XQ4A 2BG9E 2LKGA 2XQAA 1OEDE 3TLTA 2VL0A 4LMJA 3UU3A 5HEOA 2LKHA 2BG9C 2XQ6A 4LMKA 2KSRA 4ILCA 3RIAA 4Z91A 4IL4A 4IL9A 4F8HA 2XQ7A 2XQ8A 4TWHA 5L4EA 2YN6A 2XQ5A 3JAFA 4X5TA 2XQ3A 5L47A 3EHZA 4ILBA 3RQUA 2M6BA 2XQ9A 5HEUA 3RI5A 3UQ7A 4ZZCA 5HEJA 3EAMA 3RHWA 4HFCA 1OEDA 4TWFA 5HCJA 3UU4A 4HFIA 3TLWA 4A97A 4QH5A 2LLYA 4HFHA 4HFEA 3RIFA 4NPPA 5HEHA 3TLSA 4HFDA 4TNVA 3UUBA 3LSVA 3UU6A 4TNWA 5IUXA 3ZKRA 5L4HA
chains in the Genus database with same CATH superfamily
5JDHA 2BG9A 4C90A 5LHHB 3ZMUB 4H9QC 4TWDA 3AA7B 4H9SE 1XZYA 3N9OA 5AQIB 1I94T 5JTGA 3EDVA 1D0YA 3IHRA 4AKRB 5DQWA 2VK9A 2XQYA 1KK7A 4P0BA 4YT0A 4UXNB 4ZOLE 4E7SA 3L8RA 3AE4A 3AEDA 4U33A 3VHLA 4HTEA 3K8PC 2ZM2A 3RYFE 5L3FB 4LF4T 3CVRA 2LT3A 3ZJ2A 1MNDA 2LSGA 5JQGE 3KVAA 3ZYKA 1ZHCA 3E22E 2WDVA 2ACXA 4JI2T 2KINB 1WCRA 2XAJB 3FZLB 4B3TT 3FXDB 2Q9QC 1U5PA 1D1BA 3CIRA 5FXWA 3P7IA 3ZN0B 2CCQA 1XNQT 2A9UA 4YTPA 2LM2A 3T1HT 2ODVA 4G2AA 5BMVE 2MAWA 1XDOA 3PUZF 3JADA 2NR4A 3L09A 3F57A 4UIGA 1IZNB 2JMHA 1VOMA 3TLUA 3AEAA 2LKGA 2XQAA 4PFPA 3GMIA 1HR0T 1J5ET 3TLTA 3GN5A 4YSZA 1O3XA 4JI0T 5C3JA 2XTLA 3C98B 2CHOA 3RIAA 4JI3T 4BJNA 4B3MT 3JC6D 2XAQB 1NWMX 2KWIB 5L3EB 3K3NA 4LFCT 2IC9A 2UXXB 4U7YA 4IDZA 1XWMA 5H6RB 5LJNA 1FMWA 4EV6A 4IIJE 2V26A 4OHFA 1N32T 2LSIA 4BA9A 2C5IT 4HFDA 2WWUA 3UUBA 2UXCT 1LKXA 4DR3T 4TNWA 3KDSE 3PU8A 2IUBA 5AFUL 2W63A 1UK5A 2WSSV 3ZYMA 4JI8T 2F4VT 4AKLA 2KMFA 2V7JA 4HFBA 2WWVA 4AQYT 5FP3A 2VQET 3RKOA 2YKSA 5AQGB 5LBMA 1X9BA 5M4YA 1Z0PA 4P1NA 2YOEA 5LYJE 3J7Yq 4JI7T 3EI0A 5AQTB 3WAJA 4ZI3C 2L3LA 2CEAA 3AAAB 2VKOA 4HWCA 3K3QC 3Q5WA 3IEEA 2IW5B 3RIUC 2XY8B 2YDQA 2KSRA 3FB2A 3Q5EA 4IL4A 5HXHA 3DP7A 4KHPT 1FJGT 2CBJA 3CKDA 3IF8B 2R6GF 4EEDA 2BVLA 1W0AA 2N1GA 3KINB 2W67A 1IAPA 2V7KA 5DQVA 2CXDA 3RQUA 4DUZT 4X1KE 3RRCA 5KDMC 3KV9A 4ZEYA 2P9BA 2H7OA 4LF6T 1QLBA 1VCTA 4DV2T 5FL0A 4XAXB 2VURA 1M62A 2VKJA 2E9XC 3N9LA 4YJ2E 2HPJA 2XZEA 2LRKA 5IYZE 4EZHA 3LBXB 4X64T 2V7IA 3VKGA 3OVUA 3PUSA 3ZLIA 4OX9T 3PUXF 4KBMB 4COFA 3AEGA 3UU8A 3FZKB 4DMWA 5JR9A 4HE8A 4CXYA 3N9QA 3AEFA 1EZ3A 3EVYA 2IIUA 1XMQT 4QWNB 5CB4E 5ABFB 2W0GA 3KBUA 1CHUA 2LM9A 4C91A 3N2OA 2Y48B 4QX7B 5FXZA 4K0KT 4IL9A 2MOZA 3B13A 2XQ8A 2BBJA 2PFVA 2XHEB 3IBPA 3ZT7A 5HXCA 5HXSA 3MKDA 4PK5A 3UFGA 3PUWF 5LGTB 2M6BA 2XQ9A 3PDYA 3O1IA 2ZM8A 3OBVE 4YFSA 2Z6EA 3KBTA 1UURA 1LVKA 5LCYA 1NAFA 1SA0E 3ETUA 4A97A 2BZBA 2X51A 3NKZA 4F6RC 5HEHA 3CQXC 2E8IA 3NWIA 1UUSA 1WR6A 2YDSA 3ONXA 5LA6E 2LSJA 3N2GE 2YU2A 1XDPA 3NRXA 5FL1A 4QXBB 1OEDC 5LXTE 3UUMA 1IBMT 5FVLA 1L0VA 3UFEA 4B3ST 4GKKT 2NW9A 5LHIB 3TLVA 2CLYB 4MLKA 2X67A 3RH3A 3BQKA 4ISTA 3UU3A 2X0YA 2EHOC 4ILCA 2OLTA 3F31A 3ZCJA 4TWHA 4PFOA 4LF9T 4AISA 4MALA 4WNKA 4KP3C 5AQPB 2X0LB 2Q9QA 4H9NC 2XUEA 3ZMTB 2XJ7A 5FVKA 4DBRA 1SUMB 1T72A 2KNDA 2DHRA 2LHNA 4UF0A 4ERRA 4DR1T 3AECA 2J62A 2UU9T 3RYIE 5ABGA 2XAHB 3QNUA 4ADZA 2QVAA 3C4WA 3U3IA 1D0ZA 2D0TA 3MXZA 5JRCA 1IJ6A 2D0UA 4JBWF 2YDRA 3LSVA 1CUNA 5KMGP 2MYSA 5L3DB 4HWFA 3CPZA 4ISSA 4PJLA 5L4HA 5JDLA 2WBLA 1R8IA 2C5JA 2BDEA 4OK0A 4YHHT 3UT5E 5BR8T 4CI3B 4QXHB 4J2CA 2IAKA 3OTOT 4PK6A 4EGWA 5FMNA 2W61A 2BG9B 3DTOA 4IE4A 4Z90A 4H9PC 4DV7T 3ESLA 2MBGA 5FXVA 1YW0A 2JMKA 2QGSA 1HX1B 5L2LA 2AXDS 3ZMVB 3PJAA 2H7VC 2N2NA 1HFAA 3ZJ1A 1MMGA 1D0XA 3C4ZA 4YSXA 2UXDT 5ETWA 3AE2A 4UEMA 2JPFA 2K9AA 2ZMAA 3OKQA 2D9DA 3AE9A 4YTMA 4CXWA 4X5TA 5L3CB 2GK9A 1G73A 1Y01A 4HGAA 3N2KE 5FNVE 4O4JE 1NENA 2V6YA 3U78A 1U4QA 2K24A 2WZHA 3LK42 3UUNA 3CQGB 4E7ZA 1G8XA 4TWFA 3GWHA 3PU3A 2KLQA 2J47A 3RYCE 3I9WA 1N33T 5AQNB 5E0OA 2JQHA 3FZMB 3FZHB 2PJQA 3TLSA 2C0SA 2JQQA 1WRDA 2BS4A 4PNIA 4AKHA 2HHHT 3RIUA 4DR6T 1E1HB 3AVRA 2CPTA 2L9QA 2OV9A 3VR8A 2WY2A 4U74A 1J1JA 2ZM0A 3QUJA 3AA6B 3UQ4A 2SPCA 4P09A 2G0UA 4EXTA 3B5MA 4M1PA 5LG3A 3N9NA 4YJ3E 1W0BA 2JRKA 3AXJA 5HEGA 3I1AA 1WFDA 1MMAA 2K5BB 2VL0A 1D1CA 1YD8G 3RF1A 4CN4A 2DWKA 3ZC1A 4HWIB 2CWYA 4Z91A 3RPUA 2E9XA 3H3MA 3HKCE 3C50A 5KXJA 5LOVE 3GN5B 5LG4A 1E7PA 2BVMA 3AE3A 3BK9A 4LF5T 3CWZB 4IE5A 3ZN1B 4DNDA 3GA8A 1KF6A 2ODUA 1HCIA 4YXDA 4PW8A 3RIFA 4DV1T 3VKHA 5JDQA 3O1JA 5LGNB 5AQVB 2WB5A 2LE8A 3ZKRA 2RPAA 2UUAT 1H7CA 2B1EA 3P50A 2X9XA 4DV4T 3ZPOA 1BR0A 2M6IA 5KX5E 4ZZBA 3RC3A 2X9HA 4I55E 4A98A 2VVNA 3UU5A 4BJMA 4NIQA 3NVOA 2WZIA 2CWOA 3ZEFB 5H6QB 4ZI2C 5ABHA 1KNZA 1X79A 2VKDA 3HR0A 1LVFA 3HA4A 3O9XA 5CGMA 3NZQA 3T8OA 2YN6A 1VCSA 3ONJA 4EAHA 2C5KT 2HPLA 1M7KA 3C4XA 2V5CA 2A3DA 1DU2A 4A5XA 5HEJA 2X66A 5JDMA 3PUQA 3OYXA 4JLEA 1OEDA 2XAGB 2YINA 4HFIA 4DV0T 4PJMA 3OJAA 5HWYA 4X1YE 3QC9A 3FHNA 4O2AE 3Q5DA 2Q9QD 3A8YC 3NBXX 1ZOYA 2UUCT 3VR9A 2ES0A 2LOSA 2DLRA 4AIUA 2EHOA 2CMRA 4ILAA 4JV5T 2MTQA 4U31A 2NTYA 4KUMB 2VASA 5J2TE 3RLFF 4AQFC 2VL8A 5IHYA 4GIWA 4DBQA 3ZMSB 5AQFB 5AQLB 1FIOA 4FI5A 1IBLT 5JH7E 4KX6A 4O8SA 1S35A 4GK5E 3ANWA 4LFAT 4LF8T 3CX7B 3EABA 2FJBA 4F8HA 2KWHA 3ZMZB 5JR9B 2V7LA 5JDFA 5C8YE 2WAUA 1T7SA 3AAEB 4DV5T 2LSKA 3AVSA 1IJ5A 4MBQA 3UQ7A 3PUYF 4ZZCA 2Y6XA 2XSBA 4DR5T 4CN1A 3RHWA 4IHJE 2B76A 2BKNA 3ZC0A 2LHRA 5HCJA 3UULA 4GYSA 4H9RC 3FZFB 4U3CA 4TZ4C 4UR9A 2CBIA 3Q2MA 3LK3B 3N5LA 4CQIA 3C64A 3AEBA 2JIWA 2QA7A 4YSYA 5IUXA 3QK6A 4WYVA 4EYYR 4X65T 5L3BB 3CQCB 4QX8B 3LFMA 4DR4T 3C51A 4ZI2D 5JDNA 3LDQB 2ACZA 3B57A 2CE7A 2I59A 3S4UA 5FY1A 4ZI3D 4JEUB 3I0OA 4PJJA 3AB3B 1FMVA 5AQRB 2Y8DA 2PG8A 3QB5K 5IWAT 1YKEB 3Q9DA 4CZZB 4EIWA 4U2ZA 1V9DA 5AQHB 2V1DB 2FBWA 4WZXA 5AQOB 4ZHQE 1MIWA 4ZI7E 2CXFA 4WBNE 3PE0A 4V1Av 2CXLA 2V6XA 1E2AA 2VB6A 5LGUB 2E5VA 3K3OA 2CRBA 4UVBB 1S94A 2UUBT 3L3PA 3NRYA 3H37A 4B3RT 2WMOA 2N9DA 1J5WA 2AE9A 1Z8UA 3X1DA 4EB6E 3EDUA 2Q9QB 3AEEA 3I0QA 3HI2A 2E9XD 4NXNT 2V5DA 4PJNA 3MK7C 4JI6T 4UF0B 5J1GA 5HYAA 4DMVA 1D1AA 2X0HA 2NTXA 1N34T 4CXXA 3WI3A 3FBLA 1B7TA 2NWBA 5J2UE 2D5UA 5JRCB 4B6XA 2LRLA 2WU5A 5C2TA 3O4XE 5J0ZA 3ZCIA 1XNRT 4QH1A 4DO0A 5TAOA 1YKHB 1KEYA 3VRAA 1HS7A 4X1IE 3UTKA 4X62T 4JUYA 5HEOA 3E0ZA 2LKHA 4I43B 4LMKA 4DVDA 5CA0E 3UUXB 4Z8XA 3M65A 4AI6A 2A2FX 4OFZA 3JC6C 1VRBA 5LP6E 1GQEA 5AQUB 4H63H 3CMLA 4UELA 1HNXT 3EHZA 4ILBA 2QYWA 1AJ3A 4HEAA 4MHCA 4UVCB 2L8KA 3N9MA 3G06A 3NZPA 5LNKA 3CX8B 4DIDB 2IDOB 4OYJA 4QH5A 1ZKEA 3A5XA 2DNXA 2PBIA 5HXRA 2V6YB 4TNVA 4UV8B 4YHJA 2XM1A 5AQQB 2NOXA 3V5SA 1HX8A 3MACA 4H9OC 1NEKA 1UX5A 3P4QA 3P4WA 4Q25A 2DWGA 5DJQC 3ABVA 4XBFB 3AE7A 5LB7B 4KMCA 4CI1B 4ILUA 1T8BA 4G63A 3RRWA 4HFVA 3RQWA 1HF8A 1ZP0A 4LMLA 3RX6A 3PURA 1KNRA 2EHOD 2WS3A 4DR2T 2BBHA 1SE7A 4GKJT 1I6ZA 4TN7B 2XQ7A 4CI2B 1OWAA 2CLYC 3SWHA 3LG7A 3AXJB 4I4TE 1OXZA 2LJLA 5EK2A 5GONE 2K48A 4YTNA 3EAMA 2WDRA 4O4HE 5FY7A 3J9X1 2BKOA 2M67A 4AQFA 2E9XB 3WAKA 4HFCA 3I9YA 4K0UA 2CHNA 5F5WA 2KT9A 3AA0B 1BR4A 4HFHA 2CA5A 4ANJA 3ZT5A 2H89A 1N36T 4JI1T 4ZXLA 2W00A 2BKPA 1ZEEA 2J1DG 2UXNB 3QOFA 4IDPA 5AQKB 1UGOA 2K3WA 4NUVA 2VKHA 2CM0A 3VRBA 3R6NA 4O2BE 1UCUA 4EOZB 1HG5A 3AAIA 4HWDA 4AKIA 4DV3T 4ZS2A 4H63V 3KV6A 4AQGA 1ZV4X 3CK6A 5HXEA 1OEDE 2W62A 3JCFA 5LJMA 2RA1A 2XSAA 3SOLA 2FJAA 3ZSTA 4EZ4A 4EEBA 4I0UA 2BG9C 3F2EA 3K1SA 2V8SV 3AE5A 3MA9A 1WLXA 4QHOA 1SHZC 2XQ5A 3FBZA 2JJ9A 4IE0A 2JQKA 2H88A 2RP4A 4U2YA 4QKNA 4U7IA 5FY0A 4EYUA 3R84B 4ZS3A 5FYMA 2W2UA 1LRZA 3ONLC 3TLWA 4WW0A 5F3JA 3OPCA 4P0AA 4HFEA 1HNWT 4DR7T 4NXMT 5ADXL 1HNZT 5JDGA 2XM2A 3UU6A 2FJDA 2ZM6T 4UV9B 1KFYA 2LOPA 1OEDB 4KHZF 1T98A 2WDQA 2BS3A 2WCAA 5DABA 5CFBA 1XMOT 2IC6A 4QH4A 3JAEA 1MMDA 1WR0A 3AA1B 5HAXA 3SFEA 3CX6B 1JNZA 5EZYE 2EHOB 3MJXA 2NW7A 4N78D 2X68A 3PUVF 1JNRA 4LF7T 4O4LE 4U72A 2BS2A 3RYHE 4TV8E 2HN2A 4L0RA 4TUYE 3LJCA 5HWXA 5CA1E 3ETVA 4UVAB 1HTJF 3KFWX 4HKAA 2DL1A 3HKBE 2X9WA 3D0TA 4AXPA 3JAFA 2LSYA 4GOUA 1YXRA 3PTRB 2VWAA 3ANWB 3LK2B 2H3RA 3RI5A 3RKGA 4WBOA 4TV9E 1HG2A 2WMNA 2YU1A 4PAGA 2IHR1 3LBXA 5LBQB 5CJ5A 3E08A 4GK0E 4O4IE 2LLYA 2I0MA 2WP9A 1QUUA 4IE7A 4L5GA 4NPPA 3EUHA 5EK4A 3T1YT 2DCFA 3SRZA 3P8CD 2JQ9A 2FJEA 1BR1A 1UX4A 2LEHA 4XZCA 1IBKT 3AE8A 2YK0A 2W4XA 4IT4A 3W15B 2IMLA 3SS1A 3V5UA 2UXBT 5L3GB 4DV6T 5ABFA 1WYCA 3Q5XA 1KNPA 4PK4A 2A72A 3HL6A 4X66T 2VQFT 2HN1A 3RGLA 3FXEB 5HCMA 2WM9A 3PV0F 3HKDE 5A1LA 4IDNA 1MNEA 1W09A 3ZYLA 4IDQA 4LMJA 3KVBA 1W9RA 1US7B 4YY3T 5LMUT 3HKEE 3N9PA 3AE1A 3P4PA 5AQMB 2W66A 1YQ3A 2XAFB 4X20E 3M3ZB 2OA5A 5F8PA 4AKGA 2XQ3A 2I6HA 2QRXA 4OYKA 2J4GA 2E5LT 4NUUA 4DUYT 3TKLB 1FEWA 2VVSA 4JEHB 2XPKA 3PJAJ 3DJBA 3IA3A 2XASB 3H3AA 5EK3A 5JREA 1QSDA 5FXXA 3KV5A 2WQYA 4QXCB 2E2AA 2FUPA 1MIVA 3O1HA 5LMNT 2DI4A 3OYZA 4JI5T 2D2SA 4HWHA 3P4RA 4IDOA 4MFRA 3P4SA 1BR2A 4L9IA 4IGUA 5ABEA 1YQ4A 4A56A 1MMNA 2WU2A 3MZKB 1Y64B 2X9YA 4HN9A 4I50E 4BAYB 4ASKA 3KV4A 4IREA 2PTFA 3VU7H 2XQ4A 2BG9E 2KZ7B 2V7MA 5FKYA 2HH7A 2ZLYA 2MPKA 3AE6A 4JYAT 2XQ6A 3BQIA 1WYBA 3PUGA 5LHGB 3SFDA 4LFBT 4CN6A 5L4EA 3L39A 4JI4T 3ZSSA 5AQJB 5L47A 5HEUA 5JR9C 4GYRA 3QB5A 3A7MA 3ZT6A 4IE6A 2KXPB 2NW8A 3UU4A 2YEVC 5JVDE 4KI0F 4FJOA 3BQLA 4TX5A 5AQSB 3RC8A 4YLHA 1MIYA 3PUAA 2NP9A
chains in the Genus database with same CATH topology
1OEDB 2BG9A 4ILAA 3P50A 5CFBA 4HFBA 3P4WA 4COFA 4TWDA 4QH4A 2LM2A 3JAEA 2YKSA 2M6IA 4ZZBA 3UQ4A 1OEDC 2MAWA 3UU8A 5J0ZA 4QH1A 3JADA 2YOEA 4A98A 3UU5A 2BG9B 5LG3A 4Z90A 3EI0A 5HEGA 3TLVA 3RQWA 5HCMA 4IREA 4LMLA 3TLUA 2XQ4A 2BG9E 2LKGA 2XQAA 1OEDE 3TLTA 2VL0A 4LMJA 3UU3A 5HEOA 2LKHA 2BG9C 2XQ6A 4LMKA 2KSRA 4ILCA 3RIAA 4Z91A 4IL4A 4IL9A 4F8HA 2XQ7A 2XQ8A 4TWHA 5L4EA 2YN6A 2XQ5A 3JAFA 4X5TA 2XQ3A 5L47A 3EHZA 4ILBA 3RQUA 2M6BA 2XQ9A 5HEUA 3RI5A 3UQ7A 4ZZCA 5HEJA 3EAMA 3RHWA 4HFCA 1OEDA 4TWFA 5HCJA 3UU4A 4HFIA 3TLWA 4A97A 4QH5A 2LLYA 4HFHA 4HFEA 3RIFA 4NPPA 5HEHA 3TLSA 4HFDA 4TNVA 3UUBA 3LSVA 3UU6A 4TNWA 5IUXA 3ZKRA 5L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED B;  2BG9 A;  4ILA A;  3P50 A;  5CFB A;  4HFB A;  3P4W A;  4COF A;  4TWD A;  4QH4 A;  2LM2 A;  3JAE A;  2YKS A;  2M6I A;  4ZZB A;  3UQ4 A;  1OED C;  2MAW A;  3UU8 A;  5J0Z A;  4QH1 A;  3JAD A;  2YOE A;  4A98 A;  3UU5 A;  2BG9 B;  5LG3 A;  4Z90 A;  3EI0 A;  5HEG A;  3TLV A;  3RQW A;  5HCM A;  4IRE A;  4LML A;  3TLU A;  2XQ4 A;  2BG9 E;  2LKG A;  2XQA A;  1OED E;  3TLT A;  2VL0 A;  4LMJ A;  3UU3 A;  5HEO A;  2LKH A;  2BG9 C;  2XQ6 A;  4LMK A;  2KSR A;  4ILC A;  3RIA A;  4Z91 A;  4IL4 A;  4IL9 A;  4F8H A;  2XQ7 A;  2XQ8 A;  4TWH A;  5L4E A;  2YN6 A;  2XQ5 A;  3JAF A;  4X5T A;  2XQ3 A;  5L47 A;  3EHZ A;  4ILB A;  3RQU A;  2M6B A;  2XQ9 A;  5HEU A;  3RI5 A;  3UQ7 A;  4ZZC A;  5HEJ A;  3EAM A;  3RHW A;  4HFC A;  1OED A;  4TWF A;  5HCJ A;  3UU4 A;  4HFI A;  3TLW A;  4A97 A;  4QH5 A;  2LLY A;  4HFH A;  4HFE A;  3RIF A;  4NPP A;  5HEH A;  3TLS A;  4HFD A;  4TNV A;  3UUB A;  3LSV A;  3UU6 A;  4TNW A;  5IUX A;  3ZKR A;  5L4H A; 
#chains in the Genus database with same CATH topology
 5JDH A;  2BG9 A;  4C90 A;  5LHH B;  3ZMU B;  4H9Q C;  4TWD A;  3AA7 B;  4H9S E;  1XZY A;  3N9O A;  5AQI B;  1I94 T;  5JTG A;  3EDV A;  1D0Y A;  3IHR A;  4AKR B;  5DQW A;  2VK9 A;  2XQY A;  1KK7 A;  4P0B A;  4YT0 A;  4UXN B;  4ZOL E;  4E7S A;  3L8R A;  3AE4 A;  3AED A;  4U33 A;  3VHL A;  4HTE A;  3K8P C;  2ZM2 A;  3RYF E;  5L3F B;  4LF4 T;  3CVR A;  2LT3 A;  3ZJ2 A;  1MND A;  2LSG A;  5JQG E;  3KVA A;  3ZYK A;  1ZHC A;  3E22 E;  2WDV A;  2ACX A;  4JI2 T;  2KIN B;  1WCR A;  2XAJ B;  3FZL B;  4B3T T;  3FXD B;  2Q9Q C;  1U5P A;  1D1B A;  3CIR A;  5FXW A;  3P7I A;  3ZN0 B;  2CCQ A;  1XNQ T;  2A9U A;  4YTP A;  2LM2 A;  3T1H T;  2ODV A;  4G2A A;  5BMV E;  2MAW A;  1XDO A;  3PUZ F;  3JAD A;  2NR4 A;  3L09 A;  3F57 A;  4UIG A;  1IZN B;  2JMH A;  1VOM A;  3TLU A;  3AEA A;  2LKG A;  2XQA A;  4PFP A;  3GMI A;  1HR0 T;  1J5E T;  3TLT A;  3GN5 A;  4YSZ A;  1O3X A;  4JI0 T;  5C3J A;  2XTL A;  3C98 B;  2CHO A;  3RIA A;  4JI3 T;  4BJN A;  4B3M T;  3JC6 D;  2XAQ B;  1NWM X;  2KWI B;  5L3E B;  3K3N A;  4LFC T;  2IC9 A;  2UXX B;  4U7Y A;  4IDZ A;  1XWM A;  5H6R B;  5LJN A;  1FMW A;  4EV6 A;  4IIJ E;  2V26 A;  4OHF A;  1N32 T;  2LSI A;  4BA9 A;  2C5I T;  4HFD A;  2WWU A;  3UUB A;  2UXC T;  1LKX A;  4DR3 T;  4TNW A;  3KDS E;  3PU8 A;  2IUB A;  5AFU L;  2W63 A;  1UK5 A;  2WSS V;  3ZYM A;  4JI8 T;  2F4V T;  4AKL A;  2KMF A;  2V7J A;  4HFB A;  2WWV A;  4AQY T;  5FP3 A;  2VQE T;  3RKO A;  2YKS A;  5AQG B;  5LBM A;  1X9B A;  5M4Y A;  1Z0P A;  4P1N A;  2YOE A;  5LYJ E;  3J7Y q;  4JI7 T;  3EI0 A;  5AQT B;  3WAJ A;  4ZI3 C;  2L3L A;  2CEA A;  3AAA B;  2VKO A;  4HWC A;  3K3Q C;  3Q5W A;  3IEE A;  2IW5 B;  3RIU C;  2XY8 B;  2YDQ A;  2KSR A;  3FB2 A;  3Q5E A;  4IL4 A;  5HXH A;  3DP7 A;  4KHP T;  1FJG T;  2CBJ A;  3CKD A;  3IF8 B;  2R6G F;  4EED A;  2BVL A;  1W0A A;  2N1G A;  3KIN B;  2W67 A;  1IAP A;  2V7K A;  5DQV A;  2CXD A;  3RQU A;  4DUZ T;  4X1K E;  3RRC A;  5KDM C;  3KV9 A;  4ZEY A;  2P9B A;  2H7O A;  4LF6 T;  1QLB A;  1VCT A;  4DV2 T;  5FL0 A;  4XAX B;  2VUR A;  1M62 A;  2VKJ A;  2E9X C;  3N9L A;  4YJ2 E;  2HPJ A;  2XZE A;  2LRK A;  5IYZ E;  4EZH A;  3LBX B;  4X64 T;  2V7I A;  3VKG A;  3OVU A;  3PUS A;  3ZLI A;  4OX9 T;  3PUX F;  4KBM B;  4COF A;  3AEG A;  3UU8 A;  3FZK B;  4DMW A;  5JR9 A;  4HE8 A;  4CXY A;  3N9Q A;  3AEF A;  1EZ3 A;  3EVY A;  2IIU A;  1XMQ T;  4QWN B;  5CB4 E;  5ABF B;  2W0G A;  3KBU A;  1CHU A;  2LM9 A;  4C91 A;  3N2O A;  2Y48 B;  4QX7 B;  5FXZ A;  4K0K T;  4IL9 A;  2MOZ A;  3B13 A;  2XQ8 A;  2BBJ A;  2PFV A;  2XHE B;  3IBP A;  3ZT7 A;  5HXC A;  5HXS A;  3MKD A;  4PK5 A;  3UFG A;  3PUW F;  5LGT B;  2M6B A;  2XQ9 A;  3PDY A;  3O1I A;  2ZM8 A;  3OBV E;  4YFS A;  2Z6E A;  3KBT A;  1UUR A;  1LVK A;  5LCY A;  1NAF A;  1SA0 E;  3ETU A;  4A97 A;  2BZB A;  2X51 A;  3NKZ A;  4F6R C;  5HEH A;  3CQX C;  2E8I A;  3NWI A;  1UUS A;  1WR6 A;  2YDS A;  3ONX A;  5LA6 E;  2LSJ A;  3N2G E;  2YU2 A;  1XDP A;  3NRX A;  5FL1 A;  4QXB B;  1OED C;  5LXT E;  3UUM A;  1IBM T;  5FVL A;  1L0V A;  3UFE A;  4B3S T;  4GKK T;  2NW9 A;  5LHI B;  3TLV A;  2CLY B;  4MLK A;  2X67 A;  3RH3 A;  3BQK A;  4IST A;  3UU3 A;  2X0Y A;  2EHO C;  4ILC A;  2OLT A;  3F31 A;  3ZCJ A;  4TWH A;  4PFO A;  4LF9 T;  4AIS A;  4MAL A;  4WNK A;  4KP3 C;  5AQP B;  2X0L B;  2Q9Q A;  4H9N C;  2XUE A;  3ZMT B;  2XJ7 A;  5FVK A;  4DBR A;  1SUM B;  1T72 A;  2KND A;  2DHR A;  2LHN A;  4UF0 A;  4ERR A;  4DR1 T;  3AEC A;  2J62 A;  2UU9 T;  3RYI E;  5ABG A;  2XAH B;  3QNU A;  4ADZ A;  2QVA A;  3C4W A;  3U3I A;  1D0Z A;  2D0T A;  3MXZ A;  5JRC A;  1IJ6 A;  2D0U A;  4JBW F;  2YDR A;  3LSV A;  1CUN A;  5KMG P;  2MYS A;  5L3D B;  4HWF A;  3CPZ A;  4ISS A;  4PJL A;  5L4H A;  5JDL A;  2WBL A;  1R8I A;  2C5J A;  2BDE A;  4OK0 A;  4YHH T;  3UT5 E;  5BR8 T;  4CI3 B;  4QXH B;  4J2C A;  2IAK A;  3OTO T;  4PK6 A;  4EGW A;  5FMN A;  2W61 A;  2BG9 B;  3DTO A;  4IE4 A;  4Z90 A;  4H9P C;  4DV7 T;  3ESL A;  2MBG A;  5FXV A;  1YW0 A;  2JMK A;  2QGS A;  1HX1 B;  5L2L A;  2AXD S;  3ZMV B;  3PJA A;  2H7V C;  2N2N A;  1HFA A;  3ZJ1 A;  1MMG A;  1D0X A;  3C4Z A;  4YSX A;  2UXD T;  5ETW A;  3AE2 A;  4UEM A;  2JPF A;  2K9A A;  2ZMA A;  3OKQ A;  2D9D A;  3AE9 A;  4YTM A;  4CXW A;  4X5T A;  5L3C B;  2GK9 A;  1G73 A;  1Y01 A;  4HGA A;  3N2K E;  5FNV E;  4O4J E;  1NEN A;  2V6Y A;  3U78 A;  1U4Q A;  2K24 A;  2WZH A;  3LK4 2;  3UUN A;  3CQG B;  4E7Z A;  1G8X A;  4TWF A;  3GWH A;  3PU3 A;  2KLQ A;  2J47 A;  3RYC E;  3I9W A;  1N33 T;  5AQN B;  5E0O A;  2JQH A;  3FZM B;  3FZH B;  2PJQ A;  3TLS A;  2C0S A;  2JQQ A;  1WRD A;  2BS4 A;  4PNI A;  4AKH A;  2HHH T;  3RIU A;  4DR6 T;  1E1H B;  3AVR A;  2CPT A;  2L9Q A;  2OV9 A;  3VR8 A;  2WY2 A;  4U74 A;  1J1J A;  2ZM0 A;  3QUJ A;  3AA6 B;  3UQ4 A;  2SPC A;  4P09 A;  2G0U A;  4EXT A;  3B5M A;  4M1P A;  5LG3 A;  3N9N A;  4YJ3 E;  1W0B A;  2JRK A;  3AXJ A;  5HEG A;  3I1A A;  1WFD A;  1MMA A;  2K5B B;  2VL0 A;  1D1C A;  1YD8 G;  3RF1 A;  4CN4 A;  2DWK A;  3ZC1 A;  4HWI B;  2CWY A;  4Z91 A;  3RPU A;  2E9X A;  3H3M A;  3HKC E;  3C50 A;  5KXJ A;  5LOV E;  3GN5 B;  5LG4 A;  1E7P A;  2BVM A;  3AE3 A;  3BK9 A;  4LF5 T;  3CWZ B;  4IE5 A;  3ZN1 B;  4DND A;  3GA8 A;  1KF6 A;  2ODU A;  1HCI A;  4YXD A;  4PW8 A;  3RIF A;  4DV1 T;  3VKH A;  5JDQ A;  3O1J A;  5LGN B;  5AQV B;  2WB5 A;  2LE8 A;  3ZKR A;  2RPA A;  2UUA T;  1H7C A;  2B1E A;  3P50 A;  2X9X A;  4DV4 T;  3ZPO A;  1BR0 A;  2M6I A;  5KX5 E;  4ZZB A;  3RC3 A;  2X9H A;  4I55 E;  4A98 A;  2VVN A;  3UU5 A;  4BJM A;  4NIQ A;  3NVO A;  2WZI A;  2CWO A;  3ZEF B;  5H6Q B;  4ZI2 C;  5ABH A;  1KNZ A;  1X79 A;  2VKD A;  3HR0 A;  1LVF A;  3HA4 A;  3O9X A;  5CGM A;  3NZQ A;  3T8O A;  2YN6 A;  1VCS A;  3ONJ A;  4EAH A;  2C5K T;  2HPL A;  1M7K A;  3C4X A;  2V5C A;  2A3D A;  1DU2 A;  4A5X A;  5HEJ A;  2X66 A;  5JDM A;  3PUQ A;  3OYX A;  4JLE A;  1OED A;  2XAG B;  2YIN A;  4HFI A;  4DV0 T;  4PJM A;  3OJA A;  5HWY A;  4X1Y E;  3QC9 A;  3FHN A;  4O2A E;  3Q5D A;  2Q9Q D;  3A8Y C;  3NBX X;  1ZOY A;  2UUC T;  3VR9 A;  2ES0 A;  2LOS A;  2DLR A;  4AIU A;  2EHO A;  2CMR A;  4ILA A;  4JV5 T;  2MTQ A;  4U31 A;  2NTY A;  4KUM B;  2VAS A;  5J2T E;  3RLF F;  4AQF C;  2VL8 A;  5IHY A;  4GIW A;  4DBQ A;  3ZMS B;  5AQF B;  5AQL B;  1FIO A;  4FI5 A;  1IBL T;  5JH7 E;  4KX6 A;  4O8S A;  1S35 A;  4GK5 E;  3ANW A;  4LFA T;  4LF8 T;  3CX7 B;  3EAB A;  2FJB A;  4F8H A;  2KWH A;  3ZMZ B;  5JR9 B;  2V7L A;  5JDF A;  5C8Y E;  2WAU A;  1T7S A;  3AAE B;  4DV5 T;  2LSK A;  3AVS A;  1IJ5 A;  4MBQ A;  3UQ7 A;  3PUY F;  4ZZC A;  2Y6X A;  2XSB A;  4DR5 T;  4CN1 A;  3RHW A;  4IHJ E;  2B76 A;  2BKN A;  3ZC0 A;  2LHR A;  5HCJ A;  3UUL A;  4GYS A;  4H9R C;  3FZF B;  4U3C A;  4TZ4 C;  4UR9 A;  2CBI A;  3Q2M A;  3LK3 B;  3N5L A;  4CQI A;  3C64 A;  3AEB A;  2JIW A;  2QA7 A;  4YSY A;  5IUX A;  3QK6 A;  4WYV A;  4EYY R;  4X65 T;  5L3B B;  3CQC B;  4QX8 B;  3LFM A;  4DR4 T;  3C51 A;  4ZI2 D;  5JDN A;  3LDQ B;  2ACZ A;  3B57 A;  2CE7 A;  2I59 A;  3S4U A;  5FY1 A;  4ZI3 D;  4JEU B;  3I0O A;  4PJJ A;  3AB3 B;  1FMV A;  5AQR B;  2Y8D A;  2PG8 A;  3QB5 K;  5IWA T;  1YKE B;  3Q9D A;  4CZZ B;  4EIW A;  4U2Z A;  1V9D A;  5AQH B;  2V1D B;  2FBW A;  4WZX A;  5AQO B;  4ZHQ E;  1MIW A;  4ZI7 E;  2CXF A;  4WBN E;  3PE0 A;  4V1A v;  2CXL A;  2V6X A;  1E2A A;  2VB6 A;  5LGU B;  2E5V A;  3K3O A;  2CRB A;  4UVB B;  1S94 A;  2UUB T;  3L3P A;  3NRY A;  3H37 A;  4B3R T;  2WMO A;  2N9D A;  1J5W A;  2AE9 A;  1Z8U A;  3X1D A;  4EB6 E;  3EDU A;  2Q9Q B;  3AEE A;  3I0Q A;  3HI2 A;  2E9X D;  4NXN T;  2V5D A;  4PJN A;  3MK7 C;  4JI6 T;  4UF0 B;  5J1G A;  5HYA A;  4DMV A;  1D1A A;  2X0H A;  2NTX A;  1N34 T;  4CXX A;  3WI3 A;  3FBL A;  1B7T A;  2NWB A;  5J2U E;  2D5U A;  5JRC B;  4B6X A;  2LRL A;  2WU5 A;  5C2T A;  3O4X E;  5J0Z A;  3ZCI A;  1XNR T;  4QH1 A;  4DO0 A;  5TAO A;  1YKH B;  1KEY A;  3VRA A;  1HS7 A;  4X1I E;  3UTK A;  4X62 T;  4JUY A;  5HEO A;  3E0Z A;  2LKH A;  4I43 B;  4LMK A;  4DVD A;  5CA0 E;  3UUX B;  4Z8X A;  3M65 A;  4AI6 A;  2A2F X;  4OFZ A;  3JC6 C;  1VRB A;  5LP6 E;  1GQE A;  5AQU B;  4H63 H;  3CML A;  4UEL A;  1HNX T;  3EHZ A;  4ILB A;  2QYW A;  1AJ3 A;  4HEA A;  4MHC A;  4UVC B;  2L8K A;  3N9M A;  3G06 A;  3NZP A;  5LNK A;  3CX8 B;  4DID B;  2IDO B;  4OYJ A;  4QH5 A;  1ZKE A;  3A5X A;  2DNX A;  2PBI A;  5HXR A;  2V6Y B;  4TNV A;  4UV8 B;  4YHJ A;  2XM1 A;  5AQQ B;  2NOX A;  3V5S A;  1HX8 A;  3MAC A;  4H9O C;  1NEK A;  1UX5 A;  3P4Q A;  3P4W A;  4Q25 A;  2DWG A;  5DJQ C;  3ABV A;  4XBF B;  3AE7 A;  5LB7 B;  4KMC A;  4CI1 B;  4ILU A;  1T8B A;  4G63 A;  3RRW A;  4HFV A;  3RQW A;  1HF8 A;  1ZP0 A;  4LML A;  3RX6 A;  3PUR A;  1KNR A;  2EHO D;  2WS3 A;  4DR2 T;  2BBH A;  1SE7 A;  4GKJ T;  1I6Z A;  4TN7 B;  2XQ7 A;  4CI2 B;  1OWA A;  2CLY C;  3SWH A;  3LG7 A;  3AXJ B;  4I4T E;  1OXZ A;  2LJL A;  5EK2 A;  5GON E;  2K48 A;  4YTN A;  3EAM A;  2WDR A;  4O4H E;  5FY7 A;  3J9X 1;  2BKO A;  2M67 A;  4AQF A;  2E9X B;  3WAK A;  4HFC A;  3I9Y A;  4K0U A;  2CHN A;  5F5W A;  2KT9 A;  3AA0 B;  1BR4 A;  4HFH A;  2CA5 A;  4ANJ A;  3ZT5 A;  2H89 A;  1N36 T;  4JI1 T;  4ZXL A;  2W00 A;  2BKP A;  1ZEE A;  2J1D G;  2UXN B;  3QOF A;  4IDP A;  5AQK B;  1UGO A;  2K3W A;  4NUV A;  2VKH A;  2CM0 A;  3VRB A;  3R6N A;  4O2B E;  1UCU A;  4EOZ B;  1HG5 A;  3AAI A;  4HWD A;  4AKI A;  4DV3 T;  4ZS2 A;  4H63 V;  3KV6 A;  4AQG A;  1ZV4 X;  3CK6 A;  5HXE A;  1OED E;  2W62 A;  3JCF A;  5LJM A;  2RA1 A;  2XSA A;  3SOL A;  2FJA A;  3ZST A;  4EZ4 A;  4EEB A;  4I0U A;  2BG9 C;  3F2E A;  3K1S A;  2V8S V;  3AE5 A;  3MA9 A;  1WLX A;  4QHO A;  1SHZ C;  2XQ5 A;  3FBZ A;  2JJ9 A;  4IE0 A;  2JQK A;  2H88 A;  2RP4 A;  4U2Y A;  4QKN A;  4U7I A;  5FY0 A;  4EYU A;  3R84 B;  4ZS3 A;  5FYM A;  2W2U A;  1LRZ A;  3ONL C;  3TLW A;  4WW0 A;  5F3J A;  3OPC A;  4P0A A;  4HFE A;  1HNW T;  4DR7 T;  4NXM T;  5ADX L;  1HNZ T;  5JDG A;  2XM2 A;  3UU6 A;  2FJD A;  2ZM6 T;  4UV9 B;  1KFY A;  2LOP A;  1OED B;  4KHZ F;  1T98 A;  2WDQ A;  2BS3 A;  2WCA A;  5DAB A;  5CFB A;  1XMO T;  2IC6 A;  4QH4 A;  3JAE A;  1MMD A;  1WR0 A;  3AA1 B;  5HAX A;  3SFE A;  3CX6 B;  1JNZ A;  5EZY E;  2EHO B;  3MJX A;  2NW7 A;  4N78 D;  2X68 A;  3PUV F;  1JNR A;  4LF7 T;  4O4L E;  4U72 A;  2BS2 A;  3RYH E;  4TV8 E;  2HN2 A;  4L0R A;  4TUY E;  3LJC A;  5HWX A;  5CA1 E;  3ETV A;  4UVA B;  1HTJ F;  3KFW X;  4HKA A;  2DL1 A;  3HKB E;  2X9W A;  3D0T A;  4AXP A;  3JAF A;  2LSY A;  4GOU A;  1YXR A;  3PTR B;  2VWA A;  3ANW B;  3LK2 B;  2H3R A;  3RI5 A;  3RKG A;  4WBO A;  4TV9 E;  1HG2 A;  2WMN A;  2YU1 A;  4PAG A;  2IHR 1;  3LBX A;  5LBQ B;  5CJ5 A;  3E08 A;  4GK0 E;  4O4I E;  2LLY A;  2I0M A;  2WP9 A;  1QUU A;  4IE7 A;  4L5G A;  4NPP A;  3EUH A;  5EK4 A;  3T1Y T;  2DCF A;  3SRZ A;  3P8C D;  2JQ9 A;  2FJE A;  1BR1 A;  1UX4 A;  2LEH A;  4XZC A;  1IBK T;  3AE8 A;  2YK0 A;  2W4X A;  4IT4 A;  3W15 B;  2IML A;  3SS1 A;  3V5U A;  2UXB T;  5L3G B;  4DV6 T;  5ABF A;  1WYC A;  3Q5X A;  1KNP A;  4PK4 A;  2A72 A;  3HL6 A;  4X66 T;  2VQF T;  2HN1 A;  3RGL A;  3FXE B;  5HCM A;  2WM9 A;  3PV0 F;  3HKD E;  5A1L A;  4IDN A;  1MNE A;  1W09 A;  3ZYL A;  4IDQ A;  4LMJ A;  3KVB A;  1W9R A;  1US7 B;  4YY3 T;  5LMU T;  3HKE E;  3N9P A;  3AE1 A;  3P4P A;  5AQM B;  2W66 A;  1YQ3 A;  2XAF B;  4X20 E;  3M3Z B;  2OA5 A;  5F8P A;  4AKG A;  2XQ3 A;  2I6H A;  2QRX A;  4OYK A;  2J4G A;  2E5L T;  4NUU A;  4DUY T;  3TKL B;  1FEW A;  2VVS A;  4JEH B;  2XPK A;  3PJA J;  3DJB A;  3IA3 A;  2XAS B;  3H3A A;  5EK3 A;  5JRE A;  1QSD A;  5FXX A;  3KV5 A;  2WQY A;  4QXC B;  2E2A A;  2FUP A;  1MIV A;  3O1H A;  5LMN T;  2DI4 A;  3OYZ A;  4JI5 T;  2D2S A;  4HWH A;  3P4R A;  4IDO A;  4MFR A;  3P4S A;  1BR2 A;  4L9I A;  4IGU A;  5ABE A;  1YQ4 A;  4A56 A;  1MMN A;  2WU2 A;  3MZK B;  1Y64 B;  2X9Y A;  4HN9 A;  4I50 E;  4BAY B;  4ASK A;  3KV4 A;  4IRE A;  2PTF A;  3VU7 H;  2XQ4 A;  2BG9 E;  2KZ7 B;  2V7M A;  5FKY A;  2HH7 A;  2ZLY A;  2MPK A;  3AE6 A;  4JYA T;  2XQ6 A;  3BQI A;  1WYB A;  3PUG A;  5LHG B;  3SFD A;  4LFB T;  4CN6 A;  5L4E A;  3L39 A;  4JI4 T;  3ZSS A;  5AQJ B;  5L47 A;  5HEU A;  5JR9 C;  4GYR A;  3QB5 A;  3A7M A;  3ZT6 A;  4IE6 A;  2KXP B;  2NW8 A;  3UU4 A;  2YEV C;  5JVD E;  4KI0 F;  4FJO A;  3BQL A;  4TX5 A;  5AQS B;  3RC8 A;  4YLH A;  1MIY A;  3PUA A;  2NP9 A; 
#chains in the Genus database with same CATH homology
 1OED B;  2BG9 A;  4ILA A;  3P50 A;  5CFB A;  4HFB A;  3P4W A;  4COF A;  4TWD A;  4QH4 A;  2LM2 A;  3JAE A;  2YKS A;  2M6I A;  4ZZB A;  3UQ4 A;  1OED C;  2MAW A;  3UU8 A;  5J0Z A;  4QH1 A;  3JAD A;  2YOE A;  4A98 A;  3UU5 A;  2BG9 B;  5LG3 A;  4Z90 A;  3EI0 A;  5HEG A;  3TLV A;  3RQW A;  5HCM A;  4IRE A;  4LML A;  3TLU A;  2XQ4 A;  2BG9 E;  2LKG A;  2XQA A;  1OED E;  3TLT A;  2VL0 A;  4LMJ A;  3UU3 A;  5HEO A;  2LKH A;  2BG9 C;  2XQ6 A;  4LMK A;  2KSR A;  4ILC A;  3RIA A;  4Z91 A;  4IL4 A;  4IL9 A;  4F8H A;  2XQ7 A;  2XQ8 A;  4TWH A;  5L4E A;  2YN6 A;  2XQ5 A;  3JAF A;  4X5T A;  2XQ3 A;  5L47 A;  3EHZ A;  4ILB A;  3RQU A;  2M6B A;  2XQ9 A;  5HEU A;  3RI5 A;  3UQ7 A;  4ZZC A;  5HEJ A;  3EAM A;  3RHW A;  4HFC A;  1OED A;  4TWF A;  5HCJ A;  3UU4 A;  4HFI A;  3TLW A;  4A97 A;  4QH5 A;  2LLY A;  4HFH A;  4HFE A;  3RIF A;  4NPP A;  5HEH A;  3TLS A;  4HFD A;  4TNV A;  3UUB A;  3LSV A;  3UU6 A;  4TNW A;  5IUX A;  3ZKR A;  5L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...