2LM2A

Nmr structures of the transmembrane domains of the achr b2 subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NAEEEPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSSDSPSVGEYLMFTMVLVTFSIVTSVCVLNVHHRSPETHTGGGGGIDRLFLWIFVFVCVFGTIGMFLQPLFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Neuronal acetylcholine receptor subunit beta-2
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2lm2A01
2XQ6A 2M6BA 5HCMA 3UU4A 4F8HA 2XQ5A 3RIAA 5HEJA 5HEOA 2XQAA 4Z90A 4HFIA 3TLWA 4TNWA 3RIFA 2YN6A 4QH4A 4TWDA 5L4HA 3JAEA 4HFEA 3JAFA 3RI5A 4IREA 3UQ7A 3RQUA 4ZZCA 2LLYA 2MAWA 4TNVA 2XQ7A 2LKHA 3P4WA 4LMKA 2KSRA 3JADA 4HFCA 1OEDB 4NPPA 4X5TA 2XQ3A 3TLUA 3P50A 3UU6A 5HCJA 3UU5A 5J0ZA 2XQ9A 3UU8A 2BG9A 4ILBA 4IL9A 3TLVA 2M6IA 2BG9E 5L47A 3TLSA 4LMJA 4LMLA 4ZZBA 4HFBA 5HEUA 4ILCA 3RQWA 2BG9C 2YKSA 4Z91A 1OEDA 4TWHA 3UU3A 5CFBA 4HFHA 3UUBA 3UQ4A 2XQ8A 1OEDE 2LKGA 1OEDC 4A97A 5HEHA 2VL0A 3EHZA 4TWFA 2LM2A 4HFDA 4ILAA 4QH1A 3RHWA 3TLTA 3ZKRA 2YOEA 4COFA 4IL4A 2BG9B 3EI0A 4QH5A 5IUXA 3EAMA 3LSVA 5LG3A 4A98A 5L4EA 2XQ4A 5HEGA
chains in the Genus database with same CATH superfamily
5BMVE 2A3DA 2VKHA 4GK5E 4P0AA 1OXZA 4GKJT 3I1AA 2LEHA 2Q9QD 2CBJA 2CMRA 2J47A 2IAKA 2V6XA 3ETVA 3PUZF 4IT4A 3NRXA 2CPTA 2FJBA 3PDYA 5A1LA 3A8YC 1OWAA 2JQQA 3PV0F 2E9XA 3AB3B 1UURA 3AEFA 2FJAA 1CUNA 4A56A 4WBNE 1UX4A 2V6YB 5AQVB 3FZHB 1I6ZA 4KBMB 1HNXT 2JQHA 1GQEA 3AECA 4Z8XA 5AQNB 3CMLA 2WBLA 3C4XA 3I9WA 3RIFA 3AE5A 3ZMVB 3AEGA 2LSKA 4YJ3E 4TWDA 2LHNA 3JAEA 2CXLA 4YHHT 4UELA 1QSDA 2XY8B 3ZN0B 2V7LA 4J2CA 4EOZB 1BR0A 2E5VA 4ZI2C 2X9HA 2QGSA 3CVRA 3UUMA 4LFAT 3RYFE 4UV8B 3N9PA 3AA6B 4WBOA 2N2NA 4MHCA 4LF5T 2BKNA 5LBMA 2J4GA 5J2UE 4I4TE 4DV1T 4NXMT 4CXWA 1VCSA 3ONXA 1KNRA 4CN1A 1S94A 2CM0A 3ZSTA 1MMGA 4X64T 1HTJF 2E9XD 4EEBA 2BKOA 2Y8DA 1OEDB 3MA9A 3PUVF 3Q5EA 1L0VA 1WCRA 3TLUA 4QHOA 4O4IE 1X79A 3I0QA 5LJNA 2LM9A 2X9WA 3EDVA 3ZCIA 3QUJA 4G63A 4CN6A 2A9UA 1KNZA 3ZMZB 1NWMX 3RRWA 2XQ9A 4ADZA 1IBKT 3OYXA 3SOLA 3T8OA 5C2TA 3CQCB 4ISTA 4AIUA 4IL9A 3Q5XA 4ILBA 1O3XA 2M67A 5AQIB 3J9X1 3RPUA 3FZFB 5EK4A 1MMNA 1W0AA 2HPJA 4H9RC 1HG5A 4HN9A 2AXDS 2MTQA 4ISSA 4TV9E 3OYZA 2M6IA 3FZLB 3MZKB 3MK7C 3VR8A 5LXTE 5JREA 5AQTB 5LMUT 2W63A 4X20E 4C90A 1I94T 3N2KE 3DJBA 1YQ3A 3Q9DA 2WSSV 5GONE 4LFCT 2WY2A 3KFWX 2WQYA 4CN4A 3KVAA 1E1HB 3L39A 2D2SA 5HEUA 3VHLA 1N34T 3RQWA 1NENA 4UF0B 3N9LA 4X65T 2VQET 4YLHA 3FZMB 3ANWB 3OJAA 3PUWF 3N2GE 4WNKA 3WAJA 2KMFA 5ABEA 3T1YT 3AEBA 1OEDA 3OVUA 2JQ9A 4YJ2E 4X66T 4DV2T 3VRBA 2CCQA 2UXNB 4H9NC 5AQOB 5AQPB 4EV6A 5JH7E 4K0UA 4CZZB 4HFHA 4UVCB 3AVSA 2XJ7A 3UQ4A 1H7CA 5LNKA 1SA0E 2K24A 2KLQA 2QA7A 4UR9A 2K48A 1N33T 3OBVE 3P4PA 3NZPA 4AQGA 2DNXA 5L3FB 2D0UA 2JPFA 2DL1A 2VK9A 3N2OA 4H63V 1HF8A 2ODUA 2YDRA 3EVYA 4KHZF 5LHHB 4U72A 4X1YE 5AQFB 1ZEEA 3R6NA 1US7B 5DABA 3A5XA 2YU1A 1S35A 2ES0A 2VL8A 3L3PA 1WYBA 2LSGA 3O4XE 3Q5WA 4ILAA 4O8SA 5HWYA 2H7OA 5LBQB 2WWVA 3TLTA 3W15B 1WFDA 3SRZA 1KFYA 3ZMSB 1HNWT 4V1Av 4PJJA 2XPKA 4COFA 1VOMA 1X9BA 2HN2A 2E9XB 2BDEA 2BVMA 3NRYA 1HX1B 1E2AA 1NEKA 2RA1A 3I0OA 3LSVA 5LG3A 2MYSA 1WRDA 5CGMA 2WWUA 2C5KT 2X66A 5AQLB 1LKXA 4JI5T 3O1HA 1R8IA 3AE8A 1HX8A 2VKOA 1HCIA 3AA1B 3T1HT 1YKEB 3AEEA 1D0ZA 4YTPA 1XNRT 3ZN1B 1M62A 5AFUL 3VKGA 4PNIA 3P4RA 5ABGA 4WZXA 3UUXB 2E2AA 1QLBA 2XQ5A 3F57A 3LFMA 5FY7A 5FYMA 4YXDA 2WMNA 3K3OA 3CX8B 1IBMT 3DTOA 2H7VC 5AQJB 3MXZA 1XZYA 1ZP0A 3RIAA 1ZHCA 5LG4A 1UUSA 2XQAA 4KMCA 4AQYT 5H6QB 4ZHQE 5HWXA 3ETUA 5KXJA 5AQGB 3LK2B 1XMOT 1J5ET 4Z90A 3BQKA 4G2AA 4MFRA 1IAPA 5M4YA 1MNEA 4L9IA 2WU2A 4L0RA 3TLWA 4CI3B 3RKGA 5CJ5A 4DV6T 2CLYC 1W09A 1Y64B 3LG7A 3N9OA 5TAOA 3WAKA 3P7IA 4JI1T 4QH4A 1AJ3A 4PJMA 4LF7T 2IC6A 5AQHB 4IDZA 2KWHA 4HWHA 1G73A 5FMNA 3RI5A 3PJAA 3B57A 4IREA 4HEAA 2VKDA 2XTLA 1D1AA 4QXBB 2LT3A 3UQ7A 5J2TE 4ZZCA 2W61A 1ZKEA 4QXHB 2JRKA 3EUHA 2MAWA 4TNVA 4DV7T 2KXPB 2WZHA 4KI0F 3QC9A 3RKOA 5FY0A 3AAEB 3X1DA 2VVNA 3AXJA 3C64A 3NVOA 2XM2A 2Z6EA 2ZMAA 5FP3A 1J5WA 3N9MA 3QB5A 2E5LT 2N9DA 4JV5T 1IJ6A 3UU5A 2KNDA 5JRCA 3FXDB 4HWIB 3AE3A 4B3TT 3UULA 5HXSA 3C51A 3VU7H 3F31A 5C8YE 5J0ZA 5LYJE 4ZI3C 3PJAJ 4JBWF 4EZ4A 2LSYA 2JMHA 1MNDA 5FVLA 4HWDA 3UU8A 5KX5E 4JI0T 1QUUA 2BG9A 5JDFA 1FMVA 2X51A 4PK4A 2BS4A 2OLTA 1WYCA 2IW5B 4ZS3A 4ANJA 4GOUA 4ZOLE 4CI2B 3OTOT 5LHGB 2D5UA 2KZ7B 1IJ5A 1M7KA 4AKLA 3ZYKA 4O4LE 4AQFA 4YTNA 2BG9E 4DNDA 3L09A 2XAFB 2V1DB 4PW8A 4YTMA 3R84B 3UUNA 5LOVE 4GYSA 3ANWA 2FUPA 2E9XC 2VB6A 3DP7A 4HFBA 4CXYA 3ZC0A 4UIGA 4AQFC 3AE4A 2VVSA 3IHRA 5FKYA 2AE9A 3H3MA 3PTRB 4B3ST 4HKAA 2YKSA 2C5IT 3AEAA 1MMAA 4I55E 3LK42 4KX6A 4M1PA 2DI4A 2WM9A 4ZS2A 3HL6A 4IE5A 4ERRA 5AQSB 3IBPA 2UXBT 3HA4A 3ZYLA 4PAGA 4QKNA 5CFBA 3Q2MA 3UUBA 5BR8T 2QYWA 4E7SA 4WW0A 3ZEFB 2ZM6T 1OEDE 5JDMA 2LKGA 2GK9A 5CA1E 4IDNA 4JUYA 4DV4T 2EHOC 2X0YA 3PUAA 3AA0B 4ILUA 3ZC1A 3ZLIA 5L3EB 3K3QC 4U31A 4JLEA 3EHZA 1XMQT 3H3AA 5C3JA 4I43B 1KF6A 4EZHA 3K1SA 5DQVA 2WAUA 4HFDA 5JTGA 3RHWA 2CHNA 3AAAB 2CXFA 1T7SA 3OKQA 3Q5DA 4KUMB 3CQGB 1MIVA 1U5PA 4BA9A 3KINB 3U78A 3UFGA 4JI8T 2ZM0A 2CWOA 2E8IA 2IDOB 2W2UA 5ABFB 2CRBA 5L3CB 4IL4A 4YHJA 1UX5A 2IC9A 2V7MA 2V26A 3MKDA 4QH5A 3U3IA 1WLXA 5CB4E 3RLFF 5LGUB 2UUBT 2CXDA 3EAMA 1T98A 3ABVA 4U2ZA 2ACXA 2HN1A 2G0UA 3ZJ1A 3ZPOA 3O1IA 1KEYA 1D0XA 1JNRA 2WDRA 5HEGA 3FZKB 2WDQA 5HXRA 5IWAT 2X0HA 4PJLA 3N9NA 2W66A 4H9SE 4GK0E 2X0LB 5HCMA 1MIWA 4DV0T 3PUGA 1VCTA 3PURA 2IIUA 2X67A 1FEWA 3GA8A 4DR3T 4JYAT 5FL0A 5JDQA 3D0TA 1U4QA 5HEOA 2V8SV 2C5JA 2I59A 4BAYB 5KDMC 2L9QA 3C98B 1YD8G 3AXJB 3O1JA 2ODVA 3HKCE 1FIOA 3LJCA 3UFEA 2LRKA 2WCAA 4A5XA 5HAXA 5AQKB 4X1KE 4C91A 4DUZT 4O4JE 3RIUC 3F2EA 2SPCA 3RYIE 4OX9T 3ZMUB 1WR0A 2BZBA 4O4HE 2H3RA 3J7Yq 2Q9QC 2ZLYA 4LF6T 4F6RC 5FNVE 3AEDA 4HFEA 5JVDE 2V7KA 5AQRB 4X1IE 3RQUA 3VRAA 1LVKA 3C4WA 3CX6B 1XWMA 2LLYA 4HGAA 4MALA 5EK3A 2XQ7A 3FXEB 2LKHA 4ASKA 3CIRA 2NW7A 1B7TA 5JR9A 3QOFA 2V7IA 1BR4A 2HH7A 2KSRA 4NXNT 3JADA 3KBTA 5LHIB 3CX7B 2UXCT 4KHPT 2DCFA 2KWIB 3E22E 4Q25A 5HYAA 2WS3A 4NIQA 2I0MA 3PUSA 2XQ3A 2CBIA 2VKJA 3BQLA 3P50A 1YW0A 4NPPA 4X5TA 3UU6A 2YDSA 3P4QA 5HCJA 3PU3A 3TKLB 4U3CA 2NOXA 3JC6C 4YFSA 3ZT7A 4BJMA 3HKBE 3NKZA 3IEEA 2W67A 2V6YA 2X9YA 5ADXL 3ESLA 4AI6A 2JJ9A 5FXVA 1MMDA 1Z0PA 2HHHT 4U7IA 2CHOA 3NBXX 3LDQB 2EHOB 2JQKA 4IDQA 2W0GA 5FXXA 4YSXA 5JQGE 5FXZA 4IIJE 5LGNB 3TLVA 4DUYT 1IZNB 2I6HA 4YSYA 1HNZT 1T8BA 1XDOA 2QVAA 2X9XA 2CE7A 3ONJA 4IDOA 4IE0A 4H9OC 4TZ4C 5AQQB 4LFBT 1ZOYA 3TLSA 2B76A 3ZCJA 4TN7B 2XAQB 1HS7A 4ZXLA 3B13A 4ZZBA 5ABFA 4P1NA 2K3WA 1WR6A 4QX7B 5JRCB 2CA5A 4AKGA 5DJQC 3ZJ2A 4DR2T 1V9DA 2L3LA 4OK0A 2BG9C 3RC3A 4DR6T 1UK5A 4DMVA 2UXXB 3IF8B 4E7ZA 4UVBB 3EDUA 4EYUA 4Z91A 3K3NA 2LHRA 2NTXA 3RYHE 4EEDA 2LE8A 2JIWA 3KVBA 3LK3B 4UV9B 4EIWA 3PUQA 1FJGT 2IUBA 2XQ8A 2V5DA 2BS3A 1OEDC 3SS1A 5L3DB 1NAFA 2J62A 3JC6D 1Z8UA 2BKPA 3KV5A 4PJNA 5FY1A 1E7PA 2K9AA 4GYRA 2P9BA 3L8RA 2WDVA 4JI3T 4QXCB 3OPCA 1YKHB 5FVKA 5JDHA 3ZSSA 3H37A 3AAIA 2OA5A 4KP3C 3M65A 2B1EA 4L5GA 3FBLA 1XDPA 2X68A 4HFVA 4JI2T 4AKRB 3I9YA 4EXTA 5HXHA 1HG2A 3SFDA 2NTYA 4YSZA 2V7JA 2BBJA 2PJQA 1SHZC 2XSAA 3V5SA 2Q9QA 5LCYA 4XZCA 5LB7B 3S4UA 2YU2A 5L3BB 3QNUA 3K8PC 3N5LA 2EHOA 3QK6A 2EHOD 4U33A 4EYYR 5JDLA 5E0OA 3O9XA 4AKIA 4BJNA 3GN5B 1EZ3A 2XQ4A 4EGWA 3MACA 3VR9A 3HI2A 3AA7B 5JDNA 5JR9C 1N36T 4LF9T 4I0UA 4IE4A 3PUXF 2PBIA 2IMLA 4NUVA 3BK9A 5EK2A 4HTEA 4GIWA 1IBLT 2VURA 5J1GA 5FL1A 2DHRA 1SE7A 2M6BA 2XQ6A 3UU4A 3ZMTB 2VQFT 3SWHA 3RYCE 3RX6A 4F8HA 1W9RA 2ACZA 4GKKT 2WMOA 4CQIA 2DWGA 4DIDB 5F3JA 2LOSA 3HKEE 4QX8B 2YDQA 4CI1B 3CKDA 4IE6A 3FB2A 1LRZA 4PK5A 4U74A 3PE0A 4WYVA 2XM1A 4MLKA 3LBXB 3RF1A 2DWKA 4DBQA 5JDGA 4H63H 4PFOA 1CHUA 3JCFA 4HFIA 1KNPA 2PFVA 2L8KA 4H9QC 2NW8A 2YINA 4TNWA 1FMWA 3RC8A 3NZQA 2YN6A 4HWCA 5H6RB 2A2FX 2V5CA 3P4SA 5F5WA 5L4HA 2W62A 2WP9A 2XAGB 2LJLA 4FJOA 4ZEYA 5ABHA 5L2LA 5LMNT 4B3RT 1T72A 4CXXA 3JAFA 1KK7A 1G8XA 3GN5A 1UCUA 2NW9A 4X62T 3CWZB 2C0SA 3FHNA 2W4XA 2XASB 4IE7A 2KT9A 1LVFA 2H88A 2XSBA 3AE7A 4OYJA 2W00A 2YEVC 4OFZA 3A7MA 4DR7T 2XQYA 2PTFA 3M3ZB 2HPLA 4EB6E 4O2AE 2MBGA 1VRBA 3AE9A 3P4WA 2MOZA 5AQUB 3GMIA 1D1BA 2Q9QB 4LMKA 1BR1A 3CQXC 4P0BA 3ZT5A 3E0ZA 4DVDA 2UU9T 4DMWA 1D0YA 2BS2A 4B3MT 3E08A 4HFCA 2OV9A 2IHR1 2JMKA 4ZI2D 3AVRA 2LSIA 2XAJB 2NP9A 3GWHA 3RGLA 2LOPA 4QWNB 2BVLA 4TV8E 4UF0A 4YY3T 5LA6E 5AQMB 1ZV4X 5LJMA 4K0KT 2CEAA 1MIYA 1BR2A 2DLRA 3LBXA 4LF8T 4AISA 4EAHA 2QRXA 5IHYA 4JI4T 3SFEA 2MPKA 4B6XA 4U7YA 4IDPA 1HR0T 3UTKA 3P8CD 3KV4A 5IYZE 2FJEA 4OYKA 4P09A 4UEMA 2BBHA 4IGUA 4DO0A 5HXEA 2WZIA 2XUEA 3IA3A 2D9DA 5L47A 2ZM8A 5CA0E 2CLYB 1UGOA 4DV3T 2Y48B 1JNZA 4LMJA 4DR4T 5HEJA 4LMLA 3G06A 2J1DG 2WU5A 2YK0A 2RPAA 2PG8A 5L3GB 4DV5T 2K5BB 4ZI3D 2VWAA 3FBZA 4U2YA 3RH3A 4H9PC 2D0TA 4ILCA 4O2BE 2ZM2A 3ZT6A 1XNQT 3CPZA 3AE2A 4OHFA 4TUYE 1SUMB 2KINB 3B5MA 5F8PA 3HR0A 2H89A 2XAHB 4TWHA 3ZYMA 4IHJE 4AKHA 1YXRA 3UU3A 1HFAA 2RP4A 4HWFA 4LF4T 4PK6A 4UVAB 3HKDE 4DBRA 5KMGP 4N78D 4NUUA 2A72A 3PUYF 3UT5E 4ZI7E 2LRLA 4AXPA 3KV6A 3C50A 3AE1A 3MJXA 4A97A 2UUAT 3ONLC 5HEHA 2VL0A 4TX5A 5EZYE 2NR4A 3WI3A 3KBUA 2VASA 4DR1T 4JEHB 4TWFA 5LGTB 2UXDT 3C4ZA 2LM2A 3KV9A 3QB5K 4DR5T 3NWIA 4JEUB 4UXNB 2Y6XA 3VKHA 2FJDA 2XZEA 2CWYA 5DQWA 3RRCA 1Y01A 5LP6E 3N9QA 4QH1A 4PFPA 3ZKRA 1DU2A 1N32T 4MBQA 5HXCA 2XHEB 5JR9B 3CK6A 5FXWA 2UUCT 2N1GA 2YOEA 4JI7T 3KDSE 3AE6A 5ETWA 3PU8A 2BG9B 3EI0A 3EABA 1W0BA 4I50E 2F4VT 4XBFB 2WB5A 1J1JA 5IUXA 2NWBA 3RIUA 4A98A 4YT0A 5L4EA 1D1CA 4FI5A 3V5UA 2FBWA 3BQIA 4XAXB 1YQ4A 2LSJA 2R6GF 4JI6T 4HE8A
chains in the Genus database with same CATH topology
2XQ6A 2M6BA 5HCMA 3UU4A 4F8HA 2XQ5A 3RIAA 5HEJA 5HEOA 2XQAA 4Z90A 4HFIA 3TLWA 4TNWA 3RIFA 2YN6A 4QH4A 4TWDA 5L4HA 3JAEA 4HFEA 3JAFA 3RI5A 4IREA 3UQ7A 3RQUA 4ZZCA 2LLYA 2MAWA 4TNVA 2XQ7A 2LKHA 3P4WA 4LMKA 2KSRA 3JADA 4HFCA 1OEDB 4NPPA 4X5TA 2XQ3A 3TLUA 3P50A 3UU6A 5HCJA 3UU5A 5J0ZA 2XQ9A 3UU8A 2BG9A 4ILBA 4IL9A 3TLVA 2M6IA 2BG9E 5L47A 3TLSA 4LMJA 4LMLA 4ZZBA 4HFBA 5HEUA 4ILCA 3RQWA 2BG9C 2YKSA 4Z91A 1OEDA 4TWHA 3UU3A 5CFBA 4HFHA 3UUBA 3UQ4A 2XQ8A 1OEDE 2LKGA 1OEDC 4A97A 5HEHA 2VL0A 3EHZA 4TWFA 2LM2A 4HFDA 4ILAA 4QH1A 3RHWA 3TLTA 3ZKRA 2YOEA 4COFA 4IL4A 2BG9B 3EI0A 4QH5A 5IUXA 3EAMA 3LSVA 5LG3A 4A98A 5L4EA 2XQ4A 5HEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ6 A;  2M6B A;  5HCM A;  3UU4 A;  4F8H A;  2XQ5 A;  3RIA A;  5HEJ A;  5HEO A;  2XQA A;  4Z90 A;  4HFI A;  3TLW A;  4TNW A;  3RIF A;  2YN6 A;  4QH4 A;  4TWD A;  5L4H A;  3JAE A;  4HFE A;  3JAF A;  3RI5 A;  4IRE A;  3UQ7 A;  3RQU A;  4ZZC A;  2LLY A;  2MAW A;  4TNV A;  2XQ7 A;  2LKH A;  3P4W A;  4LMK A;  2KSR A;  3JAD A;  4HFC A;  1OED B;  4NPP A;  4X5T A;  2XQ3 A;  3TLU A;  3P50 A;  3UU6 A;  5HCJ A;  3UU5 A;  5J0Z A;  2XQ9 A;  3UU8 A;  2BG9 A;  4ILB A;  4IL9 A;  3TLV A;  2M6I A;  2BG9 E;  5L47 A;  3TLS A;  4LMJ A;  4LML A;  4ZZB A;  4HFB A;  5HEU A;  4ILC A;  3RQW A;  2BG9 C;  2YKS A;  4Z91 A;  1OED A;  4TWH A;  3UU3 A;  5CFB A;  4HFH A;  3UUB A;  3UQ4 A;  2XQ8 A;  1OED E;  2LKG A;  1OED C;  4A97 A;  5HEH A;  2VL0 A;  3EHZ A;  4TWF A;  2LM2 A;  4HFD A;  4ILA A;  4QH1 A;  3RHW A;  3TLT A;  3ZKR A;  2YOE A;  4COF A;  4IL4 A;  2BG9 B;  3EI0 A;  4QH5 A;  5IUX A;  3EAM A;  3LSV A;  5LG3 A;  4A98 A;  5L4E A;  2XQ4 A;  5HEG A; 
#chains in the Genus database with same CATH topology
 5BMV E;  2A3D A;  2VKH A;  4GK5 E;  4P0A A;  1OXZ A;  4GKJ T;  3I1A A;  2LEH A;  2Q9Q D;  2CBJ A;  2CMR A;  2J47 A;  2IAK A;  2V6X A;  3ETV A;  3PUZ F;  4IT4 A;  3NRX A;  2CPT A;  2FJB A;  3PDY A;  5A1L A;  3A8Y C;  1OWA A;  2JQQ A;  3PV0 F;  2E9X A;  3AB3 B;  1UUR A;  3AEF A;  2FJA A;  1CUN A;  4A56 A;  4WBN E;  1UX4 A;  2V6Y B;  5AQV B;  3FZH B;  1I6Z A;  4KBM B;  1HNX T;  2JQH A;  1GQE A;  3AEC A;  4Z8X A;  5AQN B;  3CML A;  2WBL A;  3C4X A;  3I9W A;  3RIF A;  3AE5 A;  3ZMV B;  3AEG A;  2LSK A;  4YJ3 E;  4TWD A;  2LHN A;  3JAE A;  2CXL A;  4YHH T;  4UEL A;  1QSD A;  2XY8 B;  3ZN0 B;  2V7L A;  4J2C A;  4EOZ B;  1BR0 A;  2E5V A;  4ZI2 C;  2X9H A;  2QGS A;  3CVR A;  3UUM A;  4LFA T;  3RYF E;  4UV8 B;  3N9P A;  3AA6 B;  4WBO A;  2N2N A;  4MHC A;  4LF5 T;  2BKN A;  5LBM A;  2J4G A;  5J2U E;  4I4T E;  4DV1 T;  4NXM T;  4CXW A;  1VCS A;  3ONX A;  1KNR A;  4CN1 A;  1S94 A;  2CM0 A;  3ZST A;  1MMG A;  4X64 T;  1HTJ F;  2E9X D;  4EEB A;  2BKO A;  2Y8D A;  1OED B;  3MA9 A;  3PUV F;  3Q5E A;  1L0V A;  1WCR A;  3TLU A;  4QHO A;  4O4I E;  1X79 A;  3I0Q A;  5LJN A;  2LM9 A;  2X9W A;  3EDV A;  3ZCI A;  3QUJ A;  4G63 A;  4CN6 A;  2A9U A;  1KNZ A;  3ZMZ B;  1NWM X;  3RRW A;  2XQ9 A;  4ADZ A;  1IBK T;  3OYX A;  3SOL A;  3T8O A;  5C2T A;  3CQC B;  4IST A;  4AIU A;  4IL9 A;  3Q5X A;  4ILB A;  1O3X A;  2M67 A;  5AQI B;  3J9X 1;  3RPU A;  3FZF B;  5EK4 A;  1MMN A;  1W0A A;  2HPJ A;  4H9R C;  1HG5 A;  4HN9 A;  2AXD S;  2MTQ A;  4ISS A;  4TV9 E;  3OYZ A;  2M6I A;  3FZL B;  3MZK B;  3MK7 C;  3VR8 A;  5LXT E;  5JRE A;  5AQT B;  5LMU T;  2W63 A;  4X20 E;  4C90 A;  1I94 T;  3N2K E;  3DJB A;  1YQ3 A;  3Q9D A;  2WSS V;  5GON E;  4LFC T;  2WY2 A;  3KFW X;  2WQY A;  4CN4 A;  3KVA A;  1E1H B;  3L39 A;  2D2S A;  5HEU A;  3VHL A;  1N34 T;  3RQW A;  1NEN A;  4UF0 B;  3N9L A;  4X65 T;  2VQE T;  4YLH A;  3FZM B;  3ANW B;  3OJA A;  3PUW F;  3N2G E;  4WNK A;  3WAJ A;  2KMF A;  5ABE A;  3T1Y T;  3AEB A;  1OED A;  3OVU A;  2JQ9 A;  4YJ2 E;  4X66 T;  4DV2 T;  3VRB A;  2CCQ A;  2UXN B;  4H9N C;  5AQO B;  5AQP B;  4EV6 A;  5JH7 E;  4K0U A;  4CZZ B;  4HFH A;  4UVC B;  3AVS A;  2XJ7 A;  3UQ4 A;  1H7C A;  5LNK A;  1SA0 E;  2K24 A;  2KLQ A;  2QA7 A;  4UR9 A;  2K48 A;  1N33 T;  3OBV E;  3P4P A;  3NZP A;  4AQG A;  2DNX A;  5L3F B;  2D0U A;  2JPF A;  2DL1 A;  2VK9 A;  3N2O A;  4H63 V;  1HF8 A;  2ODU A;  2YDR A;  3EVY A;  4KHZ F;  5LHH B;  4U72 A;  4X1Y E;  5AQF B;  1ZEE A;  3R6N A;  1US7 B;  5DAB A;  3A5X A;  2YU1 A;  1S35 A;  2ES0 A;  2VL8 A;  3L3P A;  1WYB A;  2LSG A;  3O4X E;  3Q5W A;  4ILA A;  4O8S A;  5HWY A;  2H7O A;  5LBQ B;  2WWV A;  3TLT A;  3W15 B;  1WFD A;  3SRZ A;  1KFY A;  3ZMS B;  1HNW T;  4V1A v;  4PJJ A;  2XPK A;  4COF A;  1VOM A;  1X9B A;  2HN2 A;  2E9X B;  2BDE A;  2BVM A;  3NRY A;  1HX1 B;  1E2A A;  1NEK A;  2RA1 A;  3I0O A;  3LSV A;  5LG3 A;  2MYS A;  1WRD A;  5CGM A;  2WWU A;  2C5K T;  2X66 A;  5AQL B;  1LKX A;  4JI5 T;  3O1H A;  1R8I A;  3AE8 A;  1HX8 A;  2VKO A;  1HCI A;  3AA1 B;  3T1H T;  1YKE B;  3AEE A;  1D0Z A;  4YTP A;  1XNR T;  3ZN1 B;  1M62 A;  5AFU L;  3VKG A;  4PNI A;  3P4R A;  5ABG A;  4WZX A;  3UUX B;  2E2A A;  1QLB A;  2XQ5 A;  3F57 A;  3LFM A;  5FY7 A;  5FYM A;  4YXD A;  2WMN A;  3K3O A;  3CX8 B;  1IBM T;  3DTO A;  2H7V C;  5AQJ B;  3MXZ A;  1XZY A;  1ZP0 A;  3RIA A;  1ZHC A;  5LG4 A;  1UUS A;  2XQA A;  4KMC A;  4AQY T;  5H6Q B;  4ZHQ E;  5HWX A;  3ETU A;  5KXJ A;  5AQG B;  3LK2 B;  1XMO T;  1J5E T;  4Z90 A;  3BQK A;  4G2A A;  4MFR A;  1IAP A;  5M4Y A;  1MNE A;  4L9I A;  2WU2 A;  4L0R A;  3TLW A;  4CI3 B;  3RKG A;  5CJ5 A;  4DV6 T;  2CLY C;  1W09 A;  1Y64 B;  3LG7 A;  3N9O A;  5TAO A;  3WAK A;  3P7I A;  4JI1 T;  4QH4 A;  1AJ3 A;  4PJM A;  4LF7 T;  2IC6 A;  5AQH B;  4IDZ A;  2KWH A;  4HWH A;  1G73 A;  5FMN A;  3RI5 A;  3PJA A;  3B57 A;  4IRE A;  4HEA A;  2VKD A;  2XTL A;  1D1A A;  4QXB B;  2LT3 A;  3UQ7 A;  5J2T E;  4ZZC A;  2W61 A;  1ZKE A;  4QXH B;  2JRK A;  3EUH A;  2MAW A;  4TNV A;  4DV7 T;  2KXP B;  2WZH A;  4KI0 F;  3QC9 A;  3RKO A;  5FY0 A;  3AAE B;  3X1D A;  2VVN A;  3AXJ A;  3C64 A;  3NVO A;  2XM2 A;  2Z6E A;  2ZMA A;  5FP3 A;  1J5W A;  3N9M A;  3QB5 A;  2E5L T;  2N9D A;  4JV5 T;  1IJ6 A;  3UU5 A;  2KND A;  5JRC A;  3FXD B;  4HWI B;  3AE3 A;  4B3T T;  3UUL A;  5HXS A;  3C51 A;  3VU7 H;  3F31 A;  5C8Y E;  5J0Z A;  5LYJ E;  4ZI3 C;  3PJA J;  4JBW F;  4EZ4 A;  2LSY A;  2JMH A;  1MND A;  5FVL A;  4HWD A;  3UU8 A;  5KX5 E;  4JI0 T;  1QUU A;  2BG9 A;  5JDF A;  1FMV A;  2X51 A;  4PK4 A;  2BS4 A;  2OLT A;  1WYC A;  2IW5 B;  4ZS3 A;  4ANJ A;  4GOU A;  4ZOL E;  4CI2 B;  3OTO T;  5LHG B;  2D5U A;  2KZ7 B;  1IJ5 A;  1M7K A;  4AKL A;  3ZYK A;  4O4L E;  4AQF A;  4YTN A;  2BG9 E;  4DND A;  3L09 A;  2XAF B;  2V1D B;  4PW8 A;  4YTM A;  3R84 B;  3UUN A;  5LOV E;  4GYS A;  3ANW A;  2FUP A;  2E9X C;  2VB6 A;  3DP7 A;  4HFB A;  4CXY A;  3ZC0 A;  4UIG A;  4AQF C;  3AE4 A;  2VVS A;  3IHR A;  5FKY A;  2AE9 A;  3H3M A;  3PTR B;  4B3S T;  4HKA A;  2YKS A;  2C5I T;  3AEA A;  1MMA A;  4I55 E;  3LK4 2;  4KX6 A;  4M1P A;  2DI4 A;  2WM9 A;  4ZS2 A;  3HL6 A;  4IE5 A;  4ERR A;  5AQS B;  3IBP A;  2UXB T;  3HA4 A;  3ZYL A;  4PAG A;  4QKN A;  5CFB A;  3Q2M A;  3UUB A;  5BR8 T;  2QYW A;  4E7S A;  4WW0 A;  3ZEF B;  2ZM6 T;  1OED E;  5JDM A;  2LKG A;  2GK9 A;  5CA1 E;  4IDN A;  4JUY A;  4DV4 T;  2EHO C;  2X0Y A;  3PUA A;  3AA0 B;  4ILU A;  3ZC1 A;  3ZLI A;  5L3E B;  3K3Q C;  4U31 A;  4JLE A;  3EHZ A;  1XMQ T;  3H3A A;  5C3J A;  4I43 B;  1KF6 A;  4EZH A;  3K1S A;  5DQV A;  2WAU A;  4HFD A;  5JTG A;  3RHW A;  2CHN A;  3AAA B;  2CXF A;  1T7S A;  3OKQ A;  3Q5D A;  4KUM B;  3CQG B;  1MIV A;  1U5P A;  4BA9 A;  3KIN B;  3U78 A;  3UFG A;  4JI8 T;  2ZM0 A;  2CWO A;  2E8I A;  2IDO B;  2W2U A;  5ABF B;  2CRB A;  5L3C B;  4IL4 A;  4YHJ A;  1UX5 A;  2IC9 A;  2V7M A;  2V26 A;  3MKD A;  4QH5 A;  3U3I A;  1WLX A;  5CB4 E;  3RLF F;  5LGU B;  2UUB T;  2CXD A;  3EAM A;  1T98 A;  3ABV A;  4U2Z A;  2ACX A;  2HN1 A;  2G0U A;  3ZJ1 A;  3ZPO A;  3O1I A;  1KEY A;  1D0X A;  1JNR A;  2WDR A;  5HEG A;  3FZK B;  2WDQ A;  5HXR A;  5IWA T;  2X0H A;  4PJL A;  3N9N A;  2W66 A;  4H9S E;  4GK0 E;  2X0L B;  5HCM A;  1MIW A;  4DV0 T;  3PUG A;  1VCT A;  3PUR A;  2IIU A;  2X67 A;  1FEW A;  3GA8 A;  4DR3 T;  4JYA T;  5FL0 A;  5JDQ A;  3D0T A;  1U4Q A;  5HEO A;  2V8S V;  2C5J A;  2I59 A;  4BAY B;  5KDM C;  2L9Q A;  3C98 B;  1YD8 G;  3AXJ B;  3O1J A;  2ODV A;  3HKC E;  1FIO A;  3LJC A;  3UFE A;  2LRK A;  2WCA A;  4A5X A;  5HAX A;  5AQK B;  4X1K E;  4C91 A;  4DUZ T;  4O4J E;  3RIU C;  3F2E A;  2SPC A;  3RYI E;  4OX9 T;  3ZMU B;  1WR0 A;  2BZB A;  4O4H E;  2H3R A;  3J7Y q;  2Q9Q C;  2ZLY A;  4LF6 T;  4F6R C;  5FNV E;  3AED A;  4HFE A;  5JVD E;  2V7K A;  5AQR B;  4X1I E;  3RQU A;  3VRA A;  1LVK A;  3C4W A;  3CX6 B;  1XWM A;  2LLY A;  4HGA A;  4MAL A;  5EK3 A;  2XQ7 A;  3FXE B;  2LKH A;  4ASK A;  3CIR A;  2NW7 A;  1B7T A;  5JR9 A;  3QOF A;  2V7I A;  1BR4 A;  2HH7 A;  2KSR A;  4NXN T;  3JAD A;  3KBT A;  5LHI B;  3CX7 B;  2UXC T;  4KHP T;  2DCF A;  2KWI B;  3E22 E;  4Q25 A;  5HYA A;  2WS3 A;  4NIQ A;  2I0M A;  3PUS A;  2XQ3 A;  2CBI A;  2VKJ A;  3BQL A;  3P50 A;  1YW0 A;  4NPP A;  4X5T A;  3UU6 A;  2YDS A;  3P4Q A;  5HCJ A;  3PU3 A;  3TKL B;  4U3C A;  2NOX A;  3JC6 C;  4YFS A;  3ZT7 A;  4BJM A;  3HKB E;  3NKZ A;  3IEE A;  2W67 A;  2V6Y A;  2X9Y A;  5ADX L;  3ESL A;  4AI6 A;  2JJ9 A;  5FXV A;  1MMD A;  1Z0P A;  2HHH T;  4U7I A;  2CHO A;  3NBX X;  3LDQ B;  2EHO B;  2JQK A;  4IDQ A;  2W0G A;  5FXX A;  4YSX A;  5JQG E;  5FXZ A;  4IIJ E;  5LGN B;  3TLV A;  4DUY T;  1IZN B;  2I6H A;  4YSY A;  1HNZ T;  1T8B A;  1XDO A;  2QVA A;  2X9X A;  2CE7 A;  3ONJ A;  4IDO A;  4IE0 A;  4H9O C;  4TZ4 C;  5AQQ B;  4LFB T;  1ZOY A;  3TLS A;  2B76 A;  3ZCJ A;  4TN7 B;  2XAQ B;  1HS7 A;  4ZXL A;  3B13 A;  4ZZB A;  5ABF A;  4P1N A;  2K3W A;  1WR6 A;  4QX7 B;  5JRC B;  2CA5 A;  4AKG A;  5DJQ C;  3ZJ2 A;  4DR2 T;  1V9D A;  2L3L A;  4OK0 A;  2BG9 C;  3RC3 A;  4DR6 T;  1UK5 A;  4DMV A;  2UXX B;  3IF8 B;  4E7Z A;  4UVB B;  3EDU A;  4EYU A;  4Z91 A;  3K3N A;  2LHR A;  2NTX A;  3RYH E;  4EED A;  2LE8 A;  2JIW A;  3KVB A;  3LK3 B;  4UV9 B;  4EIW A;  3PUQ A;  1FJG T;  2IUB A;  2XQ8 A;  2V5D A;  2BS3 A;  1OED C;  3SS1 A;  5L3D B;  1NAF A;  2J62 A;  3JC6 D;  1Z8U A;  2BKP A;  3KV5 A;  4PJN A;  5FY1 A;  1E7P A;  2K9A A;  4GYR A;  2P9B A;  3L8R A;  2WDV A;  4JI3 T;  4QXC B;  3OPC A;  1YKH B;  5FVK A;  5JDH A;  3ZSS A;  3H37 A;  3AAI A;  2OA5 A;  4KP3 C;  3M65 A;  2B1E A;  4L5G A;  3FBL A;  1XDP A;  2X68 A;  4HFV A;  4JI2 T;  4AKR B;  3I9Y A;  4EXT A;  5HXH A;  1HG2 A;  3SFD A;  2NTY A;  4YSZ A;  2V7J A;  2BBJ A;  2PJQ A;  1SHZ C;  2XSA A;  3V5S A;  2Q9Q A;  5LCY A;  4XZC A;  5LB7 B;  3S4U A;  2YU2 A;  5L3B B;  3QNU A;  3K8P C;  3N5L A;  2EHO A;  3QK6 A;  2EHO D;  4U33 A;  4EYY R;  5JDL A;  5E0O A;  3O9X A;  4AKI A;  4BJN A;  3GN5 B;  1EZ3 A;  2XQ4 A;  4EGW A;  3MAC A;  3VR9 A;  3HI2 A;  3AA7 B;  5JDN A;  5JR9 C;  1N36 T;  4LF9 T;  4I0U A;  4IE4 A;  3PUX F;  2PBI A;  2IML A;  4NUV A;  3BK9 A;  5EK2 A;  4HTE A;  4GIW A;  1IBL T;  2VUR A;  5J1G A;  5FL1 A;  2DHR A;  1SE7 A;  2M6B A;  2XQ6 A;  3UU4 A;  3ZMT B;  2VQF T;  3SWH A;  3RYC E;  3RX6 A;  4F8H A;  1W9R A;  2ACZ A;  4GKK T;  2WMO A;  4CQI A;  2DWG A;  4DID B;  5F3J A;  2LOS A;  3HKE E;  4QX8 B;  2YDQ A;  4CI1 B;  3CKD A;  4IE6 A;  3FB2 A;  1LRZ A;  4PK5 A;  4U74 A;  3PE0 A;  4WYV A;  2XM1 A;  4MLK A;  3LBX B;  3RF1 A;  2DWK A;  4DBQ A;  5JDG A;  4H63 H;  4PFO A;  1CHU A;  3JCF A;  4HFI A;  1KNP A;  2PFV A;  2L8K A;  4H9Q C;  2NW8 A;  2YIN A;  4TNW A;  1FMW A;  3RC8 A;  3NZQ A;  2YN6 A;  4HWC A;  5H6R B;  2A2F X;  2V5C A;  3P4S A;  5F5W A;  5L4H A;  2W62 A;  2WP9 A;  2XAG B;  2LJL A;  4FJO A;  4ZEY A;  5ABH A;  5L2L A;  5LMN T;  4B3R T;  1T72 A;  4CXX A;  3JAF A;  1KK7 A;  1G8X A;  3GN5 A;  1UCU A;  2NW9 A;  4X62 T;  3CWZ B;  2C0S A;  3FHN A;  2W4X A;  2XAS B;  4IE7 A;  2KT9 A;  1LVF A;  2H88 A;  2XSB A;  3AE7 A;  4OYJ A;  2W00 A;  2YEV C;  4OFZ A;  3A7M A;  4DR7 T;  2XQY A;  2PTF A;  3M3Z B;  2HPL A;  4EB6 E;  4O2A E;  2MBG A;  1VRB A;  3AE9 A;  3P4W A;  2MOZ A;  5AQU B;  3GMI A;  1D1B A;  2Q9Q B;  4LMK A;  1BR1 A;  3CQX C;  4P0B A;  3ZT5 A;  3E0Z A;  4DVD A;  2UU9 T;  4DMW A;  1D0Y A;  2BS2 A;  4B3M T;  3E08 A;  4HFC A;  2OV9 A;  2IHR 1;  2JMK A;  4ZI2 D;  3AVR A;  2LSI A;  2XAJ B;  2NP9 A;  3GWH A;  3RGL A;  2LOP A;  4QWN B;  2BVL A;  4TV8 E;  4UF0 A;  4YY3 T;  5LA6 E;  5AQM B;  1ZV4 X;  5LJM A;  4K0K T;  2CEA A;  1MIY A;  1BR2 A;  2DLR A;  3LBX A;  4LF8 T;  4AIS A;  4EAH A;  2QRX A;  5IHY A;  4JI4 T;  3SFE A;  2MPK A;  4B6X A;  4U7Y A;  4IDP A;  1HR0 T;  3UTK A;  3P8C D;  3KV4 A;  5IYZ E;  2FJE A;  4OYK A;  4P09 A;  4UEM A;  2BBH A;  4IGU A;  4DO0 A;  5HXE A;  2WZI A;  2XUE A;  3IA3 A;  2D9D A;  5L47 A;  2ZM8 A;  5CA0 E;  2CLY B;  1UGO A;  4DV3 T;  2Y48 B;  1JNZ A;  4LMJ A;  4DR4 T;  5HEJ A;  4LML A;  3G06 A;  2J1D G;  2WU5 A;  2YK0 A;  2RPA A;  2PG8 A;  5L3G B;  4DV5 T;  2K5B B;  4ZI3 D;  2VWA A;  3FBZ A;  4U2Y A;  3RH3 A;  4H9P C;  2D0T A;  4ILC A;  4O2B E;  2ZM2 A;  3ZT6 A;  1XNQ T;  3CPZ A;  3AE2 A;  4OHF A;  4TUY E;  1SUM B;  2KIN B;  3B5M A;  5F8P A;  3HR0 A;  2H89 A;  2XAH B;  4TWH A;  3ZYM A;  4IHJ E;  4AKH A;  1YXR A;  3UU3 A;  1HFA A;  2RP4 A;  4HWF A;  4LF4 T;  4PK6 A;  4UVA B;  3HKD E;  4DBR A;  5KMG P;  4N78 D;  4NUU A;  2A72 A;  3PUY F;  3UT5 E;  4ZI7 E;  2LRL A;  4AXP A;  3KV6 A;  3C50 A;  3AE1 A;  3MJX A;  4A97 A;  2UUA T;  3ONL C;  5HEH A;  2VL0 A;  4TX5 A;  5EZY E;  2NR4 A;  3WI3 A;  3KBU A;  2VAS A;  4DR1 T;  4JEH B;  4TWF A;  5LGT B;  2UXD T;  3C4Z A;  2LM2 A;  3KV9 A;  3QB5 K;  4DR5 T;  3NWI A;  4JEU B;  4UXN B;  2Y6X A;  3VKH A;  2FJD A;  2XZE A;  2CWY A;  5DQW A;  3RRC A;  1Y01 A;  5LP6 E;  3N9Q A;  4QH1 A;  4PFP A;  3ZKR A;  1DU2 A;  1N32 T;  4MBQ A;  5HXC A;  2XHE B;  5JR9 B;  3CK6 A;  5FXW A;  2UUC T;  2N1G A;  2YOE A;  4JI7 T;  3KDS E;  3AE6 A;  5ETW A;  3PU8 A;  2BG9 B;  3EI0 A;  3EAB A;  1W0B A;  4I50 E;  2F4V T;  4XBF B;  2WB5 A;  1J1J A;  5IUX A;  2NWB A;  3RIU A;  4A98 A;  4YT0 A;  5L4E A;  1D1C A;  4FI5 A;  3V5U A;  2FBW A;  3BQI A;  4XAX B;  1YQ4 A;  2LSJ A;  2R6G F;  4JI6 T;  4HE8 A; 
#chains in the Genus database with same CATH homology
 2XQ6 A;  2M6B A;  5HCM A;  3UU4 A;  4F8H A;  2XQ5 A;  3RIA A;  5HEJ A;  5HEO A;  2XQA A;  4Z90 A;  4HFI A;  3TLW A;  4TNW A;  3RIF A;  2YN6 A;  4QH4 A;  4TWD A;  5L4H A;  3JAE A;  4HFE A;  3JAF A;  3RI5 A;  4IRE A;  3UQ7 A;  3RQU A;  4ZZC A;  2LLY A;  2MAW A;  4TNV A;  2XQ7 A;  2LKH A;  3P4W A;  4LMK A;  2KSR A;  3JAD A;  4HFC A;  1OED B;  4NPP A;  4X5T A;  2XQ3 A;  3TLU A;  3P50 A;  3UU6 A;  5HCJ A;  3UU5 A;  5J0Z A;  2XQ9 A;  3UU8 A;  2BG9 A;  4ILB A;  4IL9 A;  3TLV A;  2M6I A;  2BG9 E;  5L47 A;  3TLS A;  4LMJ A;  4LML A;  4ZZB A;  4HFB A;  5HEU A;  4ILC A;  3RQW A;  2BG9 C;  2YKS A;  4Z91 A;  1OED A;  4TWH A;  3UU3 A;  5CFB A;  4HFH A;  3UUB A;  3UQ4 A;  2XQ8 A;  1OED E;  2LKG A;  1OED C;  4A97 A;  5HEH A;  2VL0 A;  3EHZ A;  4TWF A;  2LM2 A;  4HFD A;  4ILA A;  4QH1 A;  3RHW A;  3TLT A;  3ZKR A;  2YOE A;  4COF A;  4IL4 A;  2BG9 B;  3EI0 A;  4QH5 A;  5IUX A;  3EAM A;  3LSV A;  5LG3 A;  4A98 A;  5L4E A;  2XQ4 A;  5HEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...