2LM2A

Nmr structures of the transmembrane domains of the achr b2 subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NAEEEPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSSDSPSVGEYLMFTMVLVTFSIVTSVCVLNVHHRSPETHTGGGGGIDRLFLWIFVFVCVFGTIGMFLQPLFQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structures of the transmembrane domains of the a4b2 nAChR.
pubmed doi rcsb
molecule keywords Neuronal acetylcholine receptor subunit beta-2
molecule tags Transport protein
source organism Homo sapiens
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2lm2A01
3TLSA 2XQAA 5J0ZA 2LM2A 2XQ5A 4HFIA 2XQ3A 5HCMA 3P50A 3EI0A 3EHZA 4QH4A 3RIFA 5HEOA 4HFDA 3JAFA 2XQ4A 4A97A 2LLYA 4HFEA 3UU3A 2XQ6A 1OEDB 3UUBA 4F8HA 2XQ9A 2YKSA 3RQWA 4ILAA 3RQUA 2BG9B 4QH1A 4LMJA 2M6BA 3P4WA 2M6IA 3JADA 3TLUA 4TNVA 3ZKRA 2KSRA 1OEDE 3UU4A 5HCJA 2BG9E 4ILBA 2MAWA 4TWFA 5HEJA 3TLWA 2YN6A 4COFA 3JAEA 5L4HA 4ILCA 3UU8A 5CFBA 4NPPA 2XQ8A 4ZZBA 4HFCA 4TWHA 4LMKA 3RHWA 1OEDA 2YOEA 4IREA 4QH5A 4Z90A 4X5TA 3TLVA 2BG9A 2XQ7A 4IL4A 3TLTA 4IL9A 4A98A 3UU6A 3EAMA 4HFHA 3LSVA 2LKHA 3RI5A 5L4EA 5HEUA 5HEGA 1OEDC 3UU5A 5HEHA 4ZZCA 2LKGA 4Z91A 4TNWA 5LG3A 2BG9C 3RIAA 4TWDA 4HFBA 2VL0A 5IUXA 3UQ7A 4LMLA 3UQ4A 5L47A
chains in the Genus database with same CATH superfamily
4WBOA 4B3RT 4YLHA 1W0BA 3QOFA 2Y48B 2X67A 4PK6A 3FZLB 2N1GA 5LCYA 3N9PA 2BBJA 5FXWA 3GN5B 3HR0A 3G06A 3ESLA 4JI0T 4AXPA 4JYAT 3BQKA 4ILAA 1FMWA 2PFVA 5J2TE 3I0OA 4ZXLA 4I4TE 5H6QB 2I6HA 4DVDA 3RH3A 1CUNA 5L3BB 2EHOC 2NOXA 5KDMC 4H9NC 3PUSA 2WU5A 1KF6A 3HKEE 4B3MT 4GOUA 4U3CA 2CMRA 2UXXB 1WLXA 3RGLA 5JVDE 2V5CA 5E0OA 1U5PA 2BDEA 3N9NA 1X79A 2CPTA 2YOEA 3S4UA 4GKJT 2K48A 3OPCA 4L5GA 1HFAA 4HKAA 2K24A 3J9X1 3MXZA 3TLVA 1KNZA 1MIWA 4PFOA 2QVAA 2BVLA 3PTRB 3EAMA 1MMGA 3RI5A 4X1KE 4UEMA 3VR9A 3KV6A 4MFRA 2XAJB 3MK7C 2LSGA 3MJXA 3UQ4A 1QUUA 2KZ7B 2YDRA 4JI5T 4UV9B 3RYHE 2XUEA 4AKLA 4DV5T 1LVKA 3C50A 1VOMA 2LOSA 1S94A 2AE9A 2BVMA 4HE8A 4YTNA 4H63V 4UELA 3FZHB 3UU3A 4H9RC 1UCUA 1U4QA 3AA6B 4YFSA 5AQUB 3BQLA 1J1JA 3N2KE 4CZZB 1HG2A 4KX6A 3HKBE 2NTYA 2IC6A 2E5LT 4PK5A 1UX5A 2UUBT 3N9OA 4FI5A 5AQKB 2CM0A 2CHNA 3PUXF 2CWOA 5JREA 4AQGA 2KXPB 4LMKA 1OEDA 3AE4A 4QH5A 2JJ9A 3NZQA 3P4QA 2WSSV 4GKKT 1HNXT 4HFHA 3OYXA 3N5LA 4HTEA 4PW8A 2KMFA 2A72A 1G73A 3I9YA 1D0YA 4UIGA 5LHIB 4JI8T 4PFPA 4JI4T 3Q5WA 5KXJA 4LFCT 5AQHB 1FJGT 2WZIA 3NKZA 4X64T 4HEAA 3LBXA 5CB4E 2LM9A 4KP3C 3HKDE 4QH4A 4U33A 5HEOA 4P09A 5AQGB 2W61A 1GQEA 3VKHA 4DR3T 2XHEB 3ANWB 4O2AE 2IDOB 3AA1B 5TAOA 1ZKEA 2YINA 3VRAA 4Z8XA 4CXYA 3P4RA 4IE5A 2JPFA 2PG8A 3V5UA 2ZM2A 2CXDA 2XAGB 3AE9A 4QXBB 1I6ZA 4TUYE 3RLFF 1XZYA 4JI3T 3AAIA 2LSKA 3ZJ2A 2D0TA 2BS3A 2HPJA 1HS7A 3CQXC 4E7SA 5F3JA 4U7YA 3AE1A 3P4PA 5IHYA 4YJ2E 2WS3A 4ERRA 3C4XA 1D1AA 4IREA 4V1Av 4X5TA 4BJNA 2Q9QA 3AA0B 4YXDA 4ZZCA 2H7VC 2XTLA 3ZCJA 2CHOA 2RPAA 1BR4A 3QC9A 1DU2A 5ABGA 2CE7A 3GWHA 5HXSA 4TV8E 4JI2T 3P50A 2NR4A 3T1HT 5LHGB 3FB2A 4M1PA 5LBMA 3RX6A 2XQ6A 2D9DA 2XQ9A 4OX9T 2WWUA 1WYBA 5AQFB 1KK7A 3P4WA 2VVNA 4IDNA 2DHRA 4PAGA 2E2AA 2XZEA 4O2BE 4EYYR 1NWMX 5JDGA 2Q9QD 3EUHA 5JRCB 5HEJA 2V7JA 2L9QA 3GN5A 1XDOA 3UU8A 4GK5E 5AQNB 3RHWA 4A5XA 5FXVA 4X62T 2WDRA 3C98B 3UTKA 4I50E 3ZT5A 2ES0A 2EHOD 3RIUA 4QXCB 5L3EB 4IGUA 4ZI7E 1LRZA 2IUBA 1YD8G 5LYJE 2BG9C 4LF6T 4P1NA 4PJLA 3TLSA 4ADZA 5HWXA 3AEBA 3H3AA 2W4XA 2W0GA 5HAXA 3AXJB 2MTQA 3RYCE 3FZMB 4JV5T 3CQCB 2W66A 4DR6T 1BR2A 2BBHA 4EXTA 3AAEB 5KX5E 2CA5A 4P0BA 3P4SA 1ZV4X 3JADA 2M6IA 5LMNT 1L0VA 2KT9A 4IDPA 2KSRA 3RKOA 1JNRA 1E7PA 3AE8A 4EEBA 3JAEA 2IIUA 5FNVE 4ILCA 2LHRA 3B5MA 2CEAA 4DV3T 4AKHA 2QYWA 5LOVE 3M3ZB 4AQFA 3HI2A 2ACZA 4C91A 3DJBA 2RP4A 5C3JA 4IL4A 2AXDS 2NW9A 3A7MA 2EHOB 5HEHA 3QB5K 5LGUB 1HX8A 3EDUA 3ETUA 2R6GF 4DMVA 1XMQT 4Q25A 1HG5A 2V6YB 3FXDB 4HWCA 5BR8T 4F6RC 2LM2A 3ZMSB 2JRKA 1BR1A 4O4JE 2ZLYA 3KFWX 2DL1A 3W15B 5GONE 3RYIE 2X0YA 2XASB 1YKHB 3ONXA 5FXZA 1WFDA 2KWIB 2ODVA 3WAKA 3CMLA 2J62A 5AQQB 2KLQA 3VR8A 2VQET 2WY2A 1KFYA 3ZPOA 2YU2A 3I0QA 3RRWA 4LF7T 2NP9A 1HR0T 2C5IT 1NENA 2V7LA 2A9UA 3IEEA 3TLWA 4COFA 2JQQA 1IBLT 5FVKA 1S35A 2FBWA 4QX7B 5F8PA 5JR9C 5FY7A 2IAKA 3ANWA 3CX8B 1SA0E 3OTOT 3OKQA 4DMWA 4EB6E 4ZEYA 5LGTB 1E1HB 2FJAA 3LSVA 2PJQA 2HN1A 2HH7A 2N2NA 3ETVA 3U3IA 2E9XB 4DR7T 4LF8T 4U7IA 2VKHA 4H63H 1T72A 1FMVA 3ZYMA 2XQ3A 4ISTA 2CXLA 3ZMVB 1WYCA 1NAFA 2V5DA 4IIJE 3NZPA 2BKOA 3I1AA 2QA7A 2LLYA 4L0RA 2CCQA 2V7KA 1HTJF 4AQYT 4LF9T 3EVYA 1UX4A 3ZC1A 2BS4A 3GA8A 2VKDA 3CWZB 3CVRA 5C8YE 4KBMB 5AQOB 2J4GA 4OK0A 3IA3A 1Z8UA 4CI3B 5LNKA 2E5VA 4JI6T 5BMVE 4EGWA 1E2AA 3IBPA 4KHZF 2CLYC 2VQFT 3ONLC 4GYRA 4ZZBA 1UUSA 2MYSA 1MMNA 2XSBA 3AB3B 3MA9A 3PUQA 2DWGA 3BK9A 5AQJB 3FZKB 5M4YA 2OLTA 2WM9A 4O4HE 4PJMA 2E9XC 4A98A 4YSYA 2OV9A 3E0ZA 4I43B 2V7IA 3FBLA 3KBTA 3MACA 4AKIA 2V26A 2UUAT 4YJ3E 4JI7T 2VKJA 4IDZA 2WCAA 4B6XA 2W62A 3B57A 4HFBA 1X9BA 1B7TA 3KBUA 5JRCA 3ZJ1A 3K8PC 2ZMAA 1VRBA 2J47A 3RPUA 5LGNB 4OYKA 4IE6A 3O4XE 4HFDA 4QHOA 2OA5A 4ZI3C 2LSYA 1Y01A 2QRXA 1G8XA 2YKSA 2IMLA 2Y6XA 4LFAT 3E08A 4XAXB 5ETWA 5LJNA 3SFEA 2W00A 4NUUA 4G63A 1XNRT 5LA6E 2K9AA 3O1HA 2UXDT 4JEHB 3TLUA 4ZI2C 4UV8B 2A2FX 3I9WA 1M7KA 3DTOA 4NUVA 3AAAB 5JDFA 1Z0PA 4QXHB 1ZOYA 2UXNB 2XM2A 3L39A 4KMCA 3ZYKA 3R84B 4IT4A 3AXJA 3KDSE 2X9HA 1OXZA 2WB5A 3M65A 2LT3A 3CKDA 3H37A 4UF0A 4UVBB 3TLTA 5JDQA 4IL9A 1SUMB 3RRCA 4B3TT 3NRXA 1IZNB 2JQHA 4ILUA 5HEGA 5HEUA 4DV4T 3VRBA 4BAYB 3V5SA 1FEWA 4JLEA 5HXHA 4FJOA 1YXRA 3J7Yq 4LMLA 3LK42 4ZHQE 4WYVA 1HNZT 3C64A 2X9WA 3P7IA 2W2UA 2ZM8A 2NWBA 4J2CA 4U74A 4PNIA 1IBKT 2V6XA 1KEYA 1VCTA 4X66T 4AKGA 3OVUA 4U72A 5HYAA 3PV0F 1M62A 5ADXL 1LKXA 2EHOA 3ZYLA 2BG9B 2DCFA 4KUMB 3JCFA 4DNDA 3ZMZB 3LG7A 4KI0F 2C0SA 3IF8B 3FBZA 5FL0A 3PU8A 5JDNA 1JNZA 2XAHB 3HL6A 2PBIA 4EOZB 2BG9E 1QSDA 2ZM0A 2FUPA 3CX7B 4GIWA 2CBIA 2YN6A 4WBNE 5EZYE 1IJ5A 1ZHCA 2XQ8A 4QWNB 3O1IA 5C2TA 1MIYA 5AQTB 2BKNA 5LBQB 3KVBA 2CWYA 2HHHT 3KINB 3C4WA 5EK2A 2LKGA 2MPKA 1HCIA 5IYZE 2VL8A 4GYSA 4O4IE 2VKOA 2SPCA 2H88A 3N9MA 3UT5E 5DABA 4TZ4C 3X1DA 2DWKA 3CIRA 3MZKB 2H3RA 1BR0A 1YW0A 2DI4A 2A3DA 4XZCA 3ZN0B 4DV6T 1MNDA 2KINB 4CI2B 1NEKA 4YY3T 4ZS2A 1WRDA 4O8SA 4JUYA 2E9XA 4YTMA 1XNQT 3LBXB 4XBFB 2M6BA 2XAFB 3BQIA 2VURA 2C5KT 4PK4A 3VKGA 1CHUA 3UU4A 4K0UA 5HCJA 1T7SA 3ZSSA 3AEFA 5AFUL 2WWVA 2NW8A 1IAPA 5CFBA 4UVCB 4H9QC 4DR5T 4DR1T 1XWMA 2WAUA 4HFCA 2ACXA 1UGOA 3PUYF 4BJMA 5HXRA 3OYZA 5AQLB 3F2EA 3HA4A 3T8OA 4HWIB 1OEDC 2X9YA 3VU7H 3B13A 3PURA 4WZXA 3WAJA 1XMOT 3WI3A 1MNEA 3ZCIA 3FHNA 3AEEA 4DV2T 3UQ7A 5JR9B 4CN1A 4DR2T 3ZT7A 3NVOA 3FZFB 2LSIA 2LHNA 4LF4T 2V7MA 3JC6C 2E9XD 2H89A 2VVSA 3CK6A 5CJ5A 4ISSA 2JQKA 2DNXA 1I94T 1HX1B 4U2ZA 1SE7A 3UUBA 2E8IA 3C4ZA 2L3LA 4UR9A 2LRLA 4DBRA 5FL1A 3UULA 4YSZA 3T1YT 5LG4A 2X9XA 3A5XA 1EZ3A 3Q9DA 5LMUT 4ZI3D 5JH7E 3AE7A 3F57A 3N2GE 4MHCA 4QKNA 4BA9A 2V1DB 5ABEA 5L4HA 4C90A 3PUZF 2KWHA 3MKDA 5AQMB 2WBLA 3KV9A 1YKEB 4CN6A 3K1SA 4ZI2D 3AE2A 4CI1B 2VB6A 1IJ6A 2Z6EA 4A56A 4AIUA 5DJQC 3AE6A 2LKHA 1D0XA 5FY0A 4DV0T 4DUYT 2CLYB 2Q9QC 3AEAA 4TWDA 1N34T 5L47A 2L8KA 4KHPT 3SRZA 4IHJE 5FKYA 4HFIA 3HKCE 3O9XA 2J1DG 3P8CD 3QUJA 3O1JA 3RYFE 2XM1A 3AVSA 5J1GA 4TX5A 4YT0A 1O3XA 3UUMA 5CGMA 1YQ4A 4F8HA 3RQWA 2LE8A 3ZC0A 4H9OC 5CA1E 4QH1A 3C51A 3AVRA 4X1IE 1QLBA 3PUVF 4MALA 2XQYA 2G0UA 4CQIA 4AISA 4DBQA 4L9IA 2LJLA 2JQ9A 5J2UE 5A1LA 4GK0E 4ILBA 4ASKA 3R6NA 5FXXA 3SWHA 2WU2A 3N2OA 3UUNA 1MMDA 3OJAA 5IWAT 3Q5EA 4X65T 2WMOA 4OHFA 4N78D 2JMKA 3ZT6A 3ZEFB 4IDQA 4YTPA 2X0HA 4EZHA 2BG9A 2RA1A 5JDHA 3U78A 2P9BA 2UUCT 5LP6E 4JI1T 2MOZA 5AQRB 5EK4A 2LEHA 4TNWA 5L3DB 2YDSA 5AQPB 1VCSA 3RIUC 2C5JA 3FXEB 3H3MA 5J0ZA 4NXMT 1WR6A 2W63A 3K3OA 3EI0A 5LJMA 1V9DA 5L3GB 1YQ3A 3JAFA 2XQ4A 5L2LA 2UU9T 3L3PA 2IW5B 2CXFA 4NXNT 4DIDB 4P0AA 3RQUA 4K0KT 2I0MA 4DUZT 4DV1T 2XAQB 2IHR1 2XJ7A 1N32T 5H6RB 4QX8B 5LB7B 2X66A 4G2AA 3ZSTA 4LF5T 3LK3B 2ODUA 5HXEA 4IE4A 5ABFB 3PE0A 3TKLB 3F31A 3AE5A 4NPPA 2YU1A 2VWAA 3PUAA 4Z90A 5DQWA 4TN7B 3LDQB 3UU6A 2IC9A 2GK9A 3UFGA 5L4EA 2X0LB 2ZM6T 2CBJA 3UU5A 2D0UA 4AQFC 2D5UA 5LG3A 3QNUA 4YHJA 1N36T 3LK2B 3RIAA 4H9SE 2WZHA 2VASA 4CXWA 5ABHA 4IE0A 3CQGB 4OYJA 1AJ3A 2XQ5A 4DO0A 5HCMA 3ABVA 5FYMA 4ANJA 2WQYA 4HWFA 2WP9A 1SHZC 2UXCT 2WMNA 3LFMA 4UVAB 5JQGE 3ZMUB 2FJEA 5JDMA 2LRKA 4IDOA 4ZOLE 1UURA 4DR4T 2H7OA 3JC6D 5JR9A 3ZLIA 3KV5A 4HN9A 5JTGA 3RC3A 4EIWA 1KNRA 1XDPA 4TWFA 3AE3A 4U2YA 4YSXA 5FMNA 1US7B 3KVAA 2V6YA 2PTFA 4TWHA 3ZMTB 1W09A 2B1EA 3RC8A 3K3NA 5L3FB 4UXNB 4WW0A 2X51A 3GMIA 4X1YE 3KV4A 4JBWF 4YHHT 3AEGA 3PUGA 3PU3A 3AEDA 2WDQA 5CA0E 2YK0A 3PDYA 1HF8A 5LXTE 3L09A 2BZBA 4O4LE 5JDLA 4B3ST 2XQAA 3RF1A 2CRBA 1W0AA 1HNWT 4CXXA 4HWHA 4HFVA 1KNPA 3AECA 5DQVA 3RIFA 5AQSB 4PJJA 4EZ4A 3CPZA 3CX6B 4HFEA 5F5WA 1OEDB 2I59A 3EDVA 2V8SV 2F4VT 5AQIB 2B76A 5HWYA 2W67A 5FY1A 4JEUB 2FJDA 4TNVA 3ZKRA 1OEDE 2Y8DA 4OFZA 3A8YC 3DP7A 2FJBA 3NBXX 2DLRA 3ONJA 1MIVA 2BS2A 3SFDA 2MAWA 4I55E 5LHHB 4AKRB 3N9LA 1H7CA 1J5ET 4EAHA 3NWIA 3ZN1B 1J5WA 3AA7B 1MMAA 4MBQA 1D1BA 1OWAA 3SOLA 2HPLA 2YDQA 4EEDA 2LOPA 3K3QC 3QK6A 4WNKA 3IHRA 5L3CB 4HWDA 4PJNA 4H9PC 4I0UA 5AQVB 3LJCA 3NRYA 4MLKA 3PUWF 4TV9E 1ZP0A 2N9DA 3PJAJ 3N9QA 1D0ZA 2XSAA 4HGAA 1T98A 2XPKA 4EYUA 3PJAA 5IUXA 1Y64B 2BKPA 2HN2A 1ZEEA 3Q5XA 4UF0B 1UK5A 2UXBT 5KMGP 3EHZA 2NW7A 1WCRA 4A97A 1T8BA 3RKGA 3UFEA 3L8RA 1N33T 4CN4A 2KNDA 4E7ZA 2Q9QB 4LMJA 4EV6A 2XY8B 3Q5DA 3Q2MA 5HXCA 2QGSA 3VHLA 3UUXB 2M67A 1LVFA 4U31A 4IE7A 2JMHA 2MBGA 2VK9A 1W9RA 2LSJA 2WDVA 1D1CA 2NTXA 5FP3A 3SS1A 2K5BB 4X20E 5FVLA 3EABA 3E22E 2XQ7A 3OBVE 1WR0A 4ZS3A 2D2SA 2YEVC 3D0TA 3QB5A 1FIOA 1IBMT 2JIWA 4Z91A 4NIQA 4AI6A 1R8IA 2VL0A 5ABFA 2X68A 5EK3A 4DV7T 2K3WA 4LFBT
chains in the Genus database with same CATH topology
3TLSA 2XQAA 5J0ZA 2LM2A 2XQ5A 4HFIA 2XQ3A 5HCMA 3P50A 3EI0A 3EHZA 4QH4A 3RIFA 5HEOA 4HFDA 3JAFA 2XQ4A 4A97A 2LLYA 4HFEA 3UU3A 2XQ6A 1OEDB 3UUBA 4F8HA 2XQ9A 2YKSA 3RQWA 4ILAA 3RQUA 2BG9B 4QH1A 4LMJA 2M6BA 3P4WA 2M6IA 3JADA 3TLUA 4TNVA 3ZKRA 2KSRA 1OEDE 3UU4A 5HCJA 2BG9E 4ILBA 2MAWA 4TWFA 5HEJA 3TLWA 2YN6A 4COFA 3JAEA 5L4HA 4ILCA 3UU8A 5CFBA 4NPPA 2XQ8A 4ZZBA 4HFCA 4TWHA 4LMKA 3RHWA 1OEDA 2YOEA 4IREA 4QH5A 4Z90A 4X5TA 3TLVA 2BG9A 2XQ7A 4IL4A 3TLTA 4IL9A 4A98A 3UU6A 3EAMA 4HFHA 3LSVA 2LKHA 3RI5A 5L4EA 5HEUA 5HEGA 1OEDC 3UU5A 5HEHA 4ZZCA 2LKGA 4Z91A 4TNWA 5LG3A 2BG9C 3RIAA 4TWDA 4HFBA 2VL0A 5IUXA 3UQ7A 4LMLA 3UQ4A 5L47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLS A;  2XQA A;  5J0Z A;  2LM2 A;  2XQ5 A;  4HFI A;  2XQ3 A;  5HCM A;  3P50 A;  3EI0 A;  3EHZ A;  4QH4 A;  3RIF A;  5HEO A;  4HFD A;  3JAF A;  2XQ4 A;  4A97 A;  2LLY A;  4HFE A;  3UU3 A;  2XQ6 A;  1OED B;  3UUB A;  4F8H A;  2XQ9 A;  2YKS A;  3RQW A;  4ILA A;  3RQU A;  2BG9 B;  4QH1 A;  4LMJ A;  2M6B A;  3P4W A;  2M6I A;  3JAD A;  3TLU A;  4TNV A;  3ZKR A;  2KSR A;  1OED E;  3UU4 A;  5HCJ A;  2BG9 E;  4ILB A;  2MAW A;  4TWF A;  5HEJ A;  3TLW A;  2YN6 A;  4COF A;  3JAE A;  5L4H A;  4ILC A;  3UU8 A;  5CFB A;  4NPP A;  2XQ8 A;  4ZZB A;  4HFC A;  4TWH A;  4LMK A;  3RHW A;  1OED A;  2YOE A;  4IRE A;  4QH5 A;  4Z90 A;  4X5T A;  3TLV A;  2BG9 A;  2XQ7 A;  4IL4 A;  3TLT A;  4IL9 A;  4A98 A;  3UU6 A;  3EAM A;  4HFH A;  3LSV A;  2LKH A;  3RI5 A;  5L4E A;  5HEU A;  5HEG A;  1OED C;  3UU5 A;  5HEH A;  4ZZC A;  2LKG A;  4Z91 A;  4TNW A;  5LG3 A;  2BG9 C;  3RIA A;  4TWD A;  4HFB A;  2VL0 A;  5IUX A;  3UQ7 A;  4LML A;  3UQ4 A;  5L47 A; 
#chains in the Genus database with same CATH topology
 4WBO A;  4B3R T;  4YLH A;  1W0B A;  3QOF A;  2Y48 B;  2X67 A;  4PK6 A;  3FZL B;  2N1G A;  5LCY A;  3N9P A;  2BBJ A;  5FXW A;  3GN5 B;  3HR0 A;  3G06 A;  3ESL A;  4JI0 T;  4AXP A;  4JYA T;  3BQK A;  4ILA A;  1FMW A;  2PFV A;  5J2T E;  3I0O A;  4ZXL A;  4I4T E;  5H6Q B;  2I6H A;  4DVD A;  3RH3 A;  1CUN A;  5L3B B;  2EHO C;  2NOX A;  5KDM C;  4H9N C;  3PUS A;  2WU5 A;  1KF6 A;  3HKE E;  4B3M T;  4GOU A;  4U3C A;  2CMR A;  2UXX B;  1WLX A;  3RGL A;  5JVD E;  2V5C A;  5E0O A;  1U5P A;  2BDE A;  3N9N A;  1X79 A;  2CPT A;  2YOE A;  3S4U A;  4GKJ T;  2K48 A;  3OPC A;  4L5G A;  1HFA A;  4HKA A;  2K24 A;  3J9X 1;  3MXZ A;  3TLV A;  1KNZ A;  1MIW A;  4PFO A;  2QVA A;  2BVL A;  3PTR B;  3EAM A;  1MMG A;  3RI5 A;  4X1K E;  4UEM A;  3VR9 A;  3KV6 A;  4MFR A;  2XAJ B;  3MK7 C;  2LSG A;  3MJX A;  3UQ4 A;  1QUU A;  2KZ7 B;  2YDR A;  4JI5 T;  4UV9 B;  3RYH E;  2XUE A;  4AKL A;  4DV5 T;  1LVK A;  3C50 A;  1VOM A;  2LOS A;  1S94 A;  2AE9 A;  2BVM A;  4HE8 A;  4YTN A;  4H63 V;  4UEL A;  3FZH B;  3UU3 A;  4H9R C;  1UCU A;  1U4Q A;  3AA6 B;  4YFS A;  5AQU B;  3BQL A;  1J1J A;  3N2K E;  4CZZ B;  1HG2 A;  4KX6 A;  3HKB E;  2NTY A;  2IC6 A;  2E5L T;  4PK5 A;  1UX5 A;  2UUB T;  3N9O A;  4FI5 A;  5AQK B;  2CM0 A;  2CHN A;  3PUX F;  2CWO A;  5JRE A;  4AQG A;  2KXP B;  4LMK A;  1OED A;  3AE4 A;  4QH5 A;  2JJ9 A;  3NZQ A;  3P4Q A;  2WSS V;  4GKK T;  1HNX T;  4HFH A;  3OYX A;  3N5L A;  4HTE A;  4PW8 A;  2KMF A;  2A72 A;  1G73 A;  3I9Y A;  1D0Y A;  4UIG A;  5LHI B;  4JI8 T;  4PFP A;  4JI4 T;  3Q5W A;  5KXJ A;  4LFC T;  5AQH B;  1FJG T;  2WZI A;  3NKZ A;  4X64 T;  4HEA A;  3LBX A;  5CB4 E;  2LM9 A;  4KP3 C;  3HKD E;  4QH4 A;  4U33 A;  5HEO A;  4P09 A;  5AQG B;  2W61 A;  1GQE A;  3VKH A;  4DR3 T;  2XHE B;  3ANW B;  4O2A E;  2IDO B;  3AA1 B;  5TAO A;  1ZKE A;  2YIN A;  3VRA A;  4Z8X A;  4CXY A;  3P4R A;  4IE5 A;  2JPF A;  2PG8 A;  3V5U A;  2ZM2 A;  2CXD A;  2XAG B;  3AE9 A;  4QXB B;  1I6Z A;  4TUY E;  3RLF F;  1XZY A;  4JI3 T;  3AAI A;  2LSK A;  3ZJ2 A;  2D0T A;  2BS3 A;  2HPJ A;  1HS7 A;  3CQX C;  4E7S A;  5F3J A;  4U7Y A;  3AE1 A;  3P4P A;  5IHY A;  4YJ2 E;  2WS3 A;  4ERR A;  3C4X A;  1D1A A;  4IRE A;  4V1A v;  4X5T A;  4BJN A;  2Q9Q A;  3AA0 B;  4YXD A;  4ZZC A;  2H7V C;  2XTL A;  3ZCJ A;  2CHO A;  2RPA A;  1BR4 A;  3QC9 A;  1DU2 A;  5ABG A;  2CE7 A;  3GWH A;  5HXS A;  4TV8 E;  4JI2 T;  3P50 A;  2NR4 A;  3T1H T;  5LHG B;  3FB2 A;  4M1P A;  5LBM A;  3RX6 A;  2XQ6 A;  2D9D A;  2XQ9 A;  4OX9 T;  2WWU A;  1WYB A;  5AQF B;  1KK7 A;  3P4W A;  2VVN A;  4IDN A;  2DHR A;  4PAG A;  2E2A A;  2XZE A;  4O2B E;  4EYY R;  1NWM X;  5JDG A;  2Q9Q D;  3EUH A;  5JRC B;  5HEJ A;  2V7J A;  2L9Q A;  3GN5 A;  1XDO A;  3UU8 A;  4GK5 E;  5AQN B;  3RHW A;  4A5X A;  5FXV A;  4X62 T;  2WDR A;  3C98 B;  3UTK A;  4I50 E;  3ZT5 A;  2ES0 A;  2EHO D;  3RIU A;  4QXC B;  5L3E B;  4IGU A;  4ZI7 E;  1LRZ A;  2IUB A;  1YD8 G;  5LYJ E;  2BG9 C;  4LF6 T;  4P1N A;  4PJL A;  3TLS A;  4ADZ A;  5HWX A;  3AEB A;  3H3A A;  2W4X A;  2W0G A;  5HAX A;  3AXJ B;  2MTQ A;  3RYC E;  3FZM B;  4JV5 T;  3CQC B;  2W66 A;  4DR6 T;  1BR2 A;  2BBH A;  4EXT A;  3AAE B;  5KX5 E;  2CA5 A;  4P0B A;  3P4S A;  1ZV4 X;  3JAD A;  2M6I A;  5LMN T;  1L0V A;  2KT9 A;  4IDP A;  2KSR A;  3RKO A;  1JNR A;  1E7P A;  3AE8 A;  4EEB A;  3JAE A;  2IIU A;  5FNV E;  4ILC A;  2LHR A;  3B5M A;  2CEA A;  4DV3 T;  4AKH A;  2QYW A;  5LOV E;  3M3Z B;  4AQF A;  3HI2 A;  2ACZ A;  4C91 A;  3DJB A;  2RP4 A;  5C3J A;  4IL4 A;  2AXD S;  2NW9 A;  3A7M A;  2EHO B;  5HEH A;  3QB5 K;  5LGU B;  1HX8 A;  3EDU A;  3ETU A;  2R6G F;  4DMV A;  1XMQ T;  4Q25 A;  1HG5 A;  2V6Y B;  3FXD B;  4HWC A;  5BR8 T;  4F6R C;  2LM2 A;  3ZMS B;  2JRK A;  1BR1 A;  4O4J E;  2ZLY A;  3KFW X;  2DL1 A;  3W15 B;  5GON E;  3RYI E;  2X0Y A;  2XAS B;  1YKH B;  3ONX A;  5FXZ A;  1WFD A;  2KWI B;  2ODV A;  3WAK A;  3CML A;  2J62 A;  5AQQ B;  2KLQ A;  3VR8 A;  2VQE T;  2WY2 A;  1KFY A;  3ZPO A;  2YU2 A;  3I0Q A;  3RRW A;  4LF7 T;  2NP9 A;  1HR0 T;  2C5I T;  1NEN A;  2V7L A;  2A9U A;  3IEE A;  3TLW A;  4COF A;  2JQQ A;  1IBL T;  5FVK A;  1S35 A;  2FBW A;  4QX7 B;  5F8P A;  5JR9 C;  5FY7 A;  2IAK A;  3ANW A;  3CX8 B;  1SA0 E;  3OTO T;  3OKQ A;  4DMW A;  4EB6 E;  4ZEY A;  5LGT B;  1E1H B;  2FJA A;  3LSV A;  2PJQ A;  2HN1 A;  2HH7 A;  2N2N A;  3ETV A;  3U3I A;  2E9X B;  4DR7 T;  4LF8 T;  4U7I A;  2VKH A;  4H63 H;  1T72 A;  1FMV A;  3ZYM A;  2XQ3 A;  4IST A;  2CXL A;  3ZMV B;  1WYC A;  1NAF A;  2V5D A;  4IIJ E;  3NZP A;  2BKO A;  3I1A A;  2QA7 A;  2LLY A;  4L0R A;  2CCQ A;  2V7K A;  1HTJ F;  4AQY T;  4LF9 T;  3EVY A;  1UX4 A;  3ZC1 A;  2BS4 A;  3GA8 A;  2VKD A;  3CWZ B;  3CVR A;  5C8Y E;  4KBM B;  5AQO B;  2J4G A;  4OK0 A;  3IA3 A;  1Z8U A;  4CI3 B;  5LNK A;  2E5V A;  4JI6 T;  5BMV E;  4EGW A;  1E2A A;  3IBP A;  4KHZ F;  2CLY C;  2VQF T;  3ONL C;  4GYR A;  4ZZB A;  1UUS A;  2MYS A;  1MMN A;  2XSB A;  3AB3 B;  3MA9 A;  3PUQ A;  2DWG A;  3BK9 A;  5AQJ B;  3FZK B;  5M4Y A;  2OLT A;  2WM9 A;  4O4H E;  4PJM A;  2E9X C;  4A98 A;  4YSY A;  2OV9 A;  3E0Z A;  4I43 B;  2V7I A;  3FBL A;  3KBT A;  3MAC A;  4AKI A;  2V26 A;  2UUA T;  4YJ3 E;  4JI7 T;  2VKJ A;  4IDZ A;  2WCA A;  4B6X A;  2W62 A;  3B57 A;  4HFB A;  1X9B A;  1B7T A;  3KBU A;  5JRC A;  3ZJ1 A;  3K8P C;  2ZMA A;  1VRB A;  2J47 A;  3RPU A;  5LGN B;  4OYK A;  4IE6 A;  3O4X E;  4HFD A;  4QHO A;  2OA5 A;  4ZI3 C;  2LSY A;  1Y01 A;  2QRX A;  1G8X A;  2YKS A;  2IML A;  2Y6X A;  4LFA T;  3E08 A;  4XAX B;  5ETW A;  5LJN A;  3SFE A;  2W00 A;  4NUU A;  4G63 A;  1XNR T;  5LA6 E;  2K9A A;  3O1H A;  2UXD T;  4JEH B;  3TLU A;  4ZI2 C;  4UV8 B;  2A2F X;  3I9W A;  1M7K A;  3DTO A;  4NUV A;  3AAA B;  5JDF A;  1Z0P A;  4QXH B;  1ZOY A;  2UXN B;  2XM2 A;  3L39 A;  4KMC A;  3ZYK A;  3R84 B;  4IT4 A;  3AXJ A;  3KDS E;  2X9H A;  1OXZ A;  2WB5 A;  3M65 A;  2LT3 A;  3CKD A;  3H37 A;  4UF0 A;  4UVB B;  3TLT A;  5JDQ A;  4IL9 A;  1SUM B;  3RRC A;  4B3T T;  3NRX A;  1IZN B;  2JQH A;  4ILU A;  5HEG A;  5HEU A;  4DV4 T;  3VRB A;  4BAY B;  3V5S A;  1FEW A;  4JLE A;  5HXH A;  4FJO A;  1YXR A;  3J7Y q;  4LML A;  3LK4 2;  4ZHQ E;  4WYV A;  1HNZ T;  3C64 A;  2X9W A;  3P7I A;  2W2U A;  2ZM8 A;  2NWB A;  4J2C A;  4U74 A;  4PNI A;  1IBK T;  2V6X A;  1KEY A;  1VCT A;  4X66 T;  4AKG A;  3OVU A;  4U72 A;  5HYA A;  3PV0 F;  1M62 A;  5ADX L;  1LKX A;  2EHO A;  3ZYL A;  2BG9 B;  2DCF A;  4KUM B;  3JCF A;  4DND A;  3ZMZ B;  3LG7 A;  4KI0 F;  2C0S A;  3IF8 B;  3FBZ A;  5FL0 A;  3PU8 A;  5JDN A;  1JNZ A;  2XAH B;  3HL6 A;  2PBI A;  4EOZ B;  2BG9 E;  1QSD A;  2ZM0 A;  2FUP A;  3CX7 B;  4GIW A;  2CBI A;  2YN6 A;  4WBN E;  5EZY E;  1IJ5 A;  1ZHC A;  2XQ8 A;  4QWN B;  3O1I A;  5C2T A;  1MIY A;  5AQT B;  2BKN A;  5LBQ B;  3KVB A;  2CWY A;  2HHH T;  3KIN B;  3C4W A;  5EK2 A;  2LKG A;  2MPK A;  1HCI A;  5IYZ E;  2VL8 A;  4GYS A;  4O4I E;  2VKO A;  2SPC A;  2H88 A;  3N9M A;  3UT5 E;  5DAB A;  4TZ4 C;  3X1D A;  2DWK A;  3CIR A;  3MZK B;  2H3R A;  1BR0 A;  1YW0 A;  2DI4 A;  2A3D A;  4XZC A;  3ZN0 B;  4DV6 T;  1MND A;  2KIN B;  4CI2 B;  1NEK A;  4YY3 T;  4ZS2 A;  1WRD A;  4O8S A;  4JUY A;  2E9X A;  4YTM A;  1XNQ T;  3LBX B;  4XBF B;  2M6B A;  2XAF B;  3BQI A;  2VUR A;  2C5K T;  4PK4 A;  3VKG A;  1CHU A;  3UU4 A;  4K0U A;  5HCJ A;  1T7S A;  3ZSS A;  3AEF A;  5AFU L;  2WWV A;  2NW8 A;  1IAP A;  5CFB A;  4UVC B;  4H9Q C;  4DR5 T;  4DR1 T;  1XWM A;  2WAU A;  4HFC A;  2ACX A;  1UGO A;  3PUY F;  4BJM A;  5HXR A;  3OYZ A;  5AQL B;  3F2E A;  3HA4 A;  3T8O A;  4HWI B;  1OED C;  2X9Y A;  3VU7 H;  3B13 A;  3PUR A;  4WZX A;  3WAJ A;  1XMO T;  3WI3 A;  1MNE A;  3ZCI A;  3FHN A;  3AEE A;  4DV2 T;  3UQ7 A;  5JR9 B;  4CN1 A;  4DR2 T;  3ZT7 A;  3NVO A;  3FZF B;  2LSI A;  2LHN A;  4LF4 T;  2V7M A;  3JC6 C;  2E9X D;  2H89 A;  2VVS A;  3CK6 A;  5CJ5 A;  4ISS A;  2JQK A;  2DNX A;  1I94 T;  1HX1 B;  4U2Z A;  1SE7 A;  3UUB A;  2E8I A;  3C4Z A;  2L3L A;  4UR9 A;  2LRL A;  4DBR A;  5FL1 A;  3UUL A;  4YSZ A;  3T1Y T;  5LG4 A;  2X9X A;  3A5X A;  1EZ3 A;  3Q9D A;  5LMU T;  4ZI3 D;  5JH7 E;  3AE7 A;  3F57 A;  3N2G E;  4MHC A;  4QKN A;  4BA9 A;  2V1D B;  5ABE A;  5L4H A;  4C90 A;  3PUZ F;  2KWH A;  3MKD A;  5AQM B;  2WBL A;  3KV9 A;  1YKE B;  4CN6 A;  3K1S A;  4ZI2 D;  3AE2 A;  4CI1 B;  2VB6 A;  1IJ6 A;  2Z6E A;  4A56 A;  4AIU A;  5DJQ C;  3AE6 A;  2LKH A;  1D0X A;  5FY0 A;  4DV0 T;  4DUY T;  2CLY B;  2Q9Q C;  3AEA A;  4TWD A;  1N34 T;  5L47 A;  2L8K A;  4KHP T;  3SRZ A;  4IHJ E;  5FKY A;  4HFI A;  3HKC E;  3O9X A;  2J1D G;  3P8C D;  3QUJ A;  3O1J A;  3RYF E;  2XM1 A;  3AVS A;  5J1G A;  4TX5 A;  4YT0 A;  1O3X A;  3UUM A;  5CGM A;  1YQ4 A;  4F8H A;  3RQW A;  2LE8 A;  3ZC0 A;  4H9O C;  5CA1 E;  4QH1 A;  3C51 A;  3AVR A;  4X1I E;  1QLB A;  3PUV F;  4MAL A;  2XQY A;  2G0U A;  4CQI A;  4AIS A;  4DBQ A;  4L9I A;  2LJL A;  2JQ9 A;  5J2U E;  5A1L A;  4GK0 E;  4ILB A;  4ASK A;  3R6N A;  5FXX A;  3SWH A;  2WU2 A;  3N2O A;  3UUN A;  1MMD A;  3OJA A;  5IWA T;  3Q5E A;  4X65 T;  2WMO A;  4OHF A;  4N78 D;  2JMK A;  3ZT6 A;  3ZEF B;  4IDQ A;  4YTP A;  2X0H A;  4EZH A;  2BG9 A;  2RA1 A;  5JDH A;  3U78 A;  2P9B A;  2UUC T;  5LP6 E;  4JI1 T;  2MOZ A;  5AQR B;  5EK4 A;  2LEH A;  4TNW A;  5L3D B;  2YDS A;  5AQP B;  1VCS A;  3RIU C;  2C5J A;  3FXE B;  3H3M A;  5J0Z A;  4NXM T;  1WR6 A;  2W63 A;  3K3O A;  3EI0 A;  5LJM A;  1V9D A;  5L3G B;  1YQ3 A;  3JAF A;  2XQ4 A;  5L2L A;  2UU9 T;  3L3P A;  2IW5 B;  2CXF A;  4NXN T;  4DID B;  4P0A A;  3RQU A;  4K0K T;  2I0M A;  4DUZ T;  4DV1 T;  2XAQ B;  2IHR 1;  2XJ7 A;  1N32 T;  5H6R B;  4QX8 B;  5LB7 B;  2X66 A;  4G2A A;  3ZST A;  4LF5 T;  3LK3 B;  2ODU A;  5HXE A;  4IE4 A;  5ABF B;  3PE0 A;  3TKL B;  3F31 A;  3AE5 A;  4NPP A;  2YU1 A;  2VWA A;  3PUA A;  4Z90 A;  5DQW A;  4TN7 B;  3LDQ B;  3UU6 A;  2IC9 A;  2GK9 A;  3UFG A;  5L4E A;  2X0L B;  2ZM6 T;  2CBJ A;  3UU5 A;  2D0U A;  4AQF C;  2D5U A;  5LG3 A;  3QNU A;  4YHJ A;  1N36 T;  3LK2 B;  3RIA A;  4H9S E;  2WZH A;  2VAS A;  4CXW A;  5ABH A;  4IE0 A;  3CQG B;  4OYJ A;  1AJ3 A;  2XQ5 A;  4DO0 A;  5HCM A;  3ABV A;  5FYM A;  4ANJ A;  2WQY A;  4HWF A;  2WP9 A;  1SHZ C;  2UXC T;  2WMN A;  3LFM A;  4UVA B;  5JQG E;  3ZMU B;  2FJE A;  5JDM A;  2LRK A;  4IDO A;  4ZOL E;  1UUR A;  4DR4 T;  2H7O A;  3JC6 D;  5JR9 A;  3ZLI A;  3KV5 A;  4HN9 A;  5JTG A;  3RC3 A;  4EIW A;  1KNR A;  1XDP A;  4TWF A;  3AE3 A;  4U2Y A;  4YSX A;  5FMN A;  1US7 B;  3KVA A;  2V6Y A;  2PTF A;  4TWH A;  3ZMT B;  1W09 A;  2B1E A;  3RC8 A;  3K3N A;  5L3F B;  4UXN B;  4WW0 A;  2X51 A;  3GMI A;  4X1Y E;  3KV4 A;  4JBW F;  4YHH T;  3AEG A;  3PUG A;  3PU3 A;  3AED A;  2WDQ A;  5CA0 E;  2YK0 A;  3PDY A;  1HF8 A;  5LXT E;  3L09 A;  2BZB A;  4O4L E;  5JDL A;  4B3S T;  2XQA A;  3RF1 A;  2CRB A;  1W0A A;  1HNW T;  4CXX A;  4HWH A;  4HFV A;  1KNP A;  3AEC A;  5DQV A;  3RIF A;  5AQS B;  4PJJ A;  4EZ4 A;  3CPZ A;  3CX6 B;  4HFE A;  5F5W A;  1OED B;  2I59 A;  3EDV A;  2V8S V;  2F4V T;  5AQI B;  2B76 A;  5HWY A;  2W67 A;  5FY1 A;  4JEU B;  2FJD A;  4TNV A;  3ZKR A;  1OED E;  2Y8D A;  4OFZ A;  3A8Y C;  3DP7 A;  2FJB A;  3NBX X;  2DLR A;  3ONJ A;  1MIV A;  2BS2 A;  3SFD A;  2MAW A;  4I55 E;  5LHH B;  4AKR B;  3N9L A;  1H7C A;  1J5E T;  4EAH A;  3NWI A;  3ZN1 B;  1J5W A;  3AA7 B;  1MMA A;  4MBQ A;  1D1B A;  1OWA A;  3SOL A;  2HPL A;  2YDQ A;  4EED A;  2LOP A;  3K3Q C;  3QK6 A;  4WNK A;  3IHR A;  5L3C B;  4HWD A;  4PJN A;  4H9P C;  4I0U A;  5AQV B;  3LJC A;  3NRY A;  4MLK A;  3PUW F;  4TV9 E;  1ZP0 A;  2N9D A;  3PJA J;  3N9Q A;  1D0Z A;  2XSA A;  4HGA A;  1T98 A;  2XPK A;  4EYU A;  3PJA A;  5IUX A;  1Y64 B;  2BKP A;  2HN2 A;  1ZEE A;  3Q5X A;  4UF0 B;  1UK5 A;  2UXB T;  5KMG P;  3EHZ A;  2NW7 A;  1WCR A;  4A97 A;  1T8B A;  3RKG A;  3UFE A;  3L8R A;  1N33 T;  4CN4 A;  2KND A;  4E7Z A;  2Q9Q B;  4LMJ A;  4EV6 A;  2XY8 B;  3Q5D A;  3Q2M A;  5HXC A;  2QGS A;  3VHL A;  3UUX B;  2M67 A;  1LVF A;  4U31 A;  4IE7 A;  2JMH A;  2MBG A;  2VK9 A;  1W9R A;  2LSJ A;  2WDV A;  1D1C A;  2NTX A;  5FP3 A;  3SS1 A;  2K5B B;  4X20 E;  5FVL A;  3EAB A;  3E22 E;  2XQ7 A;  3OBV E;  1WR0 A;  4ZS3 A;  2D2S A;  2YEV C;  3D0T A;  3QB5 A;  1FIO A;  1IBM T;  2JIW A;  4Z91 A;  4NIQ A;  4AI6 A;  1R8I A;  2VL0 A;  5ABF A;  2X68 A;  5EK3 A;  4DV7 T;  2K3W A;  4LFB T; 
#chains in the Genus database with same CATH homology
 3TLS A;  2XQA A;  5J0Z A;  2LM2 A;  2XQ5 A;  4HFI A;  2XQ3 A;  5HCM A;  3P50 A;  3EI0 A;  3EHZ A;  4QH4 A;  3RIF A;  5HEO A;  4HFD A;  3JAF A;  2XQ4 A;  4A97 A;  2LLY A;  4HFE A;  3UU3 A;  2XQ6 A;  1OED B;  3UUB A;  4F8H A;  2XQ9 A;  2YKS A;  3RQW A;  4ILA A;  3RQU A;  2BG9 B;  4QH1 A;  4LMJ A;  2M6B A;  3P4W A;  2M6I A;  3JAD A;  3TLU A;  4TNV A;  3ZKR A;  2KSR A;  1OED E;  3UU4 A;  5HCJ A;  2BG9 E;  4ILB A;  2MAW A;  4TWF A;  5HEJ A;  3TLW A;  2YN6 A;  4COF A;  3JAE A;  5L4H A;  4ILC A;  3UU8 A;  5CFB A;  4NPP A;  2XQ8 A;  4ZZB A;  4HFC A;  4TWH A;  4LMK A;  3RHW A;  1OED A;  2YOE A;  4IRE A;  4QH5 A;  4Z90 A;  4X5T A;  3TLV A;  2BG9 A;  2XQ7 A;  4IL4 A;  3TLT A;  4IL9 A;  4A98 A;  3UU6 A;  3EAM A;  4HFH A;  3LSV A;  2LKH A;  3RI5 A;  5L4E A;  5HEU A;  5HEG A;  1OED C;  3UU5 A;  5HEH A;  4ZZC A;  2LKG A;  4Z91 A;  4TNW A;  5LG3 A;  2BG9 C;  3RIA A;  4TWD A;  4HFB A;  2VL0 A;  5IUX A;  3UQ7 A;  4LML A;  3UQ4 A;  5L47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...