2LM3A

Structure of the rhesus monkey trim5alpha pryspry domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
205
structure length
205
Chain Sequence
TELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Ligase
molecule keywords Tripartite motif-containing protein 5
total genus 36
structure length 205
sequence length 205
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lm3A00
4N7IA 4X8NA 2YYOA 4KG0A 5F6KA 3KB5A 4WVMA 3UV9A 2FBEA 2IWGB 4V1PA 2YUEA 4P9LA 5JI7A 2VOKA 4QT6A 5JI9A 4WVMB 2WL1A 4X8PA 5JIAA 2E63A 4XW3A 2LM3A 4B3NA 4N7UA 5JIUA 4B8EA 4P9JA 3ZO0B 5F6LB 5C33A 4P9IA 3TOJA
chains in the Genus database with same CATH superfamily
1Y9GA 3N7LA 4JC1A 1F4HA 3PUIA 1QKQA 5D8AB 2ZTNA 4FAHA 4IGOA 4M3CF 2QQJA 3ZKYA 3JQWA 3VBSC 5CG9A 2PLV3 3BALA 1Y4WA 3B7MA 5JXGA 1ODNA 4I3PA 1JZ4A 4EN9B 3N9OA 4U2AA 4CCOA 1FXZA 2HLEA 2VQ0A 3LFIA 3FZ3A 2ERFA 3I2GA 2JE9A 5EZWA 1NXMA 4AEDA 5JWPA 5DAVA 1R091 4JGZA 3ZMNA 3ZXKA 2VAUA 3AZYA 3F95A 3AYAA 1DQ6A 3C7FA 1FPN3 1QQP1 3LB9A 5FLJA 5AC91 3TOJA 3WINE 1ULEA 1QH6A 2GMEA 1PX4A 1OD5A 1H9PA 4LLFA 5FPXA 3T0BA 4CP9B 1OF4A 2QFEA 4XEZA 4LKDA 4E2GA 1JOBA 4W8JA 5FTTC 5C3SA 5DDJ1 4R52A 5FP7A 1R1A2 4BWOA 4WM7B 3WP6A 1OF3A 2J1UA 3KHCA 3AKSA 4P9WA 5B4XA 4DEQA 3PIJA 1IZ3A 2WA3A 1VAVA 5I0DA 3WUCA 3NKGA 5A3WA 5LRRA 3ZSEA 5FZCA 4RHV2 4XUNA 4AFAA 5B4NA 1JZ5A 1RUC1 1RITA 2DTWA 3HQXA 5FOJB 5K0UC 2ZGTA 1R081 3N7JA 1GQPA 3WNMA 5LWBA 5KXBA 3ZM8A 2UYBA 4XBNA 4A7ZA 3SH4A 4Y1XA 4CDUB 4OHXA 2JDUA 2WFPA 3I54A 5F2SA 5GLUA 5I91A 2VBDA 2HWD2 4Y1ZA 2JDKA 4UFIA 1WCSA 5DG1A 5BNNB 1DQ1A 1HB2A 2DVGA 5C8WA 1Z7S3 3ROUA 4E2SA 1ZZBA 4AGGA 1VBA2 4LLOA 4MH0E 2WO3A 4FPJA 5A3UA 1IQDC 1PK6B 1ASJ1 1LR5A 3DYMA 4O65A 2Q8EA 5HCAA 5T5OA 4G4FA 4AFDA 3AP6A 3GBFA 5I0SA 3LAGA 5AVAA 1SLBA 2WNUC 2W2IA 4EYUA 1RUG3 1W90A 5LBCA 4LE3A 4HLTA 2WZ8A 3BTYA 1W2NA 3M8LA 4CU6A 4E9KA 2AGSA 4FOVA 5A6YA 3NQHA 4M4RA 2BFUS 2Y60A 5BNQA 1O8SA 3IB3A 1PIV3 5GZGA 1R1ZA 1W9FA 1UOGA 2R32A 1RXGA 3JQXA 3RJRA 1E5HA 3GJAA 4XMAA 5KWRA 5FYVA 2WNUB 1LNSA 2V73A 3DGTA 3MUZ1 3VD3A 3DECA 3ME2A 4GB33 1K12A 1GBGA 1VBB1 1DU3D 2VZOA 3GYDA 4L97A 4YGCA 3MV11 4YZ1A 2D6MA 3H3LA 2LUWA 4IGPA 3ZDSA 4BXFA 1W6OB 2P17A 2VO5A 3ZXLA 2OVUA 1C5IA 3O7OA 4HFSA 5CEHA 5F37A 2GH8A 4Y20A 4JDMA 4QPGA 2FZ2A 1QQP2 5AC92 3K51A 1OXCA 1W04A 3TBDA 2WO2A 3VD5A 1DF0A 2GNDA 2ZGQA 4YGDA 5T5JA 3VBOA 3IIIA 3I2DA 3Q8CA 4EROA 4FTEA 1RVF1 1PO13 4YW5A 3O1SA 1K45A 4M3CB 2PAKA 4A6SA 1F15A 4LT5A 3GHMA 1JH5A 1TQ5A 4H3WA 2R16A 2VW0A 2OYZA 2CDOA 4Z2AA 3OBRA 1FX5A 4XUQA 1VB2A 4AVVA 4Y22A 4JGZB 3GCXA 4DQAA 1JS9A 1B35B 4FFFA 2DFCA 3UK9A 3N7MA 1O6UA 3BU0A 2Z79A 3MW3A 1RINA 2VZSA 5L7OC 4ARXA 3UT0A 4AR2A 4CDUA 4WBBA 2HKXA 3FLTA 2BGOA 3WF1A 2DYCA 3OD0A 3WG2A 4QKBA 4XETA 1YIFA 5JI9A 3OF1A 4XBLA 4MGKE 3K2OA 2D44A 3A23A 3HOBA 4FFIA 4FFHA 4YW1A 3VKOA 3CJIC 1C57A 4AFBA 2W39A 3LIHA 4G9SB 2DVAA 3UYJA 3ZYBA 3SLIA 2O1QA 4H7MA 4BQ1A 4JQTA 4KGQA 4B3NA 3WZ1A 1JBCA 1VBA1 3B5LB 2EALA 1IG0A 2VZUA 4KWUA 3WQ7A 1JYNA 5IVVA 4FOYA 2W5FA 5CBLA 3ZFGA 1N3OA 4OZXA 1CN1A 3RWNA 5LEKA 3ILFA 2J7MA 3PDQA 4XQDA 3ZN4A 3GZAA 1H6XA 4HETA 5CIRA 1H2KA 3KV5A 3C2UA 4AVCA 1N1VA 4AAPA 1V00A 1UXXX 4WM8B 2ZAHA 1DQ2A 4YVWB 1IHMA 4UW5A 4QPIB 4XAEA 3ZN6A 5FZFA 5DDJ2 4MGSA 4DY5A 2ZHKA 1K5JA 1VR3A 3POSA 3WT3A 5A6ZA 1LEDA 3HJRA 3T4VA 1J1TA 3HQUA 3WQBA 2CNAA 4OMDA 4KI5M 4JCKA 2P4EA 3N9MA 2BBVA 3PTYA 2LW8A 4XJ9A 4RR3C 3I97A 4XF1A 3CJXA 4D94A 3MGUA 2K46A 2R061 2VCBA 4BIOA 1PGSA 1F8VA 3EJKA 1YC61 1FNZA 2DU0A 5IYYA 1J59A 3NJVA 5FCCA 5L19A 1AR82 5FXWA 5L9VA 1GOFA 1MVEA 1X33A 3UJQA 3W21A 2TUNA 5F5CA 2OIIA 3R0RA 3LEIA 1CAUA 2YMZA 2C0ZA 3SH3A 5GLWA 3KQ4B 5FYTA 1GWMA 3RMXA 1S0DA 4LQRA 1KGYA 1GMMA 5LZ6A 1HV1A 3DEMA 3WDTA 1B35A 4GIQA 4U36A 1UX6A 3I2OA 3MIBA 3VUOA 2QDNA 4PDWA 2W1SA 1UZWA 3PL0A 4LBJA 1DGRN 1RGSA 2JICA 3WY6A 1SPPB 4FQZA 2E9QA 2VY0A 5L36A 3E6CC 4YFZA 1WMEA 3O1OA 3OGSA 1Q3EA 3WSOA 4FOWA 1S1AA 3UGFA 1C8M3 4AI0A 5FY9A 4GAZA 4PBOA 4CPBA 1ZREA 1OH3A 4Q0SA 4RSUA 1FOD3 1I5PA 1UYYA 2LM3A 1WLTA 2WO1A 2ZX4A 4OHVA 1A78A 5DZFA 4RGGA 3POBA 3E97A 4GWNA 2A5ZA 2VVEA 4JKMA 5A3OA 3H8RA 1JYIA 2HWE1 1Y3TA 5FYZA 3ZFEB 2XUMA 3HR9A 5J7MA 3WF4A 1TE1B 4IV1A 2HWC1 2ZEWA 3KCXA 1LGCA 4H7LA 3H9AA 1GNHA 3P5BA 4AG4A 3MDPA 4DNYA 1ULDA 2W91A 1PVC1 4M01A 2FCTA 4IGQA 3OUIA 2RVAA 1XE0A 4XDQA 4Y1VA 3P1IA 3OGRA 5EYYA 1UZ0A 2NYYA 2QVSB 1KD7A 2ORZA 4CXYA 3I3QA 4XXPA 1CZSA 3RQ0A 1W99A 3WF0A 4JGYC 2QQWA 1SCSA 1W05A 3QACA 2B39A 2B8MA 1ZA4A 1QIQA 3ST7A 3ZR6A 2XL7A 5EQUA 2R0FA 5I8YA 2OS2A 2WZR1 1TVGA 2E6VA 2VZVA 3PLQA 2Y0OA 4OZOA 4CCKA 2Y0IA 1UZVA 1YEWA 4LO8A 3KWVA 1JUIA 1QJX2 1S55A 3AYEA 3I3EA 1ENXA 3VBUB 4Q5OA 4CEWC 4YW3A 1W6PB 3OPTA 1HQLA 4IL7A 1HRV3 4Y4YA 1J3PA 1W8HA 2RS13 4UT5A 5FQ0A 4D69A 1T6GC 3BTAA 3WDYA 2ZHLA 3JUUA 3B02A 3M4FA 4JVAA 4HG6B 1WBLA 3AC0A 3DKQA 2IC1A 4QKNA 1YQCA 4R9AA 4XFCA 4AAXA 4BQ4A 4CP9A 3RZKA 2Q8DA 3HIFA 2ZKLA 3OGGA 2CWMA 2D3SA 4IEWA 5A7WB 4YW2A 2IXKA 1ENSA 3VDBA 2IFRA 2B42B 2D6PA 2R49A 2WS92 3GBGA 4QU1A 4YFWA 1VLNA 3U4SA 3HVDA 4KBZA 4CDQA 1JOPA 4Q4X3 3NNJA 1G9CA 4MADA 4CVUA 1D4M1 1L7LA 1MR5A 3MLLA 4GMP1 1DGLA 3FWEA 1G7YA 1OMIA 3BIWE 4BLJA 4FSJA 1RUE3 5F3IA 5KXDA 4L99A 1HJGA 4CDXB 3UKVA 4XUOA 2WKKA 4NAMA 4Q4W1 4MHUA 4LBQD 1EV11 4A2UA 3ASIA 4S2GA 3RRDA 3WDVA 3BPZA 1AR72 1OSGA 3KM5A 2QQOA 4Q0UA 5F1RA 2J1RA 3EB7A 1ALYA 5CADA 2RMU1 1BCXA 3BGAA 3LQCA 1CPMA 3WG1A 1X36A 1TMF3 3A4UA 3F2ZA 3WNOA 3O1UA 1COV1 2G9FA 4A7KA 1G9DA 5HI0A 3NV1A 3HN3A 1GZWB 1PGL2 5JR7B 5DDJ3 3VKMA 3IDBB 4HXCA 3FBMA 5BV6A 2JKXA 4AFCA 3DL3A 2WNEA 2Y33A 1V9U2 5EPAA 1ULCA 3KVBA 2RDRA 4QB1A 3RZGA 3ES1A 2GC0A 4DUVA 3AB0A 1RUI1 1MACA 1W9WA 1PGW1 1QOOA 2JDNA 3URFA 1I6XA 3WNKA 3I4IA 1DP0A 1OUSA 3N36A 2VUDA 1JZ6A 1CZTA 1NKGA 4M0NA 4ATFA 2YU1A 2RJKA 3BU7A 4A41A 2WLQA 4E4ZA 1YFXA 1DYKA 4PLOA 3ZYFA 5J98B 2JDPA 2VQAA 1LEMA 2P37A 1A8MA 1ZZ9A 4KMQA 4V2WA 4LXLA 4LULA 2FDFA 4GH4C 3FC0A 4NE9A 4LHKA 2WFF2 3GXUA 1PMJX 2VOVA 1RMU2 3ACGA 2JE7A 3M3CA 1UMZA 3OCPA 1PK6A 5IK5A 2Z69A 4OUSA 3P3NA 2XHKA 3MIHA 1CPNA 1AR62 1ULPA 3PTRB 3WDXA 1F4AA 3VHRA 3ZXDA 1VB4A 1O3TA 2R073 1MS9A 3THTA 5A1AA 4M0HA 4KBBA 4JTNA 2GC3A 1OKQA 4QGNA 1LU1A 4ZY9A 1CAWB 3QH6A 4RD7A 3U75A 2KD7A 1KDMA 3U0ZA 3BI3A 2QJVA 3NAPA 3ZXGA 1W0PA 2WO7A 5C71A 5CNAA 2D6KA 1FOD2 4CDUC 4I3GA 4XPVA 1K5MB 5FYMA 5FLIA 2QQIA 1NY72 3MPBA 1V6MA 5E89A 4Q4W3 4I2OA 1ZA7A 4NPRA 4XF9A 2HEWF 2ZGUA 2ZGRA 1S2BA 1G86A 5H9PA 1LHNA 3M70A 4AI2A 2QBXA 2VMEA 2J1VA 3CJIB 4GA9A 4QB6A 1GP6A 4N43C 4HN1A 1V0AA 4XFFA 4Q4X1 1TMF2 3USUA 1T6BX 1URXA 1W06A 3ZIWA 1HN0A 3T08A 2DBNA 3FMGA 1O59A 4QWNA 1NQDA 3Q8EA 4INDA 4XC9A 3FHAA 2XVGA 2ES3A 3KGLA 3VBOC 1U12A 3BB6A 1AVBA 3SEEA 5HCFA 3KF5A 1PM7A 1S0CA 4YG6A 3NVCA 1MEC1 3WV6A 3VBOB 1VBC3 2PYTA 3RZHA 1KS5A 1QJU3 5D8AC 2BERA 4YPJA 2VULA 4HKWA 3IAPA 4OQ9A 4ZZ8A 1QJX3 1GZCA 2SLIA 2VOTA 3ZYHA 1ZNPA 3TEWA 1GWLA 1U5YA 1VRH3 2YUEA 1K3IA 4QX2A 5FAXA 4S2FA 4EWEA 4ONUA 3VBFB 4NMIA 3MW2A 2A7AA 4I01A 2NN8A 1E57A 3GZUC 5FMCA 2VMIA 1XNAA 3CBNA 4HVRA 2RR13 1PO23 4W50A 1MPXA 3NSTA 5FZAA 1UY0A 4EZHA 1S0IA 2RR11 4QMAA 4AQ2A 1AX2A 4YVSB 2ZX2A 1IQAA 2NLRA 4XF3A 3NJYA 2J1TA 5ABJA 2WC2A 2XWJB 4FFGA 1VRH1 4LO5B 3GF6A 3GALA 5LY2A 4ASMB 1GZ9A 3SXWA 4AGRA 1ULGA 1LOCA 2P5BA 5CU1A 4FPYA 2WFF1 3POWA 3IIAA 2HWC3 2PHLA 5F2WA 3NO8A 1RUG1 3H8XA 2XLAA 4LTAA 1OOPB 4N9IA 2HWE3 4URTA 4X6QB 4GKXA 4X8PA 3AMPA 3BTZA 4OI2A 2WZEA 4SLIA 1AXZA 2QTWB 3B69A 4KQ7A 3E1F1 5D8AA 2ARBA 4BZ4A 2WT2A 2D5HA 2R1BA 4HK8A 4XOGA 4I0BA 4QXHA 5A33B 1JHJA 1W39A 3WNPA 2XVLA 2K9ZA 3CU7A 2SBAA 3MYXA 5DAPA 5T5PA 5GLVA 3RI8A 2H0VA 2RS32 4QPIC 3P3PA 1R082 2VXJA 1MS5A 3A0NA 5C8CC 4NWVA 5C9AC 4CTEA 1GLHA 1NY71 1LECA 1X82A 2VUAA 2YHJA 1SFPA 1R083 2WZPP 1YRZA 1NXD1 1LJ7A 4AVTA 2A71A 1ND2B 1NX9A 2X5IB 2TNFA 2AUYA 3H1WA 4P9YA 1LTEA 1SPPA 2QQMA 4YVSA 4ASKA 1QU0A 1YUDA 5EWSA 2ZGMA 3I2FA 2F6BA 4R4XA 2VM9A 4N9HA 5CKNA 1A3KA 2EVXA 2VTXJ 3TN93 1W2UA 2RS53 3FL7A 5T5LA 3ZPYA 3JD71 4IV3A 4FPHA 3SHRA 5JSOA 4A42A 3EXUA 5F6KA 1S2EA 4ZU4A 4RHV1 4OMCA 4CDQC 4DXTA 1BJQA 1AX1A 3BVCA 2VC9A 3J8F3 2FDJA 4SBVA 3W59A 3ZDVA 1FMD1 3Q8BA 1CAUB 4OHWA 1WMDA 2O8QA 1D2QA 3UKTA 4AEDB 1TME1 2JECA 4IEUA 4XYXA 4LPLA 2OX0A 4UFHA 3JBG2 2NP0A 2WNVA 4LHNA 3VDAA 1RL3A 4Q29A 1WKYA 4WV8A 3ZX7A 5T50A 3VBRC 3FX3A 3MO4A 4GH4A 3CEWA 1HDKA 1W6QA 4L0PA 2HEYF 5FPAA 3S6PA 2Q1MA 1VRBA 4AEDC 3LGRA 5FZ3A 2BGCA 5LK5A 3VHNA 5K7PA 4I09A 2ILMA 1SDDB 2JDZA 1BVP1 2PHUA 2J1SA 2UWCA 1H30A 3O5SA 2QZ3A 2YFUA 2GSYA 4F8AA 1SQ4A 1S0GA 1YJKA 2XJTA 2RG4A 4AHWA 5JXJA 1XNCA 4QX1A 2BPA2 2FMDA 4RA0A 4BK4A 3C7GA 5A7SA 5FZIA 1MQTB 3RJ2X 3LD8A 3PU8A 2HWB2 1V6KA 1RUD2 2ATFA 1KFUL 3VBSB 2WZR3 4QX5A 1XB9A 2VCMA 3VZNA 3VBUC 1GU3A 1N1TA 1RMU1 2VW1A 5FP3A 5CFDC 1J1LA 1WMFA 2V09A 2ZOEB 5FY8A 1KEXA 3ZO0B 5A3NA 3KCYA 4P14A 1RXFA 1H8TB 4JRLA 1GZTA 4UF0A 4GJYA 5LY1A 1EV13 2Y34A 3POEA 2ZJCA 1MS1A 1PM4A 1ENQA 4KL1A 1OT5A 3VHPA 3K4DA 3R4DB 4NHXA 5LBEA 3ON7A 5I93A 3LWCA 1CQ9A 1FMD2 2AEYA 2PHWA 2XG3A 4I0AA 5A32A 1DCSA 5A1FA 1XU2A 1ULOA 4CDWA 5KBFA 3OEBA 4OHZA 1AUYA 5DZGA 5C70A 1QOSA 1SLAA 5KC6A 3CF6E 5DN2A 3O1VA 4GD4A 2QNKA 3WXPA 1FAYA 2IXLA 4L92A 1LU2A 2Z42A 1ND2C 2R30A 3THCA 4IV3C 1OPOA 4P08A 5JSPA 2DF7A 4K7JA 4C8DA 5FYHA 3W9AA 4IE6A 4BA6A 1QOTA 4MGQA 2XQRA 2ZGPA 5KR7A 4IE0A 5C8CB 2D6OX 1PVXA 4LA2A 3MFAA 1J58A 1R1A3 3HN1A 1Q8VA 3POGA 1XYOA 3FUQA 2JE8A 3EMRA 2C9KA 4LA3A 4TXWA 3M3QA 4URAA 3MFCA 4Z8BA 1V9U3 1YYNA 5C3QA 1W28A 4S2HA 4JKKA 4ZS2A 5C9AA 1AYN3 5A7PA 2RJ2A 3T1LA 1TNRA 3DF0A 1H1IA 3PVNA 1HRI1 4Q27A 1UXZA 2UURA 2VTFA 2OKXA 1D0GA 1Y9QA 3GZEA 1E5SA 1IKPA 1SBFA 5GZDA 4AHXA 2RS12 1EPZA 2E51A 2VXRA 2P6CA 3FFZA 3N9QA 2FDIA 4A45A 4QDSA 1N1SA 1F9KA 1MS4A 3AMMA 5T52A 3RZMA 1PVC2 2ET1A 1YFWA 3FUOA 4HMZA 2IZWA 2GZWA 1YNAA 4IE5A 4J6GA 1S2KA 2ZHMA 1HRV2 4P9LA 5JOWA 1ND3A 3WW4A 1W6MB 2IVJA 1PO21 2PELA 2LROA 2A73B 4XFHA 1S0JA 1UPSA 4YM1A 1GANA 1OVSA 3AKRA 1H2NA 5J3UA 4XF4A 4KH9A 4EWDA 1MS8A 5C33A 4B4QA 1DIWA 4WM7A 1QJX1 5JLVA 1MS0A 4TN7A 4Y24A 1DDLA 2Y38A 1FMD3 3H50A 4COUA 3SISA 4XCAA 4XAAA 4Q0PA 2G1MA 3RGBA 3WF2A 5J36A 3M2MA 3ZN6B 2CSGA 5IFPA 3O1PA 2ADEA 4NHMA 4V1PA 3E5UA 5KC5A 4YG0A 4A7YA 2R041 4IXLA 2RMU2 2QQKA 1BBT1 5EJ1B 1XBFA 4D3WA 5FBJA 3OYWB 1RUH1 4RS5A 1R64A 2RS31 3AK0A 3J26N 1DZQA 3HD8B 4FPLA 5BNPB 4QX7A 3EBRA 4CU7A 4MO3M 1AYM2 1SHWB 2YXSA 4NPMA 4LOSA 1WMXA 2GNTA 4XBQA 2O0OA 4BMEA 3I2KA 2B46X 4OUEA 5FY7A 4MX3A 3TB0A 3ECQA 3OOXA 4COYA 4DXRA 1XYNA 3O0WA 3U4XA 2DV9A 3ACHA 2AC1A 3DCQA 4OULA 1RJ7A 3IAQA 4FPFA 3CZUA 1D4M3 4TWTA 3DV8A 1QQP3 4QPIA 3ZLIA 5AC93 4GMP0 3KGZA 2X05A 4META 1JHNA 4K1ZA 1G6NA 1BHGA 3VBFA 1IKQA 1HW5A 4Q0VA 3E5XA 1KXGA 3ZFEC 1UU5A 2VPVA 3KV4A 5DMYA 1WLWA 2VNOA 3NMBA 3IKWA 4M3CE 1RVF3 4NVPA 4B1LA 3PURA 2FMYA 5FY5A 4MXVA 5EHDA 1Z78A 4XJ8A 1YWKA 2RJLA 1W9SA 3PJQA 5GLZA 4Z07A 1QHDA 3T1MA 5ABJB 1LESA 1Q56A 1W2TA 4ZONA 5C5UA 4ES8A 3WW3A 2JD9A 5EP9A 4CCCA 1AR91 2VU9A 3FE5A 4KU8A 2BWCA 2IXJA 4LHSA 3TEYA 3D5OA 1ZRCA 3ZYGA 5T3NA 3RDIA 1A6CA 1GUIA 4WVVA 5C4WB 2DUPA 3H0OA 3VDDC 4DUWA 1CJDA 4IV1B 1O7FA 4YW7A 4P02B 2VW2A 4E4DX 2EAKA 3IMMA 4NRPA 3MF6A 4HVOA 3MIDA 3JCIA 3C7HA 2W95A 1O3QA 2OQ7A 1UU6A 1NLRA 4NRQA 3ZYRA 1NQJA 2BV4A 2I2SA 3ACFA 4D7SA 3NV3A 2XHNA 4BB3A 1JZ8A 3NNGA 4OQ8A 4WVMA 2JDAA 5FYUA 5FOBB 3IBMA 2ARCA 2GALA 3B3QE 4FPEA 1TMF1 2RS33 1ZBA2 2R6QA 4Y26A 2XXZA 5C3PA 4RQPB 2BNMA 1UU4A 1RUJ2 2QQNA 2XJUA 1OBNA 3ATGA 1U0AA 4Q4Y3 4RFRB 2Y6KA 3BCWA 2QE3A 4AWDA 3KQRA 1XNKA 1QMJA 1W6MA 1ZBA3 2E63A 4R9CA 4DIQA 5J09A 4HKLA 4ISQA 4ZS3A 4LBOA 2BJSA 4PCRA 2YC4A 2W9XA 1KDKA 4UW3A 1OQ1A 3HAGA 5BNPA 4QQ2A 4B8EA 5IVFA 3RYRA 3GCWA 4GXLA 2VMFA 2WIIB 3J7NA 3KS7A 3AX4A 4NPLA 5EJZB 5FXXA 2X5IA 2I07B 1Q43A 4CUGA 1W2OA 3FLRA 1SDWA 2YFZA 3D82A 1T2XA 2A3WA 2XWBB 4QQLA 4Y5TA 3ZSLA 5J37A 3LEKA 1AYM1 4TSVA 2E7TA 2EA7A 5GZEA 2PHRA 4QB2A 5KHGA 1C4RA 4FP2A 3SMHA 3U37A 2E7QA 5AVPA 3WQ1A 5EXOA 1UO9A 2VMHA 3BOPA 4MSVA 4CEWB 5LCWL 4LO4B 3TNPB 3QLQA 4IE7A 4E27A 4O9GA 1QXRA 2E53A 1S0BA 1AL21 3AFKA 4LO7A 5D2AA 5F3CA 2W94A 5FZHA 2ID4A 2A3XA 3RMYA 5JAXA 1FPN2 1MS3A 1BEV1 2D6NA 3WW1A 4CEYB 3MZHA 1HX6A 2VQUA 1VBB3 2VQTA 2R062 2WFF3 1WBFA 3PUHA 4JGYB 1PO22 4OUMA 2PTMA 5IVJA 4DPNA 1EYBA 1WA6X 1YLLA 2P2KA 4AI1A 4COWA 4DRRA 4AZZA 1ZZCA 4LJHA 5KHHA 3CLPA 3ZYIB 2IVIB 4LR4A 4Y4RA 3NJXA 1LHWA 2UY8A 3ZKUA 1NA1B 4YYOA 4GZ9A 2GNBA 3LZZA 3NKTA 4KU7A 2VZRA 2WRAA 4CSWA 2R072 4D8MA 5D1IA 1A34A 2WSVA 3VBRB 3AYDA 5FZDA 5JPMB 1SLLA 3POJA 2FD8A 1CAVA 2YU2A 3K4AA 3K3OA 1VBE1 3AZZA 4MGYE 3NW4A 4QD2A 3EO6A 1JZ3A 3KT4A 1UYPA 2PHXA 3N9LA 4IEYA 4XDPA 5E1RA 3Q8AA 3VL8A 5FR3A 3N4MA 4EE2A 1MQTA 1AF9A 4AI8A 1WD4A 4UI9L 1MEC2 5LASA 2GMPA 3VV1A 1WCQA 4FXGB 2HEVF 4OYUA 3HEIA 5LA9A 5F9TA 4K1YA 1H8TA 4FPKA 1MEC3 4Q4Y2 3MIEA 1RUJ3 1C1FA 3FBYA 1Q5OA 4QQHA 4YVWA 1CWPA 2JKBA 1W2AX 1LULA 3R4SA 4IE4A 1K5MA 2OT7A 4J1WA 5LA2A 2WL1A 3VKFC 4B4PA 5L73A 2X53S 2VMGA 2WNOA 1M4WA 3MEPA 5F8PA 5IVYA 2B45X 3A21A 4P9GA 4BOWA 2UWAA 4Y5SA 5TSWA 1L7RA 2C1FA 3CIHA 1W9YA 2GC2A 3HPNA 2ZXQA 4EQVA 3FHIB 4YZ2A 4FQ4A 1UPIA 1Y7BA 2G4IA 2VNRA 3G7DA 1IOAA 3USUB 4AQ6A 1LHOA 2YBPA 5DUXA 2HBUA 1PZ9A 4AQSA 1US2A 5KHKA 2C5DA 1OD3A 3BPSA 1ZRDA 3SKVA 1ZM1A 4K8RB 3V0BA 4DRVA 3D0JA 3VDDB 2CTVA 3OSDA 5CB7A 1CX1A 1RMU3 4WVMB 3WDUA 1FATA 4MOAA 1DZTA 2B5HA 1OKOA 4BXSV 1PX3A 1UQXA 4L11A 4MGIE 5E88A 1Y43B 2E26A 4MXWA 4Y33A 3WW2A 3J7MA 5FDBA 1OH4A 5ABJC 1ZBE3 2AREA 1PO11 4ATEA 1VJ2A 1RUE2 5IJRA 4D6RA 1US3A 2KXLA 1E5RA 2P1BA 4OI0A 1EP0A 3GM8A 2ZEXA 2ZS6B 3NL1A 2BOIA 2OA2A 1OQDA 2YYOA 1REFA 4X8NA 5FZ0A 4EWAA 1W3XA 4UFLA 5BNNC 4Y5Z0 1FYUA 5DAXA 1TG7A 3HMYA 3E6DA 1W8OA 4IETA 4XIKA 3USSA 1SFNA 2CYFA 2D3PA 4XJUA 1ZZ8A 4YSFA 1UYXA 4DOUA 5FLHA 4HOOA 2FHRA 1F5FA 5FO9B 1C1LA 1BMV2 1VBE3 2WWJA 3B00A 4YGBA 2CGPA 1V6OA 4CU9A 1OFSA 5HV4A 2EXIA 3S57A 3AMNA 4IEZA 1ND3B 3SITA 1N1YA 2WINB 3U14A 4BCUA 4FTBA 4JTOA 4WM8C 1C3HA 4QPWA 1EV12 4Y20B 2Y6HA 4GB31 4IESA 5A6QA 1SMVA 5CKMA 1NZIA 4RR3A 1I9RA 4UW6A 2PLV2 2EIDA 3HBZA 4YM0A 1AJKA 1OA2A 2NM1A 1W6NB 2BYVE 1BEV2 3LOIA 5CFDB 1R092 1LB2A 1GP4A 1W9TA 2VMDA 4UFMA 2ZMNA 2WDBA 3QBQA 3GGLA 4BH9A 5BUVA 3RS6A 5FYCA 1C8M2 3D3AA 4NIIA 1QJU1 1UY1A 3O1TA 1M06G 2DUQA 1LCLA 5F39A 4Z1VA 1NYWA 3WD5A 1YI9A 5IHRA 5J1XA 1HXS3 1VMFA 5FFOC 5D21A 1PNFA 1YIPA 2VVFA 1HB1A 3O12A 4QU2A 5ANNA 3RVHA 1NCRA 3TN92 4AK3A 4XUPA 1SZBA 4PLNA 4QXCA 3POFA 3VBHA 2BW8A 4AXOA 1Q8QA 1UAIA 4LBKA 3MUY1 1VBD2 5EFUA 1R1A1 2YC2A 3OYWA 1H2MA 1D4VB 1ND2A 5JXHA 5FY1A 2WQZC 4IDZA 3KF3A 1W6QB 1OPMA 3ZSJA 3VGIA 5ACA1 3WVJA 5FZGA 1UX7A 4YWAA 4YLZA 5FUIA 2E32A 4FPGA 4CYDA 5J96B 1XSRA 2C4XA 4P9XA 5F7UA 1VE0A 1GWKA 2WBKA 2XUEA 1VPHA 4X6RB 1G9AA 2V72A 4JGZC 4OI1A 3RI9A 1XOYA 3IPVA 1NA1C 3U11A 1COV2 1XXNA 2ZAAA 3JU9A 1GFF2 4CUAA 3MLKA 4BLIA 5C5TA 1AR63 3LSEA 2AACA 4XW3A 2D5FA 5LW9A 1ZRIA 2YPJA 3IN9A 4CDQB 3VKNA 2F4LA 1UKGA 2R071 1KJRA 2Q1ZB 3ZFGB 2EXKA 4LITA 4HKOA 4W6WA 2YBKA 2K0GA 3B93A 1CIWA 2WA4A 4P5HA 1W6NA 3UGGA 5IK8A 1GYKA 3LEMA 1XSQA 3ZPOA 4LEJA 1K5MC 2ARXA 4NJ4A 4GH4B 2VR4A 1QDOA 1WW5A 2X5IC 3AVRA 3NRUA 4UW4A 1V6JA 2UYAA 3LDBA 4A4AA 5HV0A 3IDCB 4XFBA 2VH9A 2EIEA 3KVAA 3WUDA 5IAVA 5JZGC 3NNFA 3I59A 5C4WA 1E5IA 1H4HA 1QXPA 2JDYA 2JIGA 5A33A 2CWSA 4ASLA 4D7TA 4F3JA 3TRSB 3AP7A 3ZSMA 2IXIA 3OB8A 2DCTA 5EYXA 1XU1A 3DYOA 3CDZB 5DABA 5A80A 5HCBA 4E2QA 5I0RA 4AEKA 3NV2A 1MZ6A 2P3IA 4LBQA 4XQWA 4DUXA 1WLDA 1W0OA 2BTVC 3NAPC 1UCXA 4QDRA 1F2NA 1GQHA 2FCUA 5BNOA 4A44A 5FKCA 2W1WA 5FZ1A 1ZZ6A 4WVZA 4BQXA 5K8SA 3HBKA 2VOXA 4R8HA 1RUC2 1C8M1 4AOCA 1W8TA 3FLPA 2V5YA 1QJEA 5HXVA 4A6OA 2A6VA 2D97A 2VZPA 3AYCA 2RMU3 1WW7A 2VMCA 4D6SA 3PIGA 5FPVA 5A7QA 1HRI2 2IXCA 2NPIA 1JMUB 3J8F1 1EPWA 2ZA9A 3T0DA 4CU8A 4QX8A 1NLQA 2HYXA 4YVSC 4CDXC 4PIXA 4QXKA 2VJXA 3LF7A 3D6EA 4ZPIA 1UIKA 3W5MA 5J48A 5H9QA 4W6XA 5FRAA 3L9JT 1V6LA 1W8ZA 1RUE1 2D43A 2IWGB 3OBAA 4CUCA 5CFCC 2DCZA 2G9ZA 4OLLA 2IFWA 3WX5A 2C26A 1RUH3 2XJRA 3B94A 3I59B 4NOTA 1OC1A 5C8CA 4PF5A 4QAWA 2QQVA 2O14A 3WP5A 1DFQA 1NG0A 5FP8A 4CEWA 2XKPA 3UETA 3LEGA 4EN8B 3RFRA 1W8UA 4C1WA 5IUQA 3VHOA 4IEOA 3THPA 4TZDA 1ODMA 4DY3A 4LMFA 4S2DA 4AEJA 4XFGA 4LNVA 3I7DA 3T30A 1RVF2 2QZ2A 4GKYA 1RHI1 3U10A 2RS11 1VAKA 3MBWA 1VP6A 3AKQA 3O0XA 4JGYA 2QQPA 1Z7S2 3A0KA 3B9CA 3JB8A 4XZPA 1LODA 4DXZA 1GOGA 4ET7A 5CYYA 1TEIA 5DAWA 2OW4A 2PHDA 1ZRFA 2KR2A 4QHBA 5HBAA 5BNNA 3MPPG 4OHYA 2PA7A 4A3XA 3W58A 1TNFA 2VNVA 2B9UA 4WZFA 4K21A 3SQOA 5CA6A 1MZFA 3RZJA 2ETEA 3CQOA 1U5ZA 2RHPA 2YZ4A 3INAA 3IPVB 3K77A 3KT7A 4PLMA 2ZKNA 3VLBB 5B2GB 2RS52 1UOJA 5DAQA 2HBTA 3M7AA 2BVBA 3D0SA 1CONA 1F5JA 2ZMKA 5LA0A 1CESA 5E8AA 1OOPA 2B4KA 4O7XA 1LGBA 3THDA 3L2YA 3AP5A 3TEZA 1GOHA 5HXMA 4HONA 2VTXA 2W08A 3TN91 4XUTA 1U5XA 1XE8A 3BN6A 4CCNA 2ZABA 3JBG3 4AI9A 1CGPA 1EAH3 5KHJA 1W8WA 3E6BA 1ENRA 1H8VA 1LOFA 2PXJA 3PUSA 4PDWC 5ACA2 2WAAA 5G04L 5JMCA 4NIDA 3KMHA 4CXWA 3QCWA 1B09A 2C24A 3SCFA 3C3VA 1YQ5A 3I2IA 4IEXA 2NQYA 5A7OA 4PJYA 2QCSB 3J7HA 1F35A 1NZCA 4MHRA 5FV3A 3TYJA 5F32A 3AVSA 3V0AB 1BK0A 3OPZA 4K3UA 5GLTA 1KQRA 1HN1A 5BXXA 2EAAA 4N53A 3Q9OA 2JB4A 1MZ5A 4P5YA 3WF3A 1CAVB 1FT9A 2VVDA 2ZCWA 3JBG1 1WCKA 4C90A 4GMP3 2I45A 4FBFA 1G9BA 3S5AA 1X7NA 1XRUA 2HWE2 3ZXFA 1BK1A 2X8KA 3K3NA 4WVWA 3U07A 2WQ8A 1J83A 2HH9A 4HPKB 2XKOA 3V0BB 4PQ9A 3K48A 1LOGA 2G9GA 2ZGLA 1UZZA 4YRDA 1CIYA 2YG0A 3KHBA 5BNOB 4L2NA 4BM8A 3FN9A 4PBPA 2W0XA 4EN6B 5DUWA 3WG4A 1VAMA 2VBBA 3K46A 4XJWA 4ZZ5A 4MG2A 4DZGA 1X8MA 3J7LA 1NE6A 4FVVA 4BQ2A 2V5DA 1WZXA 3CZJA 3RWKX 4DFSA 4YZ3A 5SV5A 4XHXA 4QQPA 4G3YC 2R063 5GKAC 2YROA 3AMQA 3RYPA 4KGGA 3QOPA 5APAA 2HJIA 4E4SA 4JDOA 4H2AA 1VIWB 3ZYJB 4HL0A 4DXSA 2PQSA 1KS4A 4YARA 5IAXA 2L9LA 2VUCA 4BPZA 1LKNA 2XVKA 3CO2A 1HQNA 1QJY1 4AW7A 3RNSA 4AL9A 2WYSA 1DGRA 2JXAA 3VD4A 3EHKA 4AVSA 1QY4A 1D7PM 1XNBA 5KXCA 3KCCA 3VDDA 2A1XA 2GH2A 4EJRA 1ST8A 1AR93 4O61A 1SCRA 1FI2A 2DTYA 1ZYBA 2MNGA 4YW6A 4ZHNA 1WCUA 2ORXA 4AVBA 3R4UA 1I3HA 3GHNA 5FZOB 1NT0A 4ITCA 2VGDA 1QGLA 1YI7A 2I74A 2BP6A 3AZWA 5C3OA 4CCEA 1ZBE1 2Y6LA 1ASJ3 4RS5B 1L3JA 3LCPA 5CFDA 2WNVB 1BVVA 1DYOA 1POV3 5JIAA 2AYHA 4XMIA 1AL22 3ACLA 1QNYA 4RGAA 4CEYC 1Z7S1 4FCAA 2DVDA 3ZXAC 1TME3 1D0HA 3WDWA 2VE1A 1AR71 1Q8OA 4M4PA 2ZGSA 2W1UA 2OUHA 4P9JA 5FKBA 4XZUG 4TTGA 2Q5TA 3GBWA 3QH7A 4FI9A 4O9EA 1DYPA 5L7OB 5C3RA 2FCVA 2J22A 3LDRA 1OFNA 3VBHB 2B9VA 1MQTC 3H8UA 2X09A 4F7ZA 1LGNA 4QGMA 3JB4C 4LE4A 1X50A 1RUD3 1QNWA 2VOKA 1SBEA 3BYWA 2BDRA 3HT2A 4KWLA 4EV0A 5F5AA 1YQ8A 1VBB2 5IVCA 4D0QA 2EIBA 3ETPA 3H1YA 4LUMA 2R043 3VD9A 2E33A 2VL4A 4NIAA 3ZFFC 1QWRA 3FHQA 3JXSA 1S0FA 2WQ4A 3ES4A 5CFCB 3AM2A 3ILRA 3B01A 1RUJ1 4ISRA 2XONA 3PJYA 2YBSA 1OLRA 3SCHA 5A3TA 2V4AA 1O91A 3X29B 3Q8FA 4NIGA 1AHSA 3V0AA 1JYCA 4KWJA 3ETQA 2FDKA 1IGOA 4BIFA 2A3YA 2W47A 3KLSA 2A6YA 2FBEA 2XJQA 3WQ0A 2VNGA 2LALA 1OUXA 4XFIA 5FBZA 2MEV2 3WG3A 1KRIA 4AHYA 4CP0A 2WZR2 4AGVA 4DB5A 4ZU7A 1UZYA 1MVQA 2LTNA 5FZKA 4PIYA 5G05L 3ZYPA 3T2QA 1EY2A 1OLQA 5FZLA 3BTXA 5GJ6A 2GNMA 4XABA 1QJFA 1VBE2 1YHFA 3ZXJA 1DBNA 4RQPC 1CAWA 1O4YA 2PLV1 5C4WC 5L7OA 4PF1A 1GSLA 3LA3A 3ZFEA 2W92A 4LO6B 5FXVA 3NAPB 1HRV1 2P3YA 4XACA 5LB6A 5LK7B 3H3ZA 4EN7B 5JMOA 4N53C 4CPBD 1QJU2 3DPRC 2X29A 4NHLA 1UD1A 3LPGA 4FAGA 2VG9A 4CEYA 3OY8A 4LBQB 4WZCA 1BEV3 5F5IA 5JPNB 4LHLA 5FWJA 5FZMA 3K75B 5BPXA 1RUF1 1D4M2 1V9U1 2VZ3A 1GNZA 3MW4A 1LOFC 2ZEZA 2R7EB 1RUF3 3A22A 3OBZA 4IV1C 1CZVA 4Z2WA 4ZU5A 4HSLA 4IEPA 4QPGC 1JOJA 4UOJA 3AMHA 3CL1A 5HPOA 4BK5A 4MZUA 5FJKA 4TYSA 2Y26A 2ET7A 3WHTA 1L7QA 4RGKA 3OG2A 5JOZA 1IPKA 2JX9A 1VBC1 4CUBA 1O3RA 4CP1A 5C7GA 3WOGA 3OJBA 1OOPC 2WN3A 1F31A 5K0UB 1UMIA 2EF6A 3ZFGC 5JI7A 4DO0A 3DKWA 5DG2A 2J1AA 1HIXA 3H7YA 1W8FA 5GM0A 3L2HA 5K9YA 3LPFA 2BU9A 3UESA 5DPNA 5A70A 1ZX5A 3GNEA 4NHYA 3HQRA 4QHOA 1DLCA 1REEA 1YJLA 3J9SA 4I30A 4F83A 1W03A 3OPWA 1DQ4A 5CAZA 2V4VA 5T55A 3VZMA 1I1EA 1OQEA 1IS4A 3H42B 5FZEA 2GMMA 1VBD1 5I0TA 3S30A 3TAYA 1Z0HA 4Q0QA 4Y22B 3NJZA 2FDHA 2LS6A 2ZGOA 1J3QA 5JSRA 2XLGA 4KG0A 1AXYA 5I8TA 1NOVA 5M0TA 3VN4A 3WEZA 4IW3A 4XE9A 2OQ6A 1UIJA 1XYPA 2RV9A 3ZVXA 2JB8A 3M3IA 4QDQA 2W3JA 5IK4A 4AEMA 3AXEA 1JXNA 2A6XA 5BNPC 3KT1A 3T2PA 2WUHA 2W87A 5FZ9A 3MHZA 4MGZE 2VUJA 4QM8A 3KV9A 2JEMA 5FZ4A 1QJZA 3UL2A 5KHIA 4RYDA 5H9RA 2WT1A 2Y6FA 2YPDA 1GNYA 3DXUA 4K20A 4P00B 4PT6A 3OUHA 2Q1FA 1N3PA 2PQQA 1J3RA 5JDBA 1QXJA 2ZPXA 3N7KA 2JG8A 3V56A 1QJY2 3WNLA 1V6IA 4XCBA 1DGWX 3UKNA 3IM0A 2OPWA 3V64A 4BDVB 4EN0A 4N43B 4PI0A 3NV4A 5A3PA 4NO4A 4MUVA 4B7EA 2J42A 2WABA 5JOYA 3T0AA 3POIA 2F4PA 1VRH2 2DCKA 1SBDA 2CU5A 3OGVA 1YFYA 3S7EA 1QEXA 3SH5A 2NMNA 2W46A 2QUOA 1AR81 2GN3A 1SLTA 2ENRA 2IXHA 2JIJA 1RTVA 2VD7A 2VCCA 4QQOA 3AFGA 3H1MA 3WNNA 2D3RA 2PAEA 2ZX3A 4J1XA 2XJPA 2C9AA 4MVTA 5F3GA 1LHUA 4QM9A 4E8DA 3AL6A 3JD73 3O1MA 4LOTA 3LOBA 1JYWA 4JZRA 3CJIA 1WW6A 4BQ3A 5GZFA 1O4ZA 4BMBA 3G6JB 3APBA 3JD72 3BODA 4QT6A 3SC7X 1CJPA 1IS5A 4AVAA 2OXBA 1TZOA 4JX0A 3OBTA 3OY8B 4UBHA 4COZA 1BBT2 1H6YA 1OLMA 2Z4FA 2BOJA 4RN5A 1CX4A 4MLOA 1RUH2 1FV2A 4XTPA 2KM2A 1LOBA 4BQWA 3LDKA 2XDVA 2CL2A 4XJAA 4LKEA 3NNMA 4MV2A 2CGOA 4PI2A 1RHI2 2GC1A 3AJZA 3GZTB 4XJZA 4YM2A 4WM8A 4N7IA 2MPFA 2YB7A 4RQPA 4N43A 3KB5A 2EXJA 3R05A 1Q8SA 3ZMOA 2P34A 1H8TC 4HANA 1R093 4N53B 1U5IA 2W52A 4ES9A 3PVEA 1SLIA 4FO9A 5JR2A 4KNCA 1LRHA 2DUOA 2GU9A 2UY9A 4RL7A 2GN7A 2K2SA 2FZ1A 3AXDA 1NLSA 1Q8PA 1RUNA 2Y8KA 4M00A 1AL23 3GJBA 5ERLA 5IATA 1JTZX 1WCDJ 3MICA 3J8F2 3LKJA 1LHVA 4Q26A 4QHZA 1HQWA 4LKFA 4B29A 4FXKB 1HLCA 2BVVA 2WSUA 5GZCA 2JD4A 3OEAA 2ZEYA 2XOMA 1XC6A 2PHFA 3T09A 4L8QA 5ACA3 3O1RA 1I5ZA 1OA4A 1ZVFA 2DWRA 1DQ0A 1NCRC 1RC6A 1XNDA 1PZ8A 1RJ8A 3OGJA 4Q8LA 1H1AA 2A70A 4QKFA 5FZ6A 3UNPA 2W68A 1AYN1 4B7KA 2B7YA 5ISLA 1EAH2 5JXIA 2WYFA 5FYBA 3PMEA 4AI3A 3MLJA 5DUUA 1B35C 4V2VA 2VZ1A 5A3MA 1UY4A 4Q4Y1 4GQ7A 1TME2 2AENA 2VZQA 4CCMA 3U1XA 4JQRA 1OA3A 2HWD1 4Q4V3 2PAMA 1SLCA 4Q1PA 3IT8A 1XQNA 1YFUA 2W1QA 4EZ4A 1JYVA 5FP9A 2YGMA 5BY5A 2OPKA 3CKHA 3AKTA 3AZXA 4CE8A 3KV6A 3OD4A 4D6QA 2BEOA 1SEFA 2E31A 3VD7A 1DHKB 5LATA 5L9BA 4IQPA 4Q4W2 1LENA 4XQ4A 1X9TA 4AYUA 4CZSA 2CGNA 2OZJA 1JZ2A 1KJLA 2QQUA 5FZ8A 4ARYA 3DPRA 1O5UA 3OTFA 5DXDA 1UWWA 1IPSA 4ZXEA 2ZGKA 3N9PA 5FO8B 1AR73 1N47A 1LOEA 4UFJA 4YW4A 3M3OA 3I3MA 3EYPA 2BWAA 4XHBA 5FMDA 4JHTA 2BRTA 3ZN5A 4CCLA 3S7IA 4P9IA 2GP5A 4IUGA 1UOFA 1H9WA 1UW8A 3DN7A 3T2TA 4H55A 4KG8A 3E5QA 1PGL1 1NCQB 2KA3A 1CVNA 2WWSA 4XF0A 4JRAA 4W65A 3MV01 1YCIA 2Y6GA 1G9FA 1GQGA 2DU1A 3C7OA 3IMNA 2PHTA 4FT8A 3UJOA 2DVBA 4LBNA 4GULA 2BZDA 5FP4A 4ORFA 1Y9MA 1EUTA 1PIV2 1WGPA 5FZBA 1W6PA 5E6HA 2BNNA 4TLFA 4ZXKA 4GWIA 1CAXA 4PQQA 4XILA 1WLCA 3SEPA 2RM21 3IWZA 2E7AA 4QPGB 4Y1YA 4AE2A 4A3ZA 5LRSA 1UL9A 2RDNA 4GJZA 2WWUA 4OFGA 5KXEA 5EIYB 3UGHA 3BKZA 5L9RA 2DVFA 3HNMA 4YZ4A 5F5QA 3WCRA 5JUVA 2XR4A 1VMHA 3LE0A 3VZOA 4AFMA 5A7NA 3SKJE 3T4HB 2YV8A 3T3YA 2IUWA 3RPQA 5FMOS 2WNUA 5LBFA 2P3JA 5EJ3A 1S4CA 3WR0A 3I2JA 2QQLA 2HWB1 3CMGA 2NMOA 3WHUA 3BUCA 2XL9A 5FY4A 2JG8C 3S5QA 2G19A 2VOWA 3DPRB 3BOWA 3LFMA 3OUJA 4I02A 4MGTA 1OVPA 1XNTA 2H6BA 2BFUL 2ZX1A 3V65A 3ZXEA 4HVQA 5LA1A 4PIZA 1IS6A 2BNOA 3ACIA 4DINB 4JAAA 1ASJ2 1UF2C 2VZTA 1CR7A 1FV3A 4BU2A 3IZOA 1PMHX 4FPCA 3VZLA 4ZKTB 1AYN2 3HNBM 4Q4V2 1BBT3 4OI4A 4UF0B 5AFEA 2VCAA 2YC0A 3DXTA 5FIXA 4RHV3 2JG9C 3TWIA 3HT1A 4Q8KA 4XURA 2HYKA 1JUHA 2RS51 4W4ZA 2WS91 1X8EA 1V70A 5K4LA 1VBA3 3AP4A 4CXXA 1AR83 2BUKA 2XJVA 4M3CA 1GZWA 3DYPA 2NZ9A 5LEJA 1G8WA 1O8PA 1LAJA 4LBMA 3U78A 5K0UA 4Q4X2 2WJSA 2ZACA 4HBNA 2F17A 2EXHA 3POYA 3PUQA 2A6ZA 5H9SA 4XVHA 3H7JA 1EAH1 5A1LA 1AX0A 3ORJA 4NWWA 5FYYA 2Q8OA 3ALQA 2YY1A 1PMIA 1RIRA 5E16A 3PUAA 1XE7A 4OVEA 5I0UA 3LIGA 4UBGA 1ULFA 2H6CA 3RSJA 3WNXA 2FQPA 2JDHA 3VL9A 2RM23 4C0BA 1UNBA 2Y64A 3RYKA 3VZKA 1VALA 4CDWB 5FMOL 3ZSKA 3MIGA 3VBHC 2D7FA 2Q4SA 4LKSA 4K40A 4XDOA 1UKRA 2MEV3 5IT6A 1HRI3 1AR92 4YZ5A 4FTSA 1APNA 2CAVA 2HWF1 3CHXA 4C91A 1DG6A 5FWEA 4CDWC 1AR61 2CV6A 4GB32 1JYXA 4NUBA 4HN0A 4LIUA 4E4HA 2UU8A 3H8OA 2CDPA 3N3HA 5IVBA 2RR12 5FYIA 1H0BA 1P8JA 1V6NA 3MIFA 3TNQA 4QXBA 1ND3C 1O3SA 2XLFA 1BKZA 1AYM3 3C7EA 4K8FA 4UXAA 2Y6JA 1CD3G 2ZZJA 1BYHA 2JG9A 4FP3A 1KITA 2P3KA 3ZIXA 1OHFA 3VDCA 1HXS2 2Z5WA 1NCQA 4YM3A 5A6XA 2DURA 3CNAA 1RUF2 4COVA 2VBPA 2XJSA 1IG3A 3FJSA 2XPJA 1QDCA 5IWFA 2H0BA 2HWC2 4YNIA 4K9SA 4BQYA 5FPBA 4J25A 2Q8CA 1SG3A 1ZBA1 2AZ5A 1O4TA 4JDNA 5FUNA 3DUIA 1OI6A 5A7WA 5F6LB 1PIV1 4E8CA 1BQPA 1O5LA 1PVC3 3C8XA 5FREA 2HWD3 4Q4V1 1ONAA 4OCTA 2D6LX 4QX0A 3ZR5A 5CFCA 2MHFA 1OLME 4XIOA 2XBO1 5CKQA 4QX3A 2XQXA 1NA1A 1WD3A 3MF9A 1AXKA 2ZGNA 4NHKA 1WUVA 3O14A 4KWKA 3W20A 3D8CA 4XXAA 2CY6A 3P6BA 3HWJA 4AF9A 2R1DA 1FOD1 3VBRA 4JHZA 3AZVA 3RG0A 3K4ZA 1JI6A 5CZKA 2YGLA 5FJHA 1KFXL 3MI8A 4N8MA 4LBLA 2AR6A 3ZOIA 1JW6A 1N3QA 1GV9A 3WP4A 1HB3A 5JIUA 3PHMA 3I3DA 5ANQA 1BXHA 1JN2P 1D2SA 2GAUA 4FOQA 3SNMA 1JU4A 4I0WB 5FUPA 1BLZA 1YQ6A 2ZX0A 3KZ4C 4AHZA 1JZ7A 5BNOC 3IDEA 1C8NA 2JG9B 2RM22 1WW4A 1RHI3 5LBBA 1RUC3 4Y1UA 1C28A 2GDFA 4LIVA 2JDMA 3M1HA 4QGLA 4NN0A 4MXWB 3ILNA 5I8SA 1W3VA 1UN1A 4NIHA 1DGWA 4W6YA 2MEV1 4BJ0A 3O0VA 5IFTA 2WAOA 1J84A 1GP5A 2DCYA 2ZZQA 1HB4A 2Q0AA 3A7QA 4HT1T 4R9BA 1SACA 3PU3A 3ZFFB 4YG3A 2PFWA 1DLLA 1RUG2 4CCDA 4FPOB 2WT0A 5JVVA 4MYEA 5JZGA 1QJY3 1POV0 1W0NA 2VECA 2XMLA 4XTMA 2CHHA 1PZ7A 2JJ6A 1S0EA 3W5NA 1H2LA 4YVWC 1YO8A 3BIEA 4DEVA 2RDSA 4B4RA 1FPN1 1VBC2 4DMIA 1PHMA 3IDAA 4IV3B 2TEPA 4HZFA 5FPUA 3SCGA 1W8NA 3S0MA 4Z82A 1XJAA 4CRQA 5FZ7A 2Z2SB 2X10A 5CG8A 1VMJA 2D40A 1RUI3 4CDXA 1GKBA 1GICA 1RUD1 3ABZA 5DZEA 1FNYA 2PN5A 3HNYM 4UFKA 3ENRA 2WNVC 3ITQA 2EICA 2Q30A 2P6HA 3JZVA 2WS93 4RS5C 1X9PA 1RUI2 1AL0G 4Q2FA 4CCJA 3H3UA 3D4KA 2DDUA 2D98A 1AJOA 5CISA 1PNGA 1RUOA 1SFYA 4L9BA 4WM7C 5FK7A 1HKDA 1POQA 1RYYA 3M3EA 4GWMA 1COV3 2WLPA 2D93A 3I2HA 3TEXA 3WP3A 2ADDA 2TBVA 4BYYA 2ARAA 5FY0A 2C6SA 3LSDA 2O8OA 1QH7A 4JKLA 4RFT0 2WN2A 5F3EA 4CA9A 1OURA 4QPYA 3ZFFA 4BISA 4NR1A 1DQ5A 3B9IA 5DUVA 4BE3A 1XPWA 1GR3A 3AL5A 4XFAA 5FMBA 3VZJA 2CAUA 1WA4A 2LRPA 4HSJA 1HXS1 2AH2A 1YQ2A 5FPZA 4HPKA 5IK7A 4D7YA 2ZHNA 3EQEA 2HWB3 2QKDA 4JV4A 3WCSA 1BZWA 3LA7A 3N9NA 3VBSA 4PHZA 2XBO3 4UYBA 3RZZA 1H1MA 5FYSA 4HK9A 4GWJA 1AZDA 2QDRA 3LA2A 1PGW2 3UV9A 4LORA 5HCHA 1WWYA 1YXWA 5SV8A 3AP9A 4BHPA 1UY3A 4NAOA 1JYTA 4UWDA 2A6WA 4BQ5A 3AKPA 2BBAA 3KD4A 3VB9A 4B1MA 1REDA 5C6CA 4Y3OA 4R4ZA 2OZ6A 5GALA 1NCRB 2GP3A 5A32B 2R0HA 1CAXB 5CVRA 3PNAA 4IERA 1C5HA 1ZZ7A 1IPJA 1EUUA 2PMWB 1STMA 2JENA 3WLUA 1BMV1 1NE4A 5EV7A 5FXZA 4C1XA 5FO7B 2OUJA 4LUKA 4YGEA 2RDQA 2EIGA 1DZRA 4RR3B 1HV0A 4C0HA 2BGPA 4N90A 1NAEA 1VBD3 3NNLA 5BYNA 2FDGA 2RE9A 2HWF2 2J1EA 3KSCA 1IS3A 2XH6A 5JCTA 1MZEA 4NRMA 1QF3A 2UWBA 1H4GA 3PMSA 2R042 5AFBA 4LK7A 1LOAA 2HWF3 2ZBJA 2JG8B 2BQPA 3N35A 4H14A 4R9DA 3J4UH 3NWKA 1RB8G 2A75A 1NUKA 5FPLA 1K42A 2WR9A 2AEZA 3I8TA 1UY2A 2JWPA 4PDWB 5C9AB 1PK6C 3QD6A 4UAPA 5JOXA 3T2OA 5FK8A 2DFBA 1ACCA 1ZBE2 2DCJA 5JZGB 3R6SA 1UMHA 3GDBA 4Q1RA 4CP2A 4IEVA 1JODA 2ZMLA 1PO12 3I49A 4TLGA 1JU3A 3FFQA 4LK6A 3VBUA 4DS0A 1UOBA 3PVBB 1HJFA 5DQ0A 4QKDA 4GALA 3RZLA 2DBIA 1W6OA 3PVOA 4K6BA 3ELNA 3VKLA 1A8DA 4NROA 1NCQC 3I3BA 4IEQA 5FQ0B 5A3LA 2XBO2 2XGXA 3AJYA 4N7UA 1ZRRA 4AQTA 3VBFC 2XB6C 1POV1 4Z92B 1UYZA 5T54A 2N7GA 5FZOA 5IW0A 5IVEA 2YDEA
chains in the Genus database with same CATH topology
3N7LA 4JC1A 1QKQA 5D8AB 2ZTNA 4FAHA 4M3CF 5CG9A 3JQWA 3VBSC 2PLV3 3BALA 3B7MA 4I3PA 4EN9B 4U2AA 1FXZA 2VQ0A 3FZ3A 2ERFA 2JE9A 5EZWA 1NXMA 4AEDA 5JWPA 3ZMNA 1R091 4JGZA 3ZXKA 3AZYA 3AYAA 1DQ6A 1FPN3 1QQP1 3LB9A 5FLJA 5AC91 3TOJA 3WINE 1ULEA 1QH6A 2GMEA 1OD5A 1H9PA 4LLFA 5FPXA 2QFEA 4XEZA 4E2GA 5FTTC 5DDJ1 4R52A 1R1A2 4BWOA 4WM7B 3WP6A 3AKSA 4P9WA 1IZ3A 2WA3A 1VAVA 3WUCA 3NKGA 5LRRA 3ZSEA 4RHV2 4AFAA 1RUC1 1RITA 2DTWA 3HQXA 5FOJB 5K0UC 2ZGTA 1R081 3N7JA 5KXBA 2UYBA 4XBNA 4A7ZA 3SH4A 4Y1XA 4CDUB 4OHXA 3I54A 2WFPA 5GLUA 5I91A 2HWD2 4Y1ZA 1WCSA 5DG1A 5BNNB 1DQ1A 2DVGA 5C8WA 1Z7S3 3ROUA 4E2SA 1ZZBA 4AGGA 1VBA2 4LLOA 4MH0E 4FPJA 1PK6B 1ASJ1 1LR5A 5HCAA 5T5OA 4G4FA 4AFDA 3AP6A 3GBFA 5I0SA 3LAGA 5AVAA 1SLBA 2WNUC 1RUG3 4LE3A 4HLTA 3M8LA 4E9KA 2AGSA 4FOVA 5BNQA 2BFUS 1PIV3 5GZGA 1R1ZA 2R32A 3RJRA 3JQXA 5KWRA 4XMAA 2WNUB 2V73A 3DGTA 3ME2A 4GB33 1GBGA 1VBB1 1DU3D 3GYDA 4L97A 4YGCA 4YZ1A 2D6MA 2LUWA 3ZDSA 1W6OB 2P17A 3ZXLA 2OVUA 1C5IA 3O7OA 4HFSA 2GH8A 4Y20A 4JDMA 4QPGA 2FZ2A 1QQP2 5AC92 3K51A 3TBDA 1DF0A 2GNDA 2ZGQA 4YGDA 5T5JA 3VBOA 3I2DA 4EROA 4FTEA 1RVF1 1PO13 4YW5A 4M3CB 2PAKA 4LT5A 3GHMA 1JH5A 1TQ5A 4H3WA 2R16A 2VW0A 2OYZA 3OBRA 1FX5A 4AVVA 1VB2A 4Y22A 4JGZB 4DQAA 1B35B 2DFCA 3UK9A 3N7MA 2Z79A 3MW3A 1RINA 5L7OC 4CDUA 4WBBA 2HKXA 3FLTA 2DYCA 3OD0A 3WG2A 4XETA 1YIFA 5JI9A 3OF1A 4XBLA 4MGKE 2D44A 4YW1A 3VKOA 3CJIC 1C57A 4AFBA 2W39A 4G9SB 2DVAA 3SLIA 2O1QA 4H7MA 4BQ1A 4KGQA 4B3NA 3WZ1A 1JBCA 1VBA1 3B5LB 2EALA 3WQ7A 4FOYA 5CBLA 3ZFGA 1N3OA 4OZXA 1CN1A 3RWNA 5LEKA 3ILFA 4XQDA 3ZN4A 3GZAA 4HETA 5CIRA 1H2KA 3C2UA 4AVCA 1N1VA 1V00A 4WM8B 2ZAHA 1DQ2A 4YVWB 1IHMA 4UW5A 4QPIB 3ZN6A 5DDJ2 4DY5A 2ZHKA 1VR3A 3POSA 3WT3A 1LEDA 1J1TA 2CNAA 4JCKA 2BBVA 3PTYA 4XJ9A 4D94A 4RR3C 4XF1A 3CJXA 3MGUA 2R061 4BIOA 1PGSA 1F8VA 3EJKA 1FNZA 2DU0A 5FCCA 5L19A 1AR82 1MVEA 1X33A 3UJQA 2TUNA 2OIIA 3R0RA 1CAUA 2YMZA 2C0ZA 3SH3A 5GLWA 3RMXA 1S0DA 1HV1A 3WDTA 1B35A 4GIQA 4U36A 1UX6A 3MIBA 3VUOA 2QDNA 4PDWA 4LBJA 1DGRN 1RGSA 2JICA 3WY6A 4FQZA 2E9QA 2VY0A 5L36A 3E6CC 4YFZA 1WMEA 1Q3EA 4FOWA 1S1AA 4AI0A 1C8M3 1ZREA 4PBOA 4Q0SA 4RSUA 2ZX4A 1FOD3 1WLTA 2LM3A 4OHVA 1A78A 5DZFA 4RGGA 4GWNA 3E97A 2A5ZA 2VVEA 1JYIA 2HWE1 1Y3TA 3ZFEB 2XUMA 3HR9A 5J7MA 1TE1B 4IV1A 2HWC1 4H7LA 3KCXA 1LGCA 4AG4A 3H9AA 1GNHA 3MDPA 4DNYA 1ULDA 4M01A 1PVC1 4XDQA 4Y1VA 5EYYA 2NYYA 2QVSB 1KD7A 4XXPA 3RQ0A 4JGYC 3QACA 1SCSA 2B39A 2B8MA 1ZA4A 3ST7A 2XL7A 2R0FA 5I8YA 2WZR1 2E6VA 3PLQA 2Y0OA 2Y0IA 4LO8A 1JUIA 1QJX2 1S55A 3AYEA 1ENXA 3VBUB 4CEWC 4YW3A 1W6PB 4IL7A 1HQLA 1HRV3 4Y4YA 1J3PA 2RS13 5FQ0A 4D69A 1T6GC 3BTAA 3WDYA 2ZHLA 3JUUA 3B02A 3M4FA 4JVAA 1WBLA 2IC1A 4XFCA 4R9AA 3HIFA 2ZKLA 3OGGA 2CWMA 2D3SA 4IEWA 4YW2A 1ENSA 2IXKA 2IFRA 2B42B 2D6PA 2R49A 2WS92 3GBGA 4YFWA 1VLNA 4CDQA 4Q4X3 1G9CA 1D4M1 1MR5A 3MLLA 4GMP1 1DGLA 3FWEA 1G7YA 1OMIA 3BIWE 4BLJA 4FSJA 1RUE3 5KXDA 4L99A 4CDXB 3UKVA 2WKKA 4Q4W1 4LBQD 1EV11 4A2UA 3ASIA 4S2GA 3RRDA 3WDVA 3BPZA 1AR72 1OSGA 3KM5A 4Q0UA 5F1RA 1ALYA 5CADA 2RMU1 1BCXA 1CPMA 3WG1A 1X36A 1TMF3 3A4UA 1COV1 2G9FA 4A7KA 1G9DA 5HI0A 3NV1A 1GZWB 1PGL2 5JR7B 5DDJ3 3VKMA 3IDBB 3FBMA 5BV6A 4AFCA 3DL3A 2WNEA 1V9U2 1ULCA 3ES1A 2GC0A 3AB0A 1RUI1 1MACA 1PGW1 1QOOA 3URFA 1I6XA 3I4IA 3N36A 4M0NA 4ATFA 2RJKA 3BU7A 2WLQA 4E4ZA 1YFXA 1DYKA 4PLOA 5J98B 2VQAA 1LEMA 2P37A 1A8MA 1ZZ9A 4LULA 4GH4C 3FC0A 4LHKA 2WFF2 2VOVA 1RMU2 2JE7A 3M3CA 1UMZA 3OCPA 1PK6A 5IK5A 2Z69A 4OUSA 3P3NA 2XHKA 3MIHA 1CPNA 1AR62 3WDXA 3VHRA 3ZXDA 1VB4A 1O3TA 2R073 1MS9A 3THTA 4M0HA 4KBBA 4JTNA 2GC3A 1OKQA 4QGNA 1LU1A 1CAWB 3QH6A 4RD7A 1KDMA 3U0ZA 2QJVA 3NAPA 3ZXGA 1W0PA 5CNAA 2D6KA 1FOD2 4CDUC 4I3GA 4XPVA 1K5MB 5FLIA 1NY72 3MPBA 1V6MA 5E89A 4Q4W3 4I2OA 4NPRA 4XF9A 2HEWF 2ZGUA 2ZGRA 1S2BA 1G86A 5H9PA 1LHNA 3M70A 4AI2A 3CJIB 4GA9A 4N43C 4HN1A 4XFFA 4Q4X1 1TMF2 3USUA 1URXA 3ZIWA 3FMGA 1NQDA 4INDA 2XVGA 2ES3A 3KGLA 3VBOC 1U12A 3BB6A 1AVBA 5HCFA 1PM7A 1S0CA 4YG6A 3NVCA 1MEC1 3WV6A 3VBOB 1VBC3 2PYTA 1KS5A 1QJU3 5D8AC 2VULA 4HKWA 1QJX3 1GZCA 2SLIA 1ZNPA 1U5YA 1VRH3 2YUEA 5FAXA 4S2FA 4EWEA 4ONUA 3VBFB 3MW2A 2A7AA 4I01A 2NN8A 1E57A 3GZUC 2VMIA 4HVRA 2RR13 1PO23 3NSTA 1S0IA 2RR11 4QMAA 4AQ2A 1AX2A 4YVSB 2ZX2A 1IQAA 2NLRA 4XF3A 5ABJA 2WC2A 2XWJB 1VRH1 4LO5B 3GF6A 3GALA 4ASMB 1GZ9A 3SXWA 4AGRA 1ULGA 1LOCA 5CU1A 4FPYA 2WFF1 3POWA 3IIAA 2HWC3 2PHLA 3NO8A 1RUG1 2XLAA 4LTAA 1OOPB 4N9IA 2HWE3 4URTA 4X6QB 4GKXA 4X8PA 3AMPA 4OI2A 4SLIA 1AXZA 3B69A 4KQ7A 5D8AA 2ARBA 4BZ4A 2WT2A 2D5HA 2R1BA 4HK8A 4XOGA 4I0BA 5A33B 1W39A 2XVLA 2K9ZA 3CU7A 2SBAA 3MYXA 5T5PA 3RI8A 5GLVA 2H0VA 2RS32 4QPIC 3P3PA 1R082 1MS5A 3A0NA 5C8CC 4NWVA 5C9AC 4CTEA 1GLHA 1NY71 1LECA 1X82A 2VUAA 2YHJA 1R083 2WZPP 1YRZA 1NXD1 1LJ7A 4AVTA 2A71A 1ND2B 2X5IB 2TNFA 2AUYA 3H1WA 4P9YA 1LTEA 4YVSA 1QU0A 1YUDA 5EWSA 2ZGMA 2F6BA 4R4XA 4N9HA 1A3KA 2EVXA 3TN93 1W2UA 2RS53 3ZPYA 5T5LA 3JD71 4IV3A 4FPHA 3SHRA 5JSOA 3EXUA 5F6KA 4ZU4A 4CDQC 4RHV1 1BJQA 1AX1A 3J8F3 4SBVA 3W59A 1FMD1 1CAUB 4OHWA 1WMDA 2O8QA 1D2QA 3UKTA 4AEDB 1TME1 2JECA 4IEUA 4XYXA 3JBG2 2NP0A 2WNVA 4LHNA 3ZX7A 1RL3A 4Q29A 4WV8A 5T50A 3VBRC 3FX3A 4GH4A 3CEWA 1HDKA 1W6QA 2HEYF 3S6PA 2Q1MA 5K7PA 4AEDC 3LGRA 5LK5A 2BGCA 3VHNA 4I09A 2ILMA 2JDZA 1BVP1 2PHUA 2UWCA 1H30A 3O5SA 2QZ3A 2GSYA 4F8AA 1SQ4A 1S0GA 1YJKA 2XJTA 4AHWA 1XNCA 2BPA2 2FMDA 4RA0A 1MQTB 3RJ2X 2HWB2 1V6KA 1RUD2 2ATFA 1KFUL 3VBSB 2WZR3 4QX5A 3VZNA 3VBUC 1RMU1 1N1TA 2VW1A 5CFDC 1J1LA 1WMFA 2V09A 2ZOEB 3ZO0B 3KCYA 4P14A 1H8TB 4JRLA 1EV13 2ZJCA 1MS1A 4KL1A 1ENQA 3VHPA 3R4DB 5I93A 3LWCA 1CQ9A 1FMD2 2PHWA 2XG3A 4I0AA 5A32A 1XU2A 4CDWA 5KBFA 4OHZA 1AUYA 5DZGA 5KC6A 1QOSA 1SLAA 3CF6E 2QNKA 3WXPA 1FAYA 2IXLA 4L92A 1LU2A 2Z42A 1ND2C 2R30A 4IV3C 1OPOA 5JSPA 2DF7A 4K7JA 3W9AA 4BA6A 1QOTA 2ZGPA 5C8CB 2D6OX 1PVXA 4LA2A 3MFAA 1J58A 1R1A3 3HN1A 1Q8VA 1XYOA 3FUQA 4LA3A 3M3QA 3MFCA 4Z8BA 1V9U3 1YYNA 4S2HA 5C9AA 1AYN3 3T1LA 1TNRA 3DF0A 1H1IA 3PVNA 1HRI1 4Q27A 2UURA 1D0GA 1Y9QA 1IKPA 1SBFA 5GZDA 4AHXA 2RS12 1EPZA 2E51A 2VXRA 3FFZA 1N1SA 1F9KA 1MS4A 3AMMA 5T52A 1PVC2 2ET1A 1YFWA 3FUOA 4HMZA 2IZWA 2GZWA 1YNAA 4J6GA 1S2KA 2ZHMA 1HRV2 4P9LA 5JOWA 1ND3A 3WW4A 1W6MB 1PO21 2PELA 2A73B 4XFHA 1S0JA 1UPSA 4YM1A 1GANA 3AKRA 1H2NA 5J3UA 4XF4A 4KH9A 4EWDA 1MS8A 5C33A 4B4QA 1DIWA 4WM7A 1QJX1 5JLVA 1MS0A 4Y24A 1DDLA 2Y38A 1FMD3 3H50A 4COUA 3SISA 4Q0PA 5J36A 3M2MA 3ZN6B 4V1PA 4NHMA 3E5UA 5KC5A 4YG0A 4A7YA 2R041 4IXLA 2RMU2 1BBT1 4D3WA 3OYWB 1RUH1 4RS5A 3AK0A 2RS31 3J26N 1DZQA 3HD8B 4FPLA 5BNPB 3EBRA 1AYM2 2YXSA 2GNTA 4XBQA 2O0OA 4BMEA 2B46X 4MX3A 3TB0A 3ECQA 4COYA 1XYNA 3O0WA 3U4XA 2DV9A 4OULA 1RJ7A 4FPFA 4TWTA 1D4M3 3DV8A 1QQP3 4QPIA 5AC93 4GMP0 3KGZA 4META 1JHNA 4K1ZA 1G6NA 3VBFA 1IKQA 1HW5A 4Q0VA 3E5XA 1KXGA 3ZFEC 1UU5A 2VPVA 1WLWA 2VNOA 4M3CE 3IKWA 1RVF3 4NVPA 2FMYA 4MXVA 1Z78A 4XJ8A 1YWKA 2RJLA 3PJQA 5GLZA 4Z07A 1QHDA 3T1MA 5ABJB 1LESA 1Q56A 4ES8A 3WW3A 1AR91 2VU9A 3FE5A 4KU8A 2BWCA 2IXJA 3D5OA 1ZRCA 3ZYGA 5T3NA 3RDIA 1A6CA 4WVVA 5C4WB 2DUPA 3H0OA 3VDDC 1CJDA 4IV1B 1O7FA 2VW2A 4E4DX 2EAKA 3MF6A 4HVOA 3MIDA 3JCIA 1O3QA 1UU6A 1NLRA 3ZYRA 1NQJA 2I2SA 4D7SA 3NV3A 4WVMA 5FOBB 3IBMA 2GALA 3B3QE 4FPEA 1TMF1 2RS33 1ZBA2 2R6QA 4Y26A 4RQPB 2BNMA 1UU4A 1RUJ2 2XJUA 3ATGA 4Q4Y3 1U0AA 3BCWA 2QE3A 4AWDA 3KQRA 1XNKA 1QMJA 1W6MA 1ZBA3 2E63A 4R9CA 5J09A 4HKLA 4ISQA 4LBOA 4PCRA 4UW3A 1KDKA 1OQ1A 3HAGA 5BNPA 4QQ2A 4B8EA 3RYRA 4GXLA 2WIIB 3KS7A 3AX4A 2X5IA 2I07B 1Q43A 3FLRA 1SDWA 3D82A 4QQLA 2XWBB 2A3WA 5J37A 3ZSLA 1AYM1 4TSVA 2E7TA 2EA7A 5GZEA 2PHRA 5KHGA 1C4RA 4FP2A 3SMHA 2E7QA 5AVPA 3WQ1A 5EXOA 2VMHA 3BOPA 4MSVA 4CEWB 4LO4B 3TNPB 3QLQA 4E27A 4O9GA 1QXRA 2E53A 1S0BA 1AL21 3AFKA 4LO7A 2A3XA 3RMYA 5JAXA 1FPN2 1MS3A 1BEV1 2D6NA 3WW1A 4CEYB 3MZHA 1HX6A 1VBB3 2R062 2WFF3 1WBFA 4JGYB 1PO22 4OUMA 2PTMA 4DPNA 1EYBA 1YLLA 2P2KA 4AI1A 4COWA 4DRRA 1ZZCA 5KHHA 3CLPA 3ZYIB 4LR4A 1LHWA 2UY8A 1NA1B 4YYOA 2GNBA 3LZZA 3NKTA 4KU7A 2R072 5D1IA 2WSVA 3VBRB 3AYDA 5JPMB 1SLLA 1CAVA 1VBE1 3AZZA 4MGYE 3NW4A 4QD2A 3EO6A 3KT4A 2PHXA 4IEYA 5E1RA 3N4MA 3VL8A 1MQTA 1AF9A 4AI8A 1WD4A 1MEC2 3VV1A 2GMPA 4FXGB 2HEVF 5F9TA 4K1YA 1H8TA 4FPKA 1MEC3 4Q4Y2 3MIEA 1RUJ3 1C1FA 3FBYA 1Q5OA 4QQHA 4YVWA 2JKBA 1LULA 3R4SA 1K5MA 4J1WA 2WL1A 3VKFC 4B4PA 5L73A 2X53S 2VMGA 1M4WA 3MEPA 2B45X 4P9GA 4BOWA 2UWAA 5TSWA 2C1FA 4YZ2A 2GC2A 3FHIB 4FQ4A 1UPIA 1Y7BA 2G4IA 2VNRA 3G7DA 1IOAA 3USUB 4AQ6A 1LHOA 5DUXA 4AQSA 1PZ9A 5KHKA 2C5DA 1ZRDA 1ZM1A 3V0BA 4DRVA 3D0JA 3VDDB 2CTVA 5CB7A 1RMU3 4WVMB 3WDUA 1FATA 1DZTA 2B5HA 4L11A 4MGIE 5E88A 1Y43B 4MXWA 3WW2A 5FDBA 5ABJC 1ZBE3 2AREA 1PO11 4ATEA 1VJ2A 1RUE2 2KXLA 4OI0A 1EP0A 2ZS6B 3NL1A 2OA2A 1OQDA 2YYOA 1REFA 4X8NA 4EWAA 5BNNC 4Y5Z0 1FYUA 3HMYA 4XIKA 3E6DA 4IETA 3USSA 1SFNA 2CYFA 2D3PA 4XJUA 1ZZ8A 4YSFA 4DOUA 5FLHA 2FHRA 1F5FA 5FO9B 1C1LA 1BMV2 1VBE3 4YGBA 3B00A 2CGPA 1V6OA 1OFSA 2EXIA 3AMNA 4IEZA 1ND3B 4FTBA 2WINB 1N1YA 4BCUA 4JTOA 4WM8C 1C3HA 1EV12 4Y20B 4GB31 4IESA 1SMVA 4RR3A 1I9RA 4UW6A 2PLV2 3HBZA 4YM0A 1AJKA 1OA2A 2NM1A 1W6NB 2BYVE 1BEV2 3LOIA 5CFDB 1R092 1LB2A 2ZMNA 3QBQA 4BH9A 5BUVA 3RS6A 1C8M2 1QJU1 1M06G 2DUQA 1LCLA 4Z1VA 1NYWA 3WD5A 1YI9A 1HXS3 5FFOC 1PNFA 1YIPA 2VVFA 3O12A 4QU2A 4AK3A 1NCRA 3TN92 3VBHA 4PLNA 2BW8A 4AXOA 1Q8QA 1UAIA 4LBKA 5EFUA 1VBD2 1R1A1 3OYWA 1H2MA 1D4VB 1ND2A 2WQZC 1W6QB 1OPMA 3ZSJA 3VGIA 5ACA1 3WVJA 4YLZA 4FPGA 4CYDA 5J96B 4P9XA 4X6RB 1G9AA 3RI9A 4JGZC 4OI1A 3IPVA 1NA1C 3U11A 1COV2 1XXNA 2ZAAA 3JU9A 1GFF2 3MLKA 4BLIA 1AR63 3LSEA 4XW3A 2D5FA 2YPJA 3IN9A 4CDQB 3VKNA 2R071 1UKGA 1KJRA 2Q1ZB 3ZFGB 2EXKA 4HKOA 4W6WA 3B93A 2K0GA 1CIWA 2WA4A 4P5HA 1W6NA 5IK8A 1GYKA 4LEJA 1K5MC 2ARXA 4GH4B 1QDOA 1WW5A 2X5IC 4UW4A 1V6JA 2UYAA 3IDCB 4XFBA 2VH9A 3WUDA 5JZGC 5C4WA 3I59A 4ASLA 1H4HA 1QXPA 5A33A 4D7TA 4F3JA 2CWSA 3TRSB 3AP7A 2IXIA 2DCTA 5EYXA 1XU1A 5I0RA 5HCBA 4E2QA 4AEKA 3NV2A 1MZ6A 2P3IA 4LBQA 4XQWA 1WLDA 1W0OA 2BTVC 3NAPC 1UCXA 1F2NA 1GQHA 5BNOA 1ZZ6A 4WVZA 5K8SA 2VOXA 4R8HA 1RUC2 1C8M1 3FLPA 2V5YA 5HXVA 2A6VA 2D97A 3AYCA 2RMU3 1WW7A 1HRI2 2IXCA 2NPIA 3J8F1 1EPWA 2ZA9A 4YVSC 4CDXC 4PIXA 4QXKA 3D6EA 1UIKA 5J48A 5H9QA 4W6XA 5FRAA 3L9JT 1V6LA 2D43A 1RUE1 2IWGB 5CFCC 2DCZA 4OLLA 2IFWA 3WX5A 1RUH3 2XJRA 3B94A 3I59B 4NOTA 5C8CA 4PF5A 3WP5A 1DFQA 1NG0A 4CEWA 2XKPA 4EN8B 4C1WA 5IUQA 3VHOA 4IEOA 3THPA 4TZDA 4DY3A 4S2DA 4AEJA 4XFGA 4LNVA 3I7DA 1RVF2 2QZ2A 4GKYA 1RHI1 3U10A 2RS11 1VAKA 3O0XA 1VP6A 3AKQA 4JGYA 2QQPA 1Z7S2 3A0KA 3B9CA 3JB8A 4XZPA 1LODA 4DXZA 1TEIA 2OW4A 2PHDA 1ZRFA 4QHBA 5HBAA 5BNNA 3MPPG 4OHYA 2PA7A 4A3XA 3W58A 1TNFA 4WZFA 2B9UA 4K21A 5CA6A 1MZFA 2ETEA 3INAA 1U5ZA 2RHPA 2YZ4A 3IPVB 3KT7A 4PLMA 3VLBB 2ZKNA 5B2GB 2RS52 3M7AA 2BVBA 3D0SA 1CONA 1F5JA 2ZMKA 1CESA 5E8AA 1OOPA 1LGBA 3L2YA 3AP5A 2W08A 3TN91 1U5XA 1XE8A 2ZABA 3JBG3 1CGPA 1EAH3 5KHJA 3E6BA 1ENRA 1H8VA 1LOFA 4PDWC 5ACA2 5JMCA 3KMHA 3QCWA 1B09A 3SCFA 3C3VA 4IEXA 2NQYA 4PJYA 2QCSB 1NZCA 3TYJA 3V0AB 4K3UA 3OPZA 5GLTA 1KQRA 5BXXA 2EAAA 4N53A 3Q9OA 1MZ5A 1CAVB 1FT9A 2VVDA 2ZCWA 3JBG1 1WCKA 4C90A 4GMP3 2I45A 4FBFA 1G9BA 1X7NA 1XRUA 2HWE2 3ZXFA 1BK1A 2X8KA 4WVWA 3U07A 4HPKB 2XKOA 3V0BB 4PQ9A 3K48A 1LOGA 2G9GA 2ZGLA 1UZZA 4YRDA 5BNOB 4L2NA 4BM8A 4PBPA 2W0XA 4EN6B 5DUWA 3WG4A 1VAMA 4XJWA 4DZGA 1X8MA 4FVVA 1NE6A 4DFSA 4YZ3A 5SV5A 4XHXA 4QQPA 4G3YC 2R063 5GKAC 2YROA 3AMQA 3RYPA 4KGGA 3QOPA 2HJIA 4E4SA 4JDOA 1VIWB 3ZYJB 4HL0A 1KS4A 4YARA 4BPZA 1LKNA 2XVKA 3CO2A 1HQNA 1QJY1 4AW7A 3RNSA 1DGRA 2JXAA 3EHKA 4AVSA 1QY4A 1XNBA 5KXCA 3KCCA 3VDDA 2GH2A 4EJRA 1AR93 1SCRA 1FI2A 2DTYA 1ZYBA 2MNGA 4AVBA 3R4UA 1I3HA 3GHNA 4ITCA 2VGDA 1QGLA 1YI7A 2I74A 3AZWA 1ZBE1 1ASJ3 4RS5B 1L3JA 3LCPA 5CFDA 2WNVB 1BVVA 1POV3 5JIAA 2AYHA 4XMIA 1AL22 3ACLA 1QNYA 4RGAA 4CEYC 1Z7S1 4FCAA 2DVDA 3ZXAC 1TME3 1D0HA 3WDWA 1AR71 1Q8OA 2ZGSA 2OUHA 4P9JA 2Q5TA 3GBWA 3QH7A 4O9EA 1DYPA 5L7OB 1OFNA 3VBHB 1MQTC 3H8UA 4F7ZA 1LGNA 4QGMA 3JB4C 4LE4A 1X50A 1RUD3 1QNWA 2VOKA 1SBEA 3HT2A 4KWLA 4EV0A 1VBB2 3H1YA 4LUMA 2R043 3ZFFC 1QWRA 1S0FA 2WQ4A 3ES4A 5CFCB 3AM2A 3ILRA 3B01A 1RUJ1 4ISRA 3PJYA 1OLRA 3SCHA 1O91A 3X29B 1AHSA 3V0AA 1JYCA 4KWJA 3ETQA 1IGOA 4BIFA 2A3YA 3KLSA 3WQ0A 2A6YA 2FBEA 2XJQA 2VNGA 2LALA 4XFIA 5FBZA 2MEV2 3WG3A 1KRIA 4AHYA 4CP0A 2WZR2 4AGVA 4DB5A 4ZU7A 1UZYA 1MVQA 2LTNA 4PIYA 3ZYPA 1EY2A 1OLQA 5GJ6A 2GNMA 1VBE2 1YHFA 3ZXJA 1DBNA 4RQPC 1CAWA 1O4YA 2PLV1 5C4WC 5L7OA 1GSLA 3LA3A 3ZFEA 4LO6B 3NAPB 1HRV1 5LK7B 3H3ZA 4EN7B 4N53C 1QJU2 3DPRC 2X29A 4NHLA 1UD1A 4FAGA 2VG9A 4CEYA 3OY8A 4LBQB 4WZCA 1BEV3 5JPNB 4LHLA 5BPXA 1RUF1 1D4M2 1V9U1 1GNZA 3MW4A 1LOFC 4IV1C 1RUF3 4Z2WA 4ZU5A 4HSLA 4IEPA 4QPGC 1JOJA 3AMHA 3CL1A 4MZUA 4TYSA 2Y26A 2ET7A 3WHTA 5JOZA 1IPKA 2JX9A 1VBC1 1O3RA 4CP1A 3WOGA 3OJBA 1OOPC 1F31A 5K0UB 2EF6A 3ZFGC 5JI7A 3DKWA 5DG2A 1HIXA 3H7YA 5GM0A 3L2HA 5K9YA 1ZX5A 3GNEA 1REEA 1YJLA 3J9SA 4I30A 4F83A 1DQ4A 5CAZA 5T55A 3VZMA 1I1EA 1OQEA 1IS4A 2GMMA 1VBD1 5I0TA 3S30A 3TAYA 1Z0HA 4Q0QA 4Y22B 3NJZA 2ZGOA 1J3QA 5JSRA 2XLGA 4KG0A 1AXYA 5I8TA 1NOVA 3VN4A 4XE9A 1UIJA 1XYPA 3ZVXA 3M3IA 5IK4A 4AEMA 3AXEA 1JXNA 2A6XA 5BNPC 3KT1A 4MGZE 2VUJA 4QM8A 3UL2A 2JEMA 5KHIA 1QJZA 5H9RA 2WT1A 4K20A 1N3PA 2PQQA 1J3RA 5JDBA 1QXJA 2ZPXA 3N7KA 2JG8A 3V56A 1QJY2 1V6IA 1DGWX 3UKNA 3IM0A 4EN0A 3V64A 4N43B 3NV4A 4NO4A 4MUVA 4B7EA 5JOYA 2F4PA 1VRH2 2DCKA 1SBDA 3S7EA 1YFYA 3SH5A 2NMNA 2QUOA 1AR81 2GN3A 1SLTA 2ENRA 2IXHA 1RTVA 4QQOA 3AFGA 3H1MA 2D3RA 2PAEA 2ZX3A 4J1XA 2XJPA 2C9AA 4MVTA 1LHUA 4QM9A 3JD73 3LOBA 3CJIA 1WW6A 5GZFA 1O4ZA 4BMBA 3G6JB 3APBA 3JD72 3BODA 4QT6A 1CJPA 1IS5A 4AVAA 3OBTA 3OY8B 4UBHA 4COZA 1BBT2 1CX4A 4MLOA 1RUH2 1FV2A 4XTPA 2KM2A 1LOBA 2CL2A 4XJAA 4MV2A 2CGOA 1RHI2 2GC1A 3AJZA 3GZTB 4XJZA 4YM2A 4WM8A 4N7IA 2MPFA 4RQPA 4N43A 3KB5A 2EXJA 3R05A 1Q8SA 3ZMOA 2P34A 1H8TC 4HANA 1R093 4N53B 1U5IA 2W52A 4ES9A 3PVEA 1SLIA 4FO9A 4KNCA 1LRHA 2DUOA 2GU9A 2UY9A