2LM3A

Structure of the rhesus monkey trim5alpha pryspry domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
205
structure length
205
Chain Sequence
TELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tripartite motif-containing protein 5
publication title Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Ligase
total genus 36
structure length 205
sequence length 205
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lm3A00
2LM3A 4N7IA 4X8NA 2VOKA 2YUEA 4KG0A 4WVMA 4XW3A 2YYOA 4P9LA 3UV9A 4X8PA 3TOJA 5F6LB 5C33A 4P9JA 5F6KA 5JIUA 3ZO0B 4B3NA 4V1PA 2IWGB 4QT6A 4WVMB 2FBEA 3KB5A 5JIAA 4P9IA 5JI7A 2E63A 2WL1A 5JI9A 4N7UA 4B8EA
chains in the Genus database with same CATH superfamily
1FPN1 4CVUA 4AEDA 4YZ2A 4MGSA 5F37A 5FQ0B 5LRRA 1JU4A 3E6DA 5JXJA 1PZ8A 4LO8A 2BVVA 3KHBA 1CAXA 4IETA 1HDKA 4KQ7A 1ZRFA 3JB4C 4QXHA 3KZ4C 5JMCA 1HJGA 4TLFA 2D44A 4GMP0 3NAPA 5FPAA 1LHWA 2VXJA 1MEC1 2WA4A 1AYN2 5FYIA 1J84A 2A75A 1S2KA 5BYNA 5C33A 1DGLA 1ZRRA 2YU1A 3MPBA 1CZTA 1J59A 3KB5A 2DURA 4JX0A 5IT6A 5L19A 1W2OA 5CBLA 1LAJA 2RDQA 4DUWA 2VU9A 1UF2C 4ORFA 1Y9MA 2ZX2A 3K2OA 4AHYA 5CEHA 3H0OA 3I59A 1QQP3 5TSWA 1LTEA 4CPBD 2AGSA 4DOUA 2OZJA 1YI9A 4X6QB 2PAKA 2J1UA 2XKOA 1HW5A 2ARXA 4KG0A 5A3PA 5FZCA 1GQPA 3WX5A 2XHNA 2QDRA 3ILFA 2ETEA 5IVBA 3KS7A 4CU9A 3PUIA 3ETPA 2IXJA 2VMFA 3Q8CA 4S2GA 5FZ6A 3UNPA 3G7DA 2ZCWA 1WW7A 4OHXA 4ZU5A 5JSRA 3SMHA 4U2AA 4ZS2A 1HXS3 4QXBA 4GIQA 5EQUA 3J7NA 5EJ3A 3PIGA 2IWGB 5A33B 1DGRA 4X6RB 4NHKA 3J8F1 2AUYA 3E5XA 3EJKA 1G6NA 3FJSA 2ZGQA 4FTSA 2VBPA 2G4IA 1X7NA 1WD3A 3H8RA 4BOWA 2VZPA 3LWCA 5FZ3A 2DDUA 5KC6A 1Z7S3 1BJQA 3UJQA 1COV2 4MVTA 1N1TA 4XXPA 5C5TA 4CU8A 1LU1A 1R081 1DU3D 5FZEA 3RZGA 1J58A 1TMF3 1UZYA 4AF9A 2PAEA 2X10A 4IERA 1GANA 1V9U1 2VPVA 3FFZA 1JYIA 1N1YA 2PHXA 4CU6A 1QXPA 3POFA 5DUUA 1B35C 3ZYGA 4CEYB 4H55A 5LEKA 3I49A 4GB32 4M3CA 2ZA9A 3HNMA 2R072 5DDJ3 3SQOA 3ST7A 4DFSA 3A4UA 1OFSA 1PGW1 4NVPA 2RS51 1BKZA 4PDWB 3NAPC 4OFGA 1LCLA 2QQMA 3T3YA 2EAKA 1EYBA 1FOD2 2YB7A 3BI3A 1PM7A 3ZFGA 2A3WA 2ZZQA 1YFXA 1M4WA 1TME1 4IV3C 4CXWA 3ZMOA 4PCRA 4YW2A 1V6LA 3D8CA 1SACA 3VL8A 4QB6A 3ZYJB 1AYM1 4Q4X1 2H0BA 4P9LA 1CZSA 3SHRA 4Q0SA 3WP3A 2I45A 3C7HA 5FPZA 3PIJA 4UFMA 5CKQA 1XYOA 2VO5A 3OB8A 2Q8CA 3MV01 1DQ4A 1LOFC 4XFBA 2WJSA 1TQ5A 2FBEA 5EJZB 5CYYA 5FYZA 3AJYA 1RUJ3 4AI2A 4HBNA 5FP7A 3B93A 4IV1C 1IG3A 3VKNA 4I01A 2H6BA 2VQ0A 5LEJA 1QH7A 1VP6A 2VQTA 2ID4A 5D8AC 1UU4A 3LE0A 3C3VA 3WW3A 5J09A 4XOGA 1L7QA 1Q8PA 2I2SA 2IXLA 1QOSA 2VW1A 1G9DA 2TUNA 1JU3A 1SLIA 1ZVFA 2Q1ZB 1MS1A 3C7OA 4XAAA 5ABJB 4MGTA 2JE9A 3E5UA 3H42B 4I3PA 2QJVA 3M7AA 3TBDA 1DQ0A 2A3YA 4UOJA 4YM2A 3KD4A 4XHXA 3URFA 1GLHA 2ZJCA 1YYNA 2CU5A 2WO7A 1HQWA 1OBNA 4YZ4A 2FCVA 2J1EA 4YG3A 5FMOS 2E6VA 5FPLA 4R9AA 3ZDSA 2D7FA 4E4HA 5C7GA 2F17A 2UWBA 1VBE2 2VOKA 1D0GA 3GF6A 1A8MA 4XUNA 5B4XA 3TNQA 3RZJA 2QQPA 1NQDA 5IFTA 5CB7A 3DYPA 5FPBA 5A1FA 4X8PA 1BMV1 3FBYA 3GGLA 4AVVA 5FO7B 2VCMA 1MZ6A 4BDVB 4BU2A 3RZZA 1X9TA 2VUAA 2VTFA 2V73A 4NIHA 2ZACA 2B45X 1XSQA 3MPPG 5KXCA 2JDAA 3KT1A 2E32A 1SHWB 3GBGA 4HKLA 4ZY9A 1DLLA 1L3JA 1PK6A 5EPAA 3LDRA 4I30A 2D6MA 4XILA 3VBFC 1AL0G 1SBDA 4EYUA 2VNGA 2BNMA 4JHZA 2FCTA 1S0JA 2BGPA 5C71A 1WMFA 2JDYA 4Y22B 1VLNA 4HN0A 1W39A 1ZBE3 4M3CE 1XQNA 3VBOB 3ORJA 5KXEA 4XDQA 3S30A 1R1A3 1ENQA 4CYDA 5HI0A 1G9BA 3ZFFA 1RUC1 1DP0A 2A6XA 3N9PA 3VDBA 1OQDA 3LIHA 3OUJA 3FHQA 4YVSA 1VBB2 1W90A 1NZIA 3TN93 1WCSA 3N9MA 2BGOA 1GFF2 3RZKA 1DFQA 3WHUA 2WZR1 2W08A 2C1FA 2C5DA 2Y38A 2YPDA 4YG6A 4DB5A 1PNGA 1TE1B 1R093 3D82A 3AZZA 4J1XA 2IXHA 2VZUA 1BK0A 3ZX7A 4OI1A 1ZM1A 3EO6A 5I8YA 2XUEA 1H1MA 5I0TA 3NJZA 4E4SA 2VD7A 3H7YA 4QX0A 3C2UA 1I5PA 1ZYBA 4SBVA 1G9AA 1XU2A 2HWF3 1HRV1 2YY1A 1X9PA 1XB9A 2VNOA 3VZKA 2VOWA 3ZXKA 2HWE3 1JBCA 3ACIA 3VHOA 2RR12 2KD7A 5GJ6A 3VKMA 1RUG1 4F3JA 5IVEA 4O9EA 1W2TA 2QFEA 1NE6A 2WA3A 1FPN3 4FPCA 5K0UA 2ES3A 3NO8A 5A7WA 2BBVA 1HKDA 4CZSA 1W8FA 4AI1A 4CCCA 1ASJ3 1NY72 1PIV2 2VNVA 4JGZA 5L73A 5JOYA 2BYVE 5GKAC 5FJHA 2RS13 3LDKA 4PIXA 5FZFA 3ZXGA 1KJRA 5L36A 3FN9A 4Y26A 4Q4Y1 2XXZA 4HMZA 4AEJA 2YGLA 3C7EA 4HLTA 4CDWA 3CJXA 5D1IA 2XJRA 5C6CA 1PK6C 1LOCA 4QPWA 4OHVA 4Y1XA 3I2GA 1RUE2 1ENRA 4H3WA 5JXGA 5FP9A 4K1ZA 4BQ1A 4IEYA 4QGLA 3B02A 2E7QA 2XDVA 1UY1A 3IAPA 1DZQA 3WF1A 1BCXA 1FYUA 4QKBA 1D4M2 3DUIA 3I4IA 1VBA2 1AX2A 3GXUA 3ZFFC 4P08A 2H6CA 3W21A 1QJFA 1SPPA 1W6OB 2VCBA 4YVSC 4BMBA 5KR7A 3LFMA 1MZFA 3FBMA 2UWAA 3ILNA 1CIYA 3ECQA 3AKRA 2V4AA 2GAUA 4XQ4A 4AEDB 3RZMA 2Y33A 3J8F3 5FMBA 1RINA 1JZ2A 3UYJA 5LBEA 3POWA 1H6XA 5FO8B 3HIFA 4G4FA 2QZ2A 1QIQA 1CAXB 2BOIA 3KT4A 4YW7A 2W3JA 5C3PA 2WQ8A 3Q8FA 5FY9A 3NAPB 2D6PA 2YMZA 4FPFA 1V00A 3TEZA 3FC0A 5E6HA 2GN7A 1VJ2A 3V64A 1RUH1 1RJ8A 1R083 1STMA 3NJYA 4B7EA 5LA1A 3I7DA 3CJIC 2Z2SB 3OGGA 2FQPA 4Y20A 5BNNA 3NKTA 1MEC2 3U14A 4CEWA 3INAA 2FD8A 3M3IA 4AGVA 1V9U3 5JCTA 1W8TA 4ZU4A 2VOXA 2PHWA 1UNBA 2JDPA 5K0UC 2BZDA 1FV3A 1W3XA 2WBKA 4P02B 3O1UA 3AYEA 2XG3A 4I09A 2XWJB 2YHJA 1W6MA 4JGZC 4RGGA 2PHRA 4XJWA 5H9RA 3ZXJA 1PVC1 1SLLA 3WG3A 4D7TA 2FZ1A 2XLFA 4LBLA 2H0VA 3R0RA 1BBT1 4YGCA 3CQOA 4BMEA 4K1YA 4BXFA 1JUIA 4Y24A 4CDWC 4E27A 3HN1A 1GP5A 1P8JA 4A7YA 2ZBJA 4ATFA 1AYM3 4Q4X3 1SBEA 4NWVA 2JE8A 1V6KA 3OY8A 4GWIA 4XZPA 2Y64A 3RYKA 1S0BA 5F2SA 4XMIA 3AMHA 4P9GA 2CDPA 5EYXA 4E9KA 1GNYA 2Z79A 4HKOA 4LE3A 2AACA 2HEYF 5CIRA 1A78A 1ACCA 1DQ5A 4YPJA 2YV8A 5CA6A 4ITCA 1LU2A 1OC1A 2PHUA 3JBG2 2R1BA 1C5HA 2EIDA 1O3SA 3QH6A 2BUKA 2QQWA 2VQAA 4IQPA 4RFRB 1AR62 3JD73 4Q26A 1CQ9A 3PU3A 2B9VA 5FKCA 5DQ0A 4RYDA 2ZGRA 2DF7A 2NZ9A 4GKXA 1H2MA 3WCRA 4LBNA 2HYKA 2WO1A 2XUMA 4CPBA 4D6RA 1AF9A 4M3CB 4BQYA 2D40A 4JDMA 2E7TA 1PO21 3S0MA 1XNKA 3JQWA 5GLZA 2ZAAA 1OLMA 3P6BA 3BOWA 3TYJA 1TNFA 3NQHA 4AFMA 4NAMA 1AHSA 3ZFGB 5C3RA 2YFUA 1YHFA 1CAVA 1RMU1 4HETA 4S2HA 4QKFA 2Y6JA 5LY2A 4BQ3A 1GZCA 2RS52 1DQ6A 3B01A 2ADDA 4FPOB 4XZUG 3KM5A 1C8M2 4CEWC 5DAPA 5L7OA 5IK7A 2JG9B 2CTVA 4RR3A 3OTFA 2D93A 4ISRA 4X8NA 4YWAA 2QUOA 2AH2A 1DF0A 4RGAA 4GZ9A 1R1ZA 3ZSEA 4C91A 1XNDA 3WT3A 3MFCA 3AKTA 1TZOA 4YZ5A 2J1SA 3AZVA 2FDJA 4BIOA 4XJ9A 2E33A 2ZOEB 2DVDA 4QX1A 3VHNA 1EV11 3R6SA 3K4AA 4KWUA 4PJYA 3ILRA 3OEBA 3AKSA 3MW4A 4B1MA 3U4XA 1CAUB 4QMAA 4EN6B 4E8DA 1QJU1 2FDHA 2EVXA 2OQ7A 4CDQA 1W8NA 2R061 4KL1A 5FFOC 2NM1A 3SH4A 3LD8A 4YNIA 3UKTA 3VKFC 5KHIA 3KCXA 3LSDA 1OT5A 3R4SA 2BFUL 1CZVA 4XJZA 4CP1A 3WNKA 4COVA 3VLBB 4PHZA 5EHDA 1FMD1 1NCRB 2AC1A 2XJTA 5I8SA 3Q9OA 4AQ6A 1SBFA 3VV1A 4BH9A 4R52A 4EV0A 5BV6A 2LROA 1AXZA 1UKGA 3AB0A 4JAAA 4AQTA 3HAGA 4CP9A 1EAH1 2XJQA 4Q4W2 4RA0A 1UYXA 2C6SA 4QX3A 4Y5SA 4E2SA 1PHMA 3E97A 2GC2A 3IKWA 1CWPA 1YC61 3WEZA 2JKBA 1V6JA 4YZ1A 3SNMA 1BLZA 2K9ZA 3PNAA 1D4VB 5FBJA 2VUJA 4R9DA 5DG2A 4A2UA 3N35A 1HRI3 1JOJA 4C8DA 1VMHA 5FMDA 2YPJA 3WF2A 1OOPA 3JUUA 3OGRA 3ZYHA 4NAOA 4K21A 1DGRN 5LBFA 3JCIA 2BBAA 5L7OC 3IAQA 1QOTA 3GCXA 1JODA 1YEWA 1NE4A 1ZZ7A 1ZRIA 2F4LA 1RUG3 1V6OA 2WO2A 4RR3C 1VBC3 2QQJA 4Q1RA 3DPRA 4YFWA 3LZZA 1HB2A 1MZEA 3NJXA 1SFYA 3P5BA 4CCDA 4TYSA 4RHV2 1EUTA 3ZN5A 2GNMA 4XFGA 5CAZA 1A6CA 4AR2A 2JD9A 2RS32 1I6XA 1C1LA 1WBFA 3UJOA 5IATA 1SCRA 5ABJA 1OLME 2XQRA 1SFNA 5APAA 3ZFFB 1W8OA 5JOWA 2A1XA 4AI3A 4GALA 1DYPA 3M3CA 4YVSB 2W95A 1LR5A 5GALA 4C0HA 1JI6A 2X05A 4XF9A 3GNEA 2W91A 1QJEA 3ZR5A 1DQ2A 2HEVF 2QE3A 4A3XA 4FSJA 1MS9A 1Z78A 4CDQC 3CBNA 1W28A 5DUXA 3J26N 4TLGA 3NVCA 4CDXA 1AL23 4RN5A 2RMU1 3JQXA 1WLTA 4CUAA 2WZR2 1OLRA 1TG7A 4XBLA 4FOVA 1C5IA 3MV11 5FYMA 5FOJB 3WR0A 3WQ0A 2ARBA 3ZXFA 1A8DA 5IFPA 1MQTB 5IVJA 3GZTB 1W0PA 5C9AA 1ZNPA 2VZSA 3M4FA 1PZ7A 3B69A 2HLEA 1HX6A 4BXSV 1ZBA1 2JIJA 2SLIA 3VZLA 3N7KA 4HOOA 5K0UB 4XFCA 3PTYA 3WVJA 5A7WB 5GLVA 3MIFA 3NNLA 3I2OA 1XE7A 3FE5A 4LO7A 4Y1ZA 4LLFA 5DMYA 2KXLA 1LENA 4JGZB 3SC7X 2RM22 3H1WA 4QDSA 5JDBA 1AVBA 3MFAA 5GM0A 1YCIA 3RS6A 2WYSA 5LRSA 2VBBA 4MUVA 3ITQA 1Q56A 3NNJA 4OUMA 3LDBA 3ON7A 3M3OA 4LTAA 1WCDJ 2N7GA 4Q4V2 4IE5A 1DQ1A 4KBZA 4O7XA 4XUQA 4CDWB 1RUH3 2X53S 3VD7A 3RGBA 5BNPB 4ISQA 5L9RA 2MPFA 5FZBA 5JAXA 1GOFA 3POJA 1K12A 4DRVA 3G6JB 1O6UA 3R4UA 4Q4Y2 3IPVA 3R05A 2EXHA 2WLPA 3ACGA 1DIWA 1URXA 5IYYA 2FDFA 5FY8A 3T4HB 5JPMB 1XE0A 2QQIA 5T5JA 2OZ6A 2QCSB 5FJKA 3T2QA 5BPXA 4B4PA 5FR3A 3VBRA 2E9QA 4ASKA 5ABJC 1H4HA 1PVC3 3K4DA 1WMXA 2DBNA 1SPPB 2GMMA 2NPIA 4ARYA 1UZ0A 4UW4A 3S5QA 4L9BA 2JDHA 3O1MA 1ODNA 5DZFA 5J96B 3MZHA 1LB2A 4IW3A 1WUVA 5IVVA 4A6SA 3ZVXA 5FPVA 2YBPA 2GC3A 2BEOA 4LKEA 2P1BA 3SISA 3ZMNA 1UXZA 4QX2A 1DZRA 2RJKA 2WZ8A 3POIA 4QB2A 3UETA 4CDXC 2ZS6B 2HKXA 3I2FA 3UESA 1XU1A 4PF5A 4AFDA 1DYOA 1UO9A 4CCJA 3NV3A 3ZIXA 5C5UA 2OT7A 3BN6A 2QQVA 3WNNA 3H8XA 4NIGA 2UURA 1U5YA 3HQRA 2JB4A 3W20A 3VKLA 3GZAA 4MO3M 4WM8A 5DZEA 1OH4A 1NLQA 2EIBA 2Q30A 4LOSA 4UW5A 2PYTA 5GLWA 2XWBB 4B4RA 5C9AC 3BU0A 2BNNA 4C1XA 1NLSA 4Y20B 4YFZA 1YQCA 5BNNB 2B39A 1MS3A 1W99A 2RG4A 2PLV2 1S55A 2HWC3 4CEWB 4XABA 4XJUA 3UT0A 2Y0IA 4HANA 3TN91 4MGKE 2KR2A 3THCA 1K5JA 3IDCB 1DG6A 2HWD3 2P5BA 3VHRA 1VMJA 4QX7A 2PHLA 1GZWA 1PO23 1UMHA 3BPZA 3H9AA 3WW1A 4U36A 1AR73 5I93A 4PI0A 1ULGA 5KXDA 4OHZA 4R9CA 3VL9A 1NUKA 3CO2A 2PN5A 2VZQA 5ACA1 4COUA 3K3OA 1RMU3 1ZA4A 5FP3A 2HWF1 4YGDA 4YM0A 3ZN4A 1ZRDA 1QJX1 4NRPA 2WAOA 1YUDA 1WCQA 3OY8B 3EBRA 1BBT2 2JDMA 1NT0A 2BOJA 2GNDA 4MX3A 2W1QA 2WIIB 4GD4A 5FRAA 3KV5A 2VZ3A 4LUKA 2VM9A 4N7UA 5FLJA 3LF7A 1YQ2A 5A7SA 3ROUA 1Q8SA 4TZDA 1UAIA 1UZWA 1ZZBA 2VUCA 3U1XA 4Z8BA 4D8MA 2OIIA 2ZKLA 1WZXA 1YRZA 1YIFA 2PHTA 2XBO1 1C57A 2P3KA 1IOAA 4XW3A 2AR6A 3J7HA 1ASJ1 3ZXEA 3O1VA 1UWWA 2E7AA 4R4ZA 2BWCA 3AM2A 1GOHA 1APNA 1CJPA 3OD4A 2RS11 1EV13 1GP4A 3NMBA 5JVVA 5A3WA 1EY2A 3H50A 4Q0PA 5A80A 1RTVA 3SH3A 5FZIA 4FOWA 3OPTA 4BLJA 5IVFA 5F3EA 4META 1QJU3 2B9UA 3KHCA 5ERLA 3APBA 5FXZA 2DYCA 2R063 3HPNA 3IIIA 3MW3A 3OG2A 1W2NA 4O61A 5EFUA 1NZCA 3EHKA 2W9XA 3AZWA 5FZDA 4LEJA 4AAXA 1GQHA 2WZEA 4B8EA 1H6YA 2QTWB 4XCAA 3RRDA 4XYXA 2V5YA 5DZGA 1FMD3 4WM8C 1OF4A 1CAVB 1KS5A 4HK8A 2JDKA 3DKWA 1H2NA 3J7MA 1ND2A 4RFT0 3WV6A 4BQXA 4EZHA 3SEPA 2VC9A 2DCKA 3BVCA 1EAH3 5L7OB 1EPWA 4QU2A 2VVFA 4RR3B 4QHZA 1Y3TA 3WUDA 2XHKA 3N9QA 4OZXA 5FBZA 4AQSA 2WC2A 1O4TA 2BTVC 4EN0A 1UXXX 4LK7A 4EE2A 3VD4A 4DXTA 1Q5OA 3AZXA 5F5QA 1ZZ8A 4FTBA 2E31A 5L9BA 1JYTA 4YW5A 1OD3A 3T0AA 3U11A 1REDA 5JMOA 4OI0A 1M06G 1HLCA 4N43B 2ERFA 2J42A 3WY6A 4DUVA 3O1SA 3ZYPA 5DAVA 2GMEA 1OFNA 2JDNA 4IEOA 1W8UA 5FK8A 5FAXA 3O1TA 3FLTA 4CDQB 4FFHA 3IB3A 3FL7A 4BM8A 4LBQA 4CXXA 3W5MA 2HYXA 1YNAA 4UBGA 3QOPA 3WQ1A 5JIUA 4JQTA 2Z4FA 4LO4B 4LA2A 2QVSB 4AEDC 1N3QA 3IM0A 1XNBA 2E63A 4AFCA 4AI9A 1DLCA 2D43A 2NQYA 3VBSA 1VRH1 2R041 1W2UA 4FP3A 5E8AA 4CP9B 3PJYA 1QQP2 1HIXA 2Z42A 4PBPA 1T6BX 1UIJA 4K7JA 1AR83 5CKMA 5FZ8A 5C8CA 1MVEA 3OGSA 3DN7A 3VZJA 4IEVA 1B09A 2RMU3 2WNUA 3LOIA 1RUF2 1PGSA 3OUHA 2NLRA 3TOJA 1CX1A 4JVAA 3PURA 3VZMA 2JG9A 3HBKA 4QWNA 1HXS2 1W03A 5LK7B 1S1AA 4LK6A 4XTPA 1JZ6A 2ZX3A 3AJZA 4N53A 4LNVA 3OUIA 4PBOA 1W9TA 1OOPB 4WVVA 1DGWA 3WF4A 3ES1A 2JEMA 1AUYA 2WNOA 3LFIA 1OKQA 1IQAA 3CZJA 1DCSA 1K5MA 3H3ZA 4TXWA 1X50A 5FWJA 4XDOA 1ZBA3 4OQ8A 1Z7S2 3JD71 3VDAA 2WFF1 4DMIA 5C4WB 3DPRB 4MHRA 4TN7A 1J3PA 4LKDA 4HVRA 1HB3A 2FHRA 2Y6FA 3C8XA 1CAUA 3WNXA 1OA4A 4I0BA 5FYYA 1TMF2 3DGTA 3MICA 3M8LA 2ORZA 5LBBA 4LBJA 1Q8QA 4CCOA 1LOBA 3B7MA 3BUCA 4MXVA 4AZZA 3K51A 1JYCA 4JDNA 4YVWA 3USUA 1SZBA 3OD0A 5LA2A 4Y5TA 2HWB3 3WDTA 1SG3A 1C3HA 4CU7A 2DWRA 4V2VA 4LBMA 4OUEA 5A3NA 1T6GC 1NCRA 1NCQA 2J1RA 1VE0A 2VCAA 4MGYE 2KA3A 3GALA 3GBFA 5DDJ2 2RDRA 4CP2A 1E5HA 1AJKA 2P3YA 2LM3A 4Q0UA 4CDXB 4ZXEA 2W87A 3I2JA 3CMGA 4CSWA 4YYOA 4NO4A 5CFCB 3VUOA 3OGJA 4FOQA 5H9SA 1UYPA 4YARA 1F8VA 3W58A 2DTWA 3AKQA 3BYWA 3VBSC 3MIGA 5C9AB 2Q1FA 5KHGA 4JTOA 4AGRA 2R0FA 2JD4A 1Y7BA 2CAVA 1UCXA 2W1UA 4RL7A 4DPNA 4A6OA 2Z69A 1O91A 2K2SA 5JI7A 3ZFGC 5F1RA 1UZZA 1QJY1 1Q3EA 1CN1A 1RUJ2 1OURA 1WW5A 4IGOA 4LIVA 4QPIA 5FZ4A 3T09A 5C8CC 2G9FA 5J98B 3MO4A 5LWBA 5LBCA 5M0TA 3A7QA 4IEXA 3D5OA 2JJ6A 1H8VA 4IE4A 2WABA 4N7IA 5FLHA 1YFYA 2JDUA 2D97A 5DAQA 1OPMA 1ZZCA 4AVAA 2JG9C 5IK4A 2HJIA 5DXDA 5A1AA 2VOVA 2JECA 2YC4A 1W0OA 3V65A 1KRIA 5FWEA 1CONA 3UV9A 2OPWA 1RITA 3LEMA 1V6NA 3T2PA 2JIGA 3ZM8A 4B4QA 1SMVA 1OVSA 1QJZA 3ALQA 1PGL1 3A0NA 1YQ5A 4KGGA 3ZOIA 3IPVB 4IE0A 2MEV1 3PU8A 4L99A 2BV4A 1AR91 3VGIA 2PFWA 3KMHA 5EIYB 5A1LA 2FDIA 3N9OA 4A4AA 2J1AA 2WNEA 5FZAA 4K3UA 4PLMA 2D5HA 3DXTA 1C8NA 1RXGA 1VBD3 3NKGA 3VBRB 4WM7A 5FP4A 4H14A 3JB8A 3VZOA 4DEQA 1RVF3 2OKXA 5J3UA 3H7JA 3JZVA 4YVWC 1I1EA 3H8OA 2J1TA 3IIAA 2XB6C 3PLQA 1SLBA 5ACA3 4W6WA 1J1LA 1CIWA 1CD3G 1HRI1 2ATFA 2ZPXA 1HN0A 1NCRC 1NCQC 2YDEA 1GKBA 1V6MA 2VXRA 3OYWB 5C3OA 4Y4RA 1MQTA 1QJX3 2WS91 2QQNA 1S2EA 1XJAA 2ENRA 2PAMA 4KU7A 5FZHA 4B3NA 3KV9A 4DY5A 1NYWA 1JOBA 2GZWA 3L2HA 1GNZA 4JKKA 4E2GA 2CHHA 4BWOA 5JSPA 3WDWA 5DABA 5FPXA 1VBC1 5FYHA 4CUGA 4WM8B 3EYPA 2XBO3 4CTEA 5J37A 4AAPA 4CCNA 3ZXLA 2DVGA 3F95A 2NMOA 4TWTA 3BKZA 3MBWA 4LO6B 4QHOA 3ZN6A 4D69A 4QQHA 2G1MA 1ZBE2 1W6NA 2GC1A 3MLKA 4L0PA 4LIUA 4Q0VA 1ZA7A 1R1A2 3RYRA 2XMLA 1W0NA 4GJZA 5BNPA 5I0UA 1IZ3A 3L9JT 5CVRA 4KI5M 4RGKA 2Y6HA 1GZWB 2IVJA 1OXCA 3TN92 1AL21 4KWKA 3LPFA 1XSRA 5CG9A 2ZX1A 4GWJA 3FLPA 2R16A 1KQRA 5A7OA 4OMDA 2R30A 4XAEA 1R092 5T55A 3DKQA 1DDLA 4QM8A 4NR1A 3NWKA 4OYUA 3RI9A 1F4HA 3GM8A 4NIDA 1ST8A 1H9PA 3ZDVA 2YYOA 3POSA 1UOGA 2ZMLA 3BGAA 4COWA 1MS0A 2HWF2 2EF6A 1I3HA 2B8MA 1ENSA 5J7MA 1BEV1 3O7OA 2X5IA 4WM7C 1LOEA 1GBGA 1UY2A 2HWE2 1KXGA 4MV2A 4RS5A 4Q1PA 2Q8DA 3CIHA 3DL3A 1J1TA 1IGOA 2B4KA 4O65A 3RDIA 3GCWA 1QWRA 2VZVA 1UX7A 1FPN2 2XH6A 2GH2A 1L7LA 3PL0A 5HXMA 4YLZA 1GWLA 1BXHA 2ORXA 3PTRB 4AHZA 3PUSA 5CISA 5IK5A 5FIXA 2ET7A 1MQTC 3WUCA 3TRSB 3TB0A 3MI8A 4Y1VA 2K0GA 4DQAA 1MS4A 4LJHA 5GZCA 1S4CA 4M4RA 4NPLA 4XFAA 1LHUA 2DUQA 4Z2AA 4KWLA 4UFIA 2OVUA 4DXZA 3I3BA 4MGIE 3ZSKA 3AP7A 3OBRA 4K8FA 1OQEA 1Q8VA 2XJPA 2A6ZA 4QT6A 1ND2B 1QNWA 1VRH3 1AR63 2R043 3M70A 4W4ZA 3LOBA 1CPNA 2GP5A 4NE9A 1JOPA 3LIGA 2LS6A 3VZNA 3ZYRA 1MPXA 5CZKA 1PMHX 5IK8A 4AWDA 2BWAA 4MADA 2VH9A 3VB9A 5FTTC 2A6WA 5BNPC 3MW2A 5FY0A 5HXVA 1XBFA 2C26A 3GJBA 3U10A 5IUQA 1RUD1 3I2IA 3IZOA 1O3RA 1NA1A 4KWJA 4ET7A 2MHFA 4AHXA 4AG4A 3J7LA 4GQ7A 3AMQA 3WG4A 1JYWA 1CAWA 3B9IA 3E5QA 4EROA 2B7YA 3O1OA 5JOZA 4I0AA 3J8F2 3IMNA 2XVKA 2RV9A 4CCEA 1NAEA 4FPYA 1S0CA 1CPMA 3LGRA 3LA2A 1E5SA 3NNGA 3UL2A 3WF0A 1SFPA 4ES8A 5E1RA 4LMFA 3HNYM 3AP4A 4LBQB 1CVNA 2WFF3 3P1IA 2EXKA 2HWC1 4NROA 1LKNA 1PM4A 3Q8AA 4MGQA 2VZ1A 2OXBA 4QPYA 3KF3A 1WD4A 1R082 4FPGA 2X5IC 3AL5A 5C70A 1KJLA 2HWD1 1BYHA 2PHFA 3AXDA 4A7KA 1UU6A 5BNOA 4GULA 2R49A 4RS5C 3VBSB 4IEZA 1V9U2 4QDQA 1G9CA 4BPZA 2CAUA 3WDXA 4MOAA 1AR71 3CDZB 1AYN1 4HONA 3ZSJA 2X29A 1H1IA 2AZ5A 1YO8A 3ZO0B 4GXLA 2Q5TA 2GC0A 3KV6A 4IGQA 5LB6A 5JXHA 3FFQA 2YFZA 1D2QA 4D7YA 3QCWA 5C8CB 2HH9A 1RHI3 1PGW2 3T30A 3OPWA 2WNUB 3RMXA 1FNYA 3GHNA 5BNNC 2RJ2A 4PLNA 3KCYA 2CYFA 4KH9A 4LUMA 5E16A 1TME2 4XUPA 4UW6A 2YC0A 3VKOA 3OCPA 1UYZA 4LHKA 4Z07A 5B2GB 1LHNA 1JS9A 4QX8A 3CNAA 1AYM2 3N3HA 4N53B 4Q4X2 3N9LA 2W94A 3WXPA 1O5UA 4XF1A 4FFIA 3GZUC 4Q4W3 1K5MB 5C3SA 5EP9A 1UOJA 3T2TA 3LEKA 2WWJA 1OHFA 4Y1YA 5L9VA 3FMGA 1QJY3 4N43A 5CFDA 2ZEZA 3O12A 1ODMA 3PMEA 4Y3OA 1F2NA 1G9FA 2W68A 2Q0AA 3MUY1 3B00A 4PQQA 3WCSA 1NA1C 1GMMA 2D6OX 3JD72 3WD5A 4WZFA 1POV3 1IS4A 4BISA 4YVWB 1VRBA 2WT1A 1UY4A 3USUB 3W9AA 2WDBA 1COV1 1LESA 1NKGA 3B3QE 3LB9A 1YIPA 4YSFA 1NCQB 4D3WA 3I2HA 3IDBB 4G3YC 3LSEA 1O8SA 1N47A 1RUI3 1LODA 2MEV3 5FV3A 5FY4A 1SLAA 5FZGA 1AR93 5KWRA 3AMPA 5FOBB 3AVRA 4NUBA 3RYPA 5F9TA 3IBMA 3AYCA 4QPGA 1W2AX 1NG0A 4GB31 1LULA 5BNOC 4Z1VA 5A3MA 2PTMA 3RPQA 3ZKYA 3NSTA 4XIKA 5T5PA 3MYXA 4FI9A 3LCPA 2ZGKA 2C9KA 1A34A 1FOD1 3Q8EA 1IS6A 1KGYA 2ZX4A 1JXNA 3WW2A 1UOFA 4QQLA 4YRDA 4XVHA 1G7YA 4L97A 4KBBA 4QPIB 4A3ZA 2JG8A 4BHPA 1BMV2 5AFEA 1F5JA 2WS93 4OMCA 2XLGA 3MIDA 1Z0HA 2ZEXA 2O8QA 1EP0A 2UYBA 4BQ5A 5C4WA 3HT2A 4GWMA 5IWFA 1ULEA 5AFBA 4HL0A 3RJRA 2YBKA 4QGNA 3ZXDA 3H1MA 2IFWA 3N7JA 4FQ4A 4GJYA 1UL9A 2W39A 1AXYA 4W8JA 1RUOA 2W1SA 2VQUA 1WCKA 3HOBA 5T52A 4XMAA 2O8OA 4RSUA 2B5HA 3FUQA 1SDDB 4QQ2A 4N43C 3KGLA 5F7UA 4LULA 1SEFA 5CFDC 1O8PA 4OUSA 4BQ4A 2E51A 3LA3A 3AMNA 5CNAA 1RUC2 5K4LA 1G8WA 5BY5A 1AR81 1BVVA 4WV8A 4WM7B 5FK7A 4EN8B 2VZTA 5AVAA 1BVP1 1ZX5A 5DAWA 5ANQA 2RDSA 2ZGMA 4JGYA 5FUIA 5FZMA 3RWKX 5CFCA 3E6BA 2ZHNA 3MIBA 4LHNA 3AFGA 5AC93 1YJLA 1DGWX 5C8WA 2Y6GA 3UGHA 3RQ0A 4ASLA 2ZGSA 1QDCA 2EXJA 4HSLA 4XCBA 1OLQA 1LHOA 1RC6A 3B5LB 1VBE1 1HRI2 1KITA 5FZ7A 5FXXA 4WBBA 1UYYA 1U5XA 1ND3A 1K42A 2BJSA 2VW0A 4QPGC 1HRV2 3QLQA 3FUOA 1BEV3 2ZHKA 3HJRA 3KSCA 3OBAA 1FXZA 1ZZ9A 3AMMA 3DF0A 2WLQA 4MGZE 5FZLA 2A73B 4UI9L 5CKNA 2WN3A 1RUG2 2IC1A 4SLIA 1VBC2 3ZN6B 4EWDA 4J1WA 2DVAA 1KFUL 1GV9A 4G9SB 3KVBA 2CNAA 1W6NB 4JCKA 3THTA 1JYNA 3ZKUA 4MYEA 1XXNA 2WNVA 3GZEA 2D6NA 2HWB1 2Y0OA 5JI9A 1OOPC 4RQPA 4H7MA 5F8PA 3I3EA 1W06A 3ATGA 3CEWA 5SV5A 1VR3A 4LBOA 5HCAA 2RVAA 4KU8A 2AEZA 4A7ZA 1LOGA 2VNRA 3P3PA 5HCFA 5C4WC 2R1DA 2UY9A 3NL1A 3DPRC 4IEQA 3UGFA 4AVBA 4ZKTB 4KNCA 2VTXA 3N7LA 4Q29A 3ZFEB 5LATA 4NPRA 1H8TA 3DYOA 2WO3A 5K8SA 2YU2A 1VBB1 3KLSA 4LR4A 5FMCA 2DFCA 5FXWA 1JZ4A 4XJ8A 2O14A 3HQXA 4NOTA 1AX1A 2GDFA 2A3XA 3OGVA 5FXVA 5GZDA 2UYAA 4FTEA 3OYWA 1C28A 1RIRA 2ZGNA 2X5IB 4HG6B 1RUD3 4B1LA 3OF1A 1RYYA 4NHYA 2PXJA 4RS5B 3LKJA 3A22A 2P37A 1JH5A 3ACFA 4Y1UA 4F83A 5I0DA 4IXLA 4FP2A 4QQOA 4R8HA 4JGYC 5JSOA 5CFCC 3E6CC 4Y5Z0 1Y9GA 1OUSA 4WVWA 2AEYA 5ANNA 4EWEA 5JOXA 1F4AA 2QQUA 2D5FA 3K75B 4V1PA 5FDBA 1PO13 4HVQA 3IN9A 4UT5A 1RUNA 1WCUA 5T54A 2RR11 1ND3C 3KF5A 4UAPA 2JICA 4BIFA 3RZLA 5HCHA 4UW3A 3S7IA 1RUH2 1UPIA 3U07A 2R0HA 3O0VA 3VDCA 4CCLA 2J22A 3OSDA 1NY71 3CU7A 1PIV1 1VBD1 4LE4A 4LKFA 1RVF1 4HVOA 4FFFA 1AXKA 1W8ZA 2O1QA 1AYN3 4CRQA 1PVXA 5DG1A 2VMGA 1X82A 2WNVC 5A6XA 2XL9A 5A32A 2ADEA 5GZGA 3FX3A 2JE7A 4RQPC 1PVC2 1RUE1 3D0SA 4UWDA 3I3DA 4BB3A 2XVGA 4HXCA 1UD1A 3LA7A 4C0BA 4FBFA 1NA1B 1LHVA 1JZ8A 4DIQA 2WUHA 3MIEA 4QM9A 2Y6KA 2PA7A 1CAWB 3PUHA 4NN0A 4FPJA 4DXRA 1D4M1 3E1F1 1VBA1 5K9YA 1O7FA 2YUEA 3I8TA 5EZWA 3VBRC 2WZPP 4AW7A 4KGQA 5JWPA 1GWKA 3JU9A 1WA4A 1H8TC 5FMOL 1JN2P 4FPLA 1PMIA 2ARAA 4LPLA 1CR7A 4XPVA 1JYXA 2FZ2A 2DU0A 1Y4WA 5FP8A 5GLUA 3FLRA 1UY0A 3TNPB 3NW4A 3WLUA 4PIZA 3WHTA 1UY3A 1WMEA 1GUIA 1SLTA 1X8EA 1HQNA 5BNOB 5JLVA 5K7PA 4P14A 5EXOA 2HWC2 4JDOA 3ES4A 1NXMA 1WA6X 1WLWA 2D3RA 5CG8A 2KM2A 3QACA 1JYVA 4K40A 4QB1A 2P3JA 3MF9A 4K9SA 1COV3 1UMIA 1B35A 1GICA 1R64A 2HWD2 5BUVA 1CX4A 4AVSA 1BQPA 4MLOA 3MDPA 5KXBA 4NIIA 1PO22 3SKVA 2P2KA 1AR72 1F31A 1I9RA 4B29A 5F6LB 1CESA 1D7PM 1REEA 4IV3A 5JPNB 1RMU2 1S0FA 2W52A 2ZGOA 2XKPA 4UFKA 4CDUA 4NHXA 2NN8A 3HR9A 4C90A 4GB33 1H0BA 4AXOA 4CA9A 1LECA 4K6BA 2R073 1IKPA 4KMQA 3WNLA 1FV2A 2WKKA 5A70A 1PNFA 1W8HA 5IHRA 3HN3A 2XQXA 4M0HA 1XC6A 1LOFA 2HBTA 2XOMA 3H3LA 1FOD3 2VOTA 3OBZA 4V2WA 3W59A 3D6EA 3KCCA 3TWIA 4HK9A 4URTA 5J48A 5CFDB 1U12A 3C7FA 3HMYA 4IV1A 1W3VA 1RL3A 2VAUA 1Q8OA 1WBLA 5KHKA 1REFA 4FAHA 3BOPA 4XACA 3NV2A 1RUF3 4DINB 4J6GA 3K46A 3D0JA 5JUVA 1ALYA 1YI7A 3WNOA 5D8AA 1EV12 1XNAA 2YROA 2Q8EA 1LRHA 5LZ6A 2EA7A 1WGPA 1WWYA 2NMNA 4QD2A 4XJAA 1XYPA 3JBG1 3SCFA 3M2MA 5KBFA 5J36A 1QJU2 4Q5OA 2XPJA 2ZXQA 2WL1A 2JENA 1QHDA 1W6PA 2R062 5EWSA 3PVOA 1AR61 3NV1A 5T5OA 2E26A 3M3QA 1TNRA 5FYUA 1RGSA 1O4YA 4BZ4A 1FMD2 3M1HA 2J1VA 1TEIA 4QPGB 1QNYA 4HZFA 4IE7A 4JRAA 4XF0A 4DZGA 3BALA 5FUPA 2ZABA 1UQXA 3DYMA 3O0WA 3N36A 2YC2A 1J3RA 1EAH2 4O9GA 3DECA 5FY7A 3DV8A 4ONUA 3V0BA 3AP9A 4YGBA 5DUWA 4YW6A 3WDUA 4F7ZA 4AI8A 3H3UA 2DCZA 1OKOA 3AC0A 2CGNA 3U37A 2DV9A 2W92A 2CSGA 2JG8B 2FDGA 1ND2C 1V70A 1W9FA 4YG0A 2EIEA 1LEMA 1G86A 3ZR6A 1C8M1 1PX3A 1KEXA 4GMP3 1H1AA 4IGPA 1VBE3 2P6HA 1US2A 3MLJA 4HPKA 4LQRA 3D4KA 5GZEA 4UF0A 4L2NA 4BJ0A 3J4UH 3SITA 2WSUA 5I8TA 2C4XA 4CDUC 4XFIA 2QQKA 2WINB 3AX4A 5FCCA 2OA2A 3VBFA 4ZU7A 5A3TA 2VZOA 3ZPOA 2ZZJA 1F9KA 3WDYA 3O14A 4BE3A 2CL2A 2GP3A 1W05A 2G19A 4L92A 3PUQA 5F32A 3DEMA 4E2QA 4LORA 3C7GA 4AGGA 3VHPA 4JQRA 4L8QA 3BIEA 4YM3A 5A3OA 5IVCA 4RD7A 1O5LA 3VBUA 1S0IA 4CE8A 4AK3A 4FT8A 1GZTA 3IDEA 4QX5A 1RHI1 2Y8KA 3P3NA 1W9SA 1YLLA 1GQGA 3MGUA 1W9YA 1QDOA 5EJ1B 1GZ9A 4WVMA 4XQWA 2IXCA 3F2ZA 4JGYB 1AR82 2RJLA 3QH7A 4MH0E 3BTZA 1W04A 1LEDA 4K8RB 5FPUA 3BU7A 2RMU2 1VAKA 3WW4A 4Z92B 1FI2A 4BK5A 1VBB3 2TEPA 4Q4W1 5FYVA 3TEXA 3AL6A 2D6KA 3FHIB 2UWCA 4GKYA 5KC5A 1ND3B 2WFPA 4XXAA 3T1LA 4NJ4A 1DZTA 4AOCA 2BVBA 3RNSA 3WG1A 5T50A 4XIOA 1JUHA 3AYAA 1XPWA 4FFGA 2VG9A 2WNUC 5FY5A 1ZBA2 3OBTA 1JTZX 4ZPIA 4LHLA 4CUCA 4DUXA 3I3MA 4AVCA 1NOVA 4OHYA 2IFRA 2ZKNA 1POV1 2CWMA 1NXD1 2WWUA 3HEIA 4JV4A 5FZKA 4DRRA 4JTNA 4EN9B 4FXKB 4EZ4A 3VD9A 4UXAA 3ZYIB 2VULA 2WNVB 2ZAHA 4N53C 1V6IA 1QMJA 2QZ3A 5E88A 5F5IA 5AVPA 4E4ZA 3USSA 3MHZA 1MACA 4RQPB 5FLIA 1LJ7A 3WP4A 2HBUA 1K5MC 1YFWA 2EIGA 1YWKA 3MIHA 1VB2A 4JHTA 1IS3A 3DCQA 2RR13 4N8MA 4NWWA 1RUI1 4Q8KA 2F4PA 4AHWA 3HBZA 3WP5A 4OVEA 1VB4A 2HWB2 1K3IA 5DUVA 3QD6A 4FCAA 1YFUA 3PVBB 1GU3A 4QKNA 4RHV1 3ZPYA 4M01A 1CGPA 1IS5A 4IEUA 2A70A 1FAYA 1ULDA 2RS31 4CP0A 1ULPA 5C3QA 2CWSA 1GOGA 1PIV3 2DU1A 4UBHA 1QF3A 3FHAA 1JMUB 2FCUA 2JXAA 4FXGB 3RSJA 1H8TB 2R6QA 2Q8OA 1W6QA 3ZLIA 4UFJA 4FOYA 4M3CF 2DVBA 2RE9A 4XFFA 5IAVA 3V56A 1O3TA 2VJXA 4LLOA 3BODA 3K48A 2D3PA 2IXKA 4XF4A 3VBUC 2VBDA 1RUE3 2DCTA 1VAMA 4QXCA 3N7MA 5FZOB 1O59A 3S6PA 4EJRA 3T0DA 4OI4A 2WR9A 3HD8B 1J83A 4AEMA 1SCSA 1IPKA 1RXFA 2TBVA 1WMDA 2VR4A 4ZONA 5D2AA 2DCJA 1D2SA 1ENXA 1D4M3 1VBA3 3SCGA 3V0AA 5CADA 3DXUA 1F35A 4N9HA 5LK5A 2EAAA 4EN7B 2A7AA 3KWVA 1HJFA 2OX0A 1WKYA 1IHMA 4QQPA 4W65A 2UU8A 2BERA 4GH4A 4XDPA 4QPIC 1GSLA 2BGCA 2ZMNA 3AYDA 3IMMA 2GMPA 3KQ4B 4P5YA 3HQUA 3CJIA 4XBQA 3VDDA 4BYYA 3RJ2X 3T08A 4GA9A 2NYYA 3CF6E 1WW6A 1SLCA 4IESA 4LHSA 4P5HA 1N3OA 2BQPA 2VY0A 4JKMA 2IUWA 2RM21 4P9IA 3D3AA 3A21A 3I97A 3EXUA 4XE9A 3K3NA 2OS2A 4I3GA 1C4RA 4MZUA 2BNOA 4BK4A 2ZGTA 1KFXL 1E5IA 4Q4V1 1YQ6A 1UMZA 2X8KA 3MF6A 5FO9B 1VBD2 1WW4A 3AP5A 2YGMA 4FPHA 2A71A 4Y4YA 5CU1A 5A32B 3ZFEA 5AC91 4ZHNA 2LW8A 1RVF2 3PDQA 3CL1A 4P9YA 4WZCA 4AFBA 4IEPA 4OQ9A 1MEC3 1CJDA 1OUXA 2EALA 5HV4A 5EYYA 3RWNA 3BIWE 3WDVA 2HEWF 4HSJA 5ACA2 3KV4A 4OCTA 2ZGUA 2GNBA 3T0BA 5A7PA 2DFBA 4MSVA 3A23A 1HQLA 1HN1A 1QJX2 2J7MA 2TNFA 3ZSMA 4A45A 2DTYA 4IDZA 2A6YA 4HN1A 2G9ZA 4Q2FA 1YJKA 4COYA 5LY1A 2Y26A 1AX0A 5HCBA 4OLLA 2WT2A 2FDKA 2XJSA 4MXWA 1W8WA 3PHMA 3HNBM 1IG0A 2D98A 2XBO2 2LALA 1I5ZA 2B42B 2VECA 1ASJ2 4LITA 3H1YA 1DYKA 1UW8A 2A6VA 5BXXA 2RS12 1OMIA 2YBSA 2ZHLA 2OQ6A 3T4VA 1HV0A 1H4GA 2VGDA 4FVVA 3ZYFA 3POBA 3JBG3 2Q1MA 1B35B 2P34A 2VZRA 3LQCA 4COZA 2EXIA 1VAVA 5A7QA 5HV0A 4I0WB 1AJOA 2V09A 1ZREA 4AQ2A 4E8CA 4ZZ8A 1H9WA 3OEAA 1GNHA 2PLV1 5IW0A 3WF3A 3U78A 4AEKA 1VALA 4GH4C 1OD5A 4IV3B 4YM1A 4BCUA 3S5AA 1T2XA 2P4EA 3VDDC 4AFAA 2V4VA 4CDUB 4E4DX 4ES9A 2A5ZA 4NMIA 3UKNA 4NRQA 2VCCA 4UFLA 2PQSA 1POV0 3SXWA 3I59B 2GN3A 2D6LX 4H2AA 3TAYA 1NQJA 5A3LA 1JHNA 1OI6A 2GSYA 4FO9A 5FZ1A 3VBHA 3WINE 5J1XA 2VW2A 1ULFA 2DUOA 1SQ4A 2JWPA 2OUJA 2YXSA 2VE1A 1N1SA 1SDWA 1XE8A 3LPGA 1ULCA 4DY3A 4Z2WA 1Y9QA 1H30A 4IV1B 4YW4A 2I74A 2P6CA 4KG8A 2C9AA 4OI2A 4QAWA 3S7EA 1KDMA 2RS53 1IKQA 3ACLA 1C8M3 3IWZA 1PO11 3WNMA 4PI2A 5D8AB 1XRUA 1TME3 3BPSA 3OOXA 4INDA 3AK0A 2W1WA 3T2OA 5JZGA 1JW6A 3GBWA 4LBKA 4LXLA 3WQ7A 3ABZA 2AYHA 2XLAA 4AI0A 1BHGA 4XURA 1L7RA 4FPKA 2ILMA 4HKWA 1VMFA 2QNKA 3PMSA 5I0RA 1W6PB 3VN4A 3WOGA 4IL7A 1E57A 3OJBA 4A44A 3THPA 3HVDA 4D7SA 2F6BA 1QXRA 4XF3A 1O3QA 2MNGA 2XGXA 1U0AA 4QKDA 5FQ0A 2OUHA 1S0GA 2CV6A 3B9CA 1HB1A 1UZVA 1VRH2 2JKXA 2R042 2VMIA 4W6YA 4ZXKA 1X33A 4D0QA 4XUOA 3S57A 5F3GA 2WT0A 3V0BB 3EMRA 2VMEA 3N9NA 1QY4A 1N3PA 2X09A 5A6QA 1FATA 1F15A 2ZTNA 2ZGPA 4ZZ5A 3WP6A 2ZGLA 4LBQD 4FAGA 4QDRA 5T5LA 4NPMA 3CHXA 1ONAA 3TEYA 1OA3A 5LASA 5B4NA 1N1VA 1X8MA 1QU0A 1IQDC 3J9SA 5LA9A 3ZXAC 3Q8BA 1FX5A 5FYTA 4BA6A 4HPKB 2FMYA 4LT5A 1FNZA 2DBIA 2LTNA 5T3NA 4UF0B 3RFRA 4YW3A 4OZOA 4TTGA 2YG0A 2PHDA 3KT7A 4FPEA 4P9XA 2BRTA 1XNTA 3MLLA 3POEA 1KDKA 2AREA 3VBFB 3JXSA 2PELA 4Q0QA 5JXIA 1RB8G 3VD3A 4AYUA 5BNQA 2JX9A 2WFF2 3SH5A 1QXJA 1MS8A 2GNTA 3VBHC 3PUAA 2QDNA 1JZ5A 2GH8A 4XHBA 3GHMA 4B7KA 4ZS3A 5A33A 2QKDA 3I2DA 4CCMA 3EQEA 1JZ7A 3VBUB 2BW8A 2YZ4A 2ZEWA 4FQZA 1W9WA 4XUTA 2LUWA 4DXSA 3CZUA 4XBNA 4YZ3A 3AZYA 4WVMB 5EV7A 5JZGC 4QXKA 5I0SA 4RHV3 3BTXA 4K20A 2ZMKA 1LGNA 3WQBA 2RS33 5SV8A 2PQQA 3UKVA 2CY6A 1RHI2 1UN1A 1WLDA 3BTAA 4M4PA 3SCHA 2CGPA 1GWMA 2R071 4NHMA 1H2LA 4HFSA 1QEXA 3H8UA 3RMYA 4BQWA 4XQDA 3SKJE 4S2DA 4LO5B 5LA0A 1QQP1 3ENRA 3AP6A 2VMDA 5G05L 4CEYA 4J25A 4CUBA 2BP6A 2SBAA 1RUC3 2ARCA 1NLRA 3NNMA 1IPSA 1QKQA 1O4ZA 3HWJA 3UGGA 2WAAA 4C1WA 2WQZC 4PDWA 2Q4SA 1RUF1 3MUZ1 5HBAA 2VMCA 2GU9A 2L9LA 1S2BA 2WZR3 2OPKA 2ZEYA 1HXS1 1QJY2 5KHHA 4L11A 3WG2A 5G04L 3UK9A 1PZ9A 1OQ1A 2FMDA 4AVTA 2QQLA 3KVAA 1IPJA 2RDNA 2WSVA 2Y60A 5LCWL 1GP6A 2IXIA 4XFHA 3N4MA 3RG0A 3KQRA 3LEIA 3ME2A 5F5AA 4DNYA 5FYBA 2V72A 2WWSA 1Z7S1 4PIYA 3ZFEC 4BLIA 5FZ9A 2OYZA 1HB4A 5FYCA 1HRV3 4YGEA 1DHKB 4NRMA 2VVEA 1PK6B 4M0NA 5FZ0A 1XYNA 4Z82A 2VMHA 1GR3A 1K45A 1KS4A 1ZRCA 3ZSLA 1PGL2 4DS0A 1TMF1 4CCKA 4LOTA 2O0OA 2RM23 1RUI2 2MEV2 5F6KA 5FUNA 3X29B 5KHJA 1AR92 1W6QB 1C1FA 4JKLA 2DUPA 2BPA2 1JHJA 1U5IA 1UPSA 2ZHMA 3A0KA 4XTMA 4N9IA 5DN2A 4ASMB 4Q4V3 2EICA 4R4XA 4M00A 1Y43B 1OA2A 2R7EB 5F5CA 5F3IA 2XONA 4OULA 4UFHA 3POGA 2P17A 5DDJ1 1JZ3A 4DEVA 4PLOA 3BTYA 4Q4Y3 1ULOA 5JR2A 2OW4A 3WNPA 1UU5A 2W0XA 4NHLA 1EPZA 4GMP1 3WSOA 5A6ZA 5JR7B 1QH6A 5FKBA 4D6SA 4DO0A 3R4DB 5FYSA 5H9QA 5GLTA 2AENA 4OHWA 3ACHA 2WS92 2RHPA 4R9BA 1UX6A 1LOAA 2IVIB 3V0AB 2ZX0A 1X36A 2BDRA 3AFKA 4I2OA 4IE6A 3OPZA 4PQ9A 2CGOA 3HT1A 1A3KA 1RJ7A 2XVLA 3O0XA 4CEYC 4D94A 5A6YA 3GJAA 1DBNA 2Y6LA 1RUJ1 4GH4B 3AXEA 3GDBA 4P00B 4AE2A 5LW9A 2JG8C 1LGBA 1U5ZA 1US3A 2VTXJ 3CJIB 3VDDB 2PMWB 2JB8A 4PDWC 3NNFA 3GYDA 5D21A 1LGCA 5IVYA 1LNSA 2WYFA 3ASIA 1UKRA 4Q27A 1OVPA 5FY1A 1XOYA 2C24A 2ET1A 4I02A 4PT6A 1ZZ6A 3LAGA 4LA3A 4W6XA 5F3CA 4P9JA 2Y34A 1AL22 4MHUA 5DAXA 5A7NA 2PLV3 4ARXA 4Y22A 3AKPA 1F5FA 2JDZA 1BK1A 5FREA 2CDOA 3SLIA 3VBOA 1OPOA 3K4ZA 5AC92 5A3UA 4LKSA 1VPHA 4BQ2A 1EUUA 3U0ZA 3K77A 1MR5A 4EWAA 4QHBA 1OSGA 5FZOA 2VL4A 3CLPA 5HPOA 1E5RA 5GZFA 1Q43A 5DPNA 1BZWA 4MXWB 2WN2A 3ZIWA 2GALA 2VVDA 1BEV2 3AVSA 4YW1A 3THDA 2Z5WA 4IEWA 4UYBA 5ISLA 4QGMA 3M3EA 2C0ZA 4GWNA 3IT8A 1BBT3 2UY8A 2W46A 3L2YA 3QBQA 5F2WA 5IJRA 3LEGA 1POQA 5IAXA 1S0EA 2BFUS 2XJVA 4PF1A 1UOBA 3PJQA 4WVZA 4EQVA 2V5DA 4ATEA 1QGLA 4JC1A 2VUDA 1HV1A 3NJVA 5I91A 3EB7A 4P9WA 2I07B 3ELNA 3VD5A 2DVFA 3PVNA 1AZDA 5F39A 4A41A 2P3IA 2W2IA 4IUGA 3I3QA 4TSVA 3TEWA 2G9GA 1ZBE1 4W50A 4CXYA 3FWEA 3FZ3A 2R32A 2W5FA 3PVEA 1WLCA 4HT1T 3T1MA 2LRPA 2WRAA 1MVQA 3BCWA 2K46A 1R1A1 3NRUA 5JIAA 4D6QA 4GAZA 4XETA 4Y33A 3WZ1A 4XEZA 2QBXA 2XL7A 3CKHA 4JZRA 4XC9A 3U4SA 1MZ5A 3POYA 1OH3A 3BB6A 2DCYA 3VBHB 4N90A 1PMJX 5E89A 2E53A 3O5SA 1GYKA 3RZHA 1R091 1W6MB 1KD7A 1MS5A 4Q8LA 4A42A 1RUD2 3NV4A 4H7LA 1UIKA 1YXWA 2BU9A 2XR4A 1S0DA 3I54A 2XJUA 3KGZA 3ZYBA 2W47A 5H9PA 1FT9A 3IDAA 2D3SA 3RVHA 4URAA 4MG2A 1J3QA 2QQOA 3RI8A 1PX4A 3ETQA 3VBOC 2B46X 1YQ8A 1D0HA 4QU1A 4S2FA 1XNCA 5JZGB 3MEPA 1QOOA 2IZWA 1W6OA 1H2KA 1PO12 4NIAA 3SEEA 3W5NA 2WQ4A 1V0AA 1TVGA 1NX9A 1VIWB 2HWE1 3B94A 2NP0A 4AL9A 3I2KA 4F8AA 3O1PA 3O1RA 4JRLA 1OF3A 3U75A
chains in the Genus database with same CATH topology
1FPN1 4AEDA 4YZ2A 5FQ0B 5LRRA 3E6DA 1PZ8A 4LO8A 2BVVA 1CAXA 4IETA 1HDKA 4KQ7A 1ZRFA 3JB4C 3KZ4C 5JMCA 4TLFA 2D44A 4GMP0 3NAPA 1LHWA 2WA4A 1MEC1 5BYNA 1AYN2 2A75A 1S2KA 5C33A 1DGLA 1ZRRA 3MPBA 1J59A 3KB5A 2DURA 5IT6A 5L19A 5CBLA 2VU9A 1UF2C 4ORFA 4AHYA 2ZX2A 3H0OA 3I59A 1QQP3 5TSWA 1LTEA 2AGSA 4DOUA 2OZJA 1YI9A 4X6QB 2PAKA 2XKOA 1HW5A 2ARXA 4KG0A 3WX5A 2QDRA 3ILFA 2ETEA 3KS7A 2IXJA 4S2GA 3G7DA 2ZCWA 1WW7A 4OHXA 4ZU5A 5JSRA 3SMHA 4U2AA 1HXS3 4GIQA 5EJ3A 2IWGB 5A33B 1DGRA 4X6RB 4NHKA 3J8F1 2AUYA 3E5XA 3EJKA 1G6NA 3FJSA 2ZGQA 4FTSA 2G4IA 1X7NA 1WD3A 4BOWA 3LWCA 5KC6A 1Z7S3 1BJQA 3UJQA 1COV2 4MVTA 1N1TA 4XXPA 1LU1A 1R081 1DU3D 1J58A 1TMF3 1UZYA 4AF9A 2PAEA 4IERA 1GANA 1V9U1 2VPVA 3FFZA 1JYIA 1N1YA 2PHXA 1QXPA 5DUUA 1B35C 3ZYGA 4CEYB 4H55A 5LEKA 4GB32 4M3CA 2ZA9A 4DFSA 2R072 5DDJ3 3ST7A 3A4UA 1OFSA 1PGW1 4NVPA 2RS51 1BKZA 4PDWB 3NAPC 4OFGA 1LCLA 2EAKA 1EYBA 1FOD2 1PM7A 3ZFGA 2A3WA 2ZZQA 1YFXA 1M4WA 1TME1 4IV3C 3ZMOA 4PCRA 4YW2A 1V6LA 3D8CA 1SACA 3VL8A 3ZYJB 1AYM1 4Q4X1 2H0BA 4P9LA 3SHRA 4Q0SA 3WP3A 2I45A 5FPZA 1XYOA 1DQ4A 1LOFC 4XFBA 2WJSA 1TQ5A 2FBEA 3AJYA 1RUJ3 4AI2A 4HBNA 3B93A 4IV1C 3VKNA 4I01A 2H6BA 2VQ0A 5LEJA 1QH7A 1VP6A 5D8AC 1UU4A 3C3VA 3WW3A 5J09A 4XOGA 1Q8PA 2I2SA 2IXLA 1QOSA 2VW1A 1G9DA 2TUNA 1SLIA 1ZVFA 2Q1ZB 1MS1A 5ABJB 2JE9A 3E5UA 4I3PA 2QJVA 3M7AA 3TBDA 1DQ0A 2A3YA 4YM2A 3KD4A 4XHXA 3URFA 1GLHA 2ZJCA 1YYNA 1HQWA 4YZ4A 4YG3A 5FMOS 2E6VA 4R9AA 3ZDSA 2D7FA 2UWBA 1VBE2 2VOKA 1D0GA 3GF6A 1A8MA 3TNQA 2QQPA 1NQDA 5CB7A 4X8PA 1BMV1 3FBYA 4AVVA 5FO7B 1MZ6A 3RZZA 2VUAA 2V73A 2ZACA 2B45X 3MPPG 5KXCA 3KT1A 3GBGA 4HKLA 1DLLA 1L3JA 1PK6A 4I30A 2D6MA 4XILA 3VBFC 1AL0G 1SBDA 2VNGA 2BNMA 1S0JA 1WMFA 4Y22B 1VLNA 4HN0A 1W39A 1ZBE3 4M3CE 1XQNA 3VBOB 5KXEA 4XDQA 3S30A 1R1A3 1ENQA 4CYDA 5HI0A 1G9BA 3ZFFA 1RUC1 2A6XA 1OQDA 4YVSA 1VBB2 3TN93 1WCSA 1GFF2 1DFQA 3WHUA 2WZR1 2W08A 2C1FA 2C5DA 2Y38A 4YG6A 4DB5A 1PNGA 1TE1B 1R093 3D82A 3AZZA 4J1XA 2IXHA 3ZX7A 4OI1A 1ZM1A 3EO6A 5I8YA 1H1MA 5I0TA 3NJZA 4E4SA 3H7YA 3C2UA 1ZYBA 4SBVA 1G9AA 1XU2A 2HWF3 1HRV1 2YY1A 2VNOA 3VZKA 2VOWA 3ZXKA 2HWE3 1JBCA 3VHOA 2RR12 5GJ6A 3VKMA 1RUG1 4F3JA 4O9EA 5K0UA 2QFEA 1NE6A 2WA3A 1FPN3 4FPCA 2ES3A 3NO8A 2BBVA 1HKDA 4CZSA 4AI1A 1ASJ3 1NY72 1PIV2 4JGZA 5L73A 5JOYA 2BYVE 5GKAC 2RS13 4PIXA 3ZXGA 1KJRA 5L36A 4Y26A 4Q4Y1 4HMZA 4AEJA 2YGLA 4HLTA 4CDWA 3CJXA 5D1IA 2XJRA 5C6CA 1PK6C 1LOCA 4OHVA 4Y1XA 1RUE2 1ENRA 4H3WA 4K1ZA 4BQ1A 4IEYA 4QGLA 3B02A 2E7QA 1DZQA 1BCXA 1FYUA 1D4M2 3DUIA 3I4IA 1VBA2 1AX2A 3ZFFC 2H6CA 1W6OB 4YVSC 4BMBA 1MZFA 3FBMA 2UWAA 3ILNA 3ECQA 3AKRA 2GAUA 4XQ4A 4AEDB 3J8F3 1RINA 3POWA 5FO8B 3HIFA 4G4FA 2QZ2A 1CAXB 3KT4A 3NAPB 2D6PA 2YMZA 4FPFA 1V00A 3FC0A 2GN7A 1VJ2A 3V64A 1RUH1 1RJ8A 1R083 4B7EA 3I7DA 3CJIC 2Z2SB 3OGGA 2FQPA 4Y20A 5BNNA 3NKTA 1MEC2 4CEWA 3INAA 3M3IA 4AGVA 1V9U3 5JCTA 4ZU4A 2VOXA 2PHWA 5K0UC 1FV3A 3AYEA 2XG3A 4I09A 2XWJB 2YHJA 1W6MA 4JGZC 4RGGA 2PHRA 4XJWA 5H9RA 3ZXJA 1PVC1 1SLLA 3WG3A 4D7TA 2FZ1A 2XLFA 4LBLA 2H0VA 3R0RA 1BBT1 4YGCA 4BMEA 4K1YA 1JUIA 4Y24A 4CDWC 4E27A 3HN1A 4A7YA 2ZBJA 4ATFA 1AYM3 4Q4X3 1SBEA 4NWVA 3OY8A 1V6KA 4XZPA 3RYKA 1S0BA 4XMIA 3AMHA 4P9GA 5EYXA 4E9KA 2Z79A 4HKOA 4LE3A 5CIRA 2HEYF 1A78A 1DQ5A 2YV8A 5CA6A 4ITCA 1LU2A 3JBG2 2PHUA 2R1BA 1C5HA 1O3SA 3QH6A 2BUKA 2VQAA 4IQPA 1AR62 3JD73 4Q26A 1CQ9A 2ZGRA 2DF7A 2NZ9A 4GKXA 1H2MA 3WCRA 4LBNA 2HYKA 2XUMA 1AF9A 4M3CB 2D40A 4JDMA 2E7TA 1PO21 3S0MA 1XNKA 3JQWA 5GLZA 2ZAAA 3BOWA 3TYJA 1TNFA 4AFMA 1AHSA 3ZFGB 1YHFA 1CAVA 1RMU1 4HETA 1GZCA 2RS52 1DQ6A 3B01A 4FPOB 3KM5A 1C8M2 4CEWC 5L7OA 5IK7A 2JG9B 2CTVA 4RR3A 3OTFA 2D93A 4ISRA 4X8NA 2QUOA 2AH2A 1DF0A 4RGAA 3ZSEA 1R1ZA 4C91A 1XNDA 3WT3A 3MFCA 3AKTA 4YZ5A 3AZVA 4BIOA 4XJ9A 2ZOEB 2DVDA 3VHNA 1EV11 3R6SA 4PJYA 3ILRA 3AKSA 3MW4A 3U4XA 1CAUB 4QMAA 4EN6B 1QJU1 2EVXA 4CDQA 2R061 4KL1A 5FFOC 2NM1A 3SH4A 3UKTA 4YNIA 3VKFC 5KHIA 3KCXA 3LSDA 3R4SA 2BFUL 4XJZA 4CP1A 4COVA 3VLBB 1FMD1 1NCRB 2XJTA 5I8SA 3Q9OA 4AQ6A 1SBFA 3VV1A 4BH9A 4R52A 4EV0A 5BV6A 1AXZA 1UKGA 3AB0A 4JAAA 4AQTA 3HAGA 1EAH1 2XJQA 4Q4W2 4RA0A 4E2SA 1PHMA 3E97A 2GC2A 3IKWA 2JKBA 1V6JA 4YZ1A 3SNMA 2K9ZA 3PNAA 1D4VB 2VUJA 4R9DA 5DG2A 4A2UA 3N35A 1HRI3 1JOJA 2YPJA 1OOPA 3JUUA 4K21A 1DGRN 3JCIA 5L7OC 1QOTA 1NE4A 1ZZ7A 4RR3C 1RUG3 1V6OA 1VBC3 4Q1RA 3DPRA 4YFWA 3LZZA 1MZEA 1SFYA 1KRIA 4TYSA 4RHV2 3ZN5A 2GNMA 4XFGA 5CAZA 1A6CA 2RS32 1I6XA 1C1LA 1WBFA 3UJOA 1SCRA 5ABJA 3ZFFB 1SFNA 5JOWA 4AI3A 4GALA 1DYPA 3M3CA 4YVSB 5GALA 1LR5A 4C0HA 4XF9A 3GNEA 1DQ2A 2HEVF 2QE3A 4A3XA 4FSJA 1MS9A 1Z78A 4CDQC 5DUXA 3J26N 3NVCA 4CDXA 1AL23 2RMU1 3JQXA 1WLTA 2WZR2 1OLRA 4XBLA 4FOVA 1C5IA 5FOJB 3WR0A 3WQ0A 2ARBA 3ZXFA 1A8DA 1MQTB 3GZTB 1W0PA 5C9AA 1ZNPA 3M4FA 1PZ7A 3B69A 1HX6A 1ZBA1 2SLIA 3VZLA 3N7KA 5K0UB 4XFCA 3PTYA 3WVJA 5GLVA 3MIFA 1XE7A 3FE5A 4LO7A 4Y1ZA 4LLFA 2KXLA 1LENA 4JGZB 2RM22 3H1WA 5JDBA 1AVBA 3MFAA 5GM0A 1YCIA 3RS6A 5LRSA 4MUVA 1Q56A 4OUMA 3M3OA 4LTAA 1WCDJ 2N7GA 4Q4V2 1DQ1A 4CDWB 1RUH3 2X53S 5BNPB 4ISQA 5JAXA 2MPFA 4DRVA 3G6JB 3R4UA 4Q4Y2 3IPVA 3R05A 2EXHA 2WLPA 1DIWA 1URXA 5JPMB 5T5JA 2OZ6A 2QCSB 4B4PA 5BPXA 3VBRA 2E9QA 5ABJC 1H4HA 1PVC3 2GMMA 2NPIA 4UW4A 3MZHA 4L9BA 5DZFA 1LB2A 1WUVA 3ZVXA 2GC3A 2BEOA 3SISA 3ZMNA 1DZRA 2RJKA 4CDXC 2ZS6B 2HKXA 1XU1A 4PF5A 4AFDA 3NV3A 3ZIXA 2UURA 1U5YA 3VKLA 3GZAA 4WM8A 5DZEA 4UW5A 2Q30A 5GLWA 4B4RA 2PYTA 5C9AC 2XWBB 2BNNA 4C1XA 1NLSA 4Y20B 4YFZA 5BNNB 2B39A 1MS3A 4CEWB 2PLV2 1S55A 2HWC3 4XJUA 2Y0IA 4HANA 3TN91 4MGKE 3IDCB 1DG6A 2HWD3 3VHRA 2PHLA 1GZWA 1PO23 3WW1A 3BPZA 3H9AA 4U36A 1AR73 5I93A 1ULGA 5KXDA 4OHZA 4R9CA 3VL9A 3CO2A 2PN5A 5ACA1 4COUA 1RMU3 1ZA4A 2HWF1 4YGDA 4YM0A 3ZN4A 1ZRDA 1QJX1 1YUDA 3OY8B 3EBRA 1BBT2 4MX3A 2GNDA 2WIIB 5FRAA 4LUKA 5FLJA 4N7UA 3ROUA 1Q8SA 4TZDA 1UAIA 1ZZBA 4Z8BA 2OIIA 2ZKLA 1YRZA 1YIFA 2PHTA 2XBO1 1C57A 2P3KA 1IOAA 4XW3A 2AR6A 1ASJ1 3ZXEA 2E7AA 4R4ZA 2BWCA 3AM2A 1APNA 1CJPA 3OD4A 2RS11 1EV13 5JVVA 3SH3A 1EY2A 3H50A 4Q0PA 1RTVA 4FOWA 4BLJA 4META 1QJU3 2B9UA 3APBA 2DYCA 2R063 3MW3A 5EFUA 1NZCA 3EHKA 3AZWA 4LEJA 1GQHA 4B8EA 3RRDA 4XYXA 2V5YA 5DZGA 1FMD3 4WM8C 1CAVB 1KS5A 4HK8A 3DKWA 1H2NA 1ND2A 4RFT0 3WV6A 2DCKA 1EAH3 5L7OB 1EPWA 4QU2A 2VVFA 4RR3B 3WUDA 1Y3TA 2XHKA 4OZXA 5FBZA 4AQSA 2WC2A 1O4TA 2BTVC 4EN0A 1Q5OA 3AZXA 5F5QA 1ZZ8A 4FTBA 4YW5A 3U11A 1REDA 4OI0A 1M06G 1HLCA 4N43B 2ERFA 3WY6A 3ZYPA 2GMEA 1OFNA 4IEOA 5FAXA 3FLTA 4CDQB 4BM8A 4LBQA 1YNAA 4UBGA 3QOPA 3WQ1A 5JIUA 4LO4B 4LA2A 2QVSB 4AEDC 1N3QA 3IM0A 1XNBA 2E63A 4AFCA 2D43A 2NQYA 3VBSA 1VRH1 2R041 1W2UA 4FP3A 5E8AA 3PJYA 1QQP2 1HIXA 2Z42A 4PBPA 1UIJA 4K7JA 1AR83 5C8CA 1MVEA 3VZJA 3DN7A 4IEVA 1B09A 2RMU3 2WNUA 3LOIA 1RUF2 1PGSA 3TOJA 2NLRA 4JVAA 3VZMA 2JG9A 1HXS2 5LK7B 1S1AA 4XTPA 2ZX3A 3AJZA 4N53A 4LNVA 4PBOA 1OOPB 4WVVA 1DGWA 3ES1A 2JEMA 1AUYA 1OKQA 1IQAA 1K5MA 3H3ZA 1X50A 1ZBA3 1Z7S2 3JD71 2WFF1 4DMIA 5C4WB 3DPRB 1J3PA 4HVRA 2FHRA 1CAUA 3WNXA 1OA4A 4I0BA 1TMF2 3DGTA 3MICA 3M8LA 4LBJA 1Q8QA 1LOBA 3B7MA 4MXVA 3K51A 1JYCA 4JDNA 4YVWA 3USUA 3OD0A 2HWB3 3WDTA 1C3HA 2DWRA 4LBMA 1T6GC 1NCRA 1NCQA 4MGYE 2KA3A 3GALA 3GBFA 5DDJ2 4CP2A 1AJKA 4Q0UA 2LM3A 4CDXB 4YYOA 4NO4A 5CFCB 3VUOA 3OGJA 4FOQA 5H9SA 1F8VA 4YARA 3W58A 2DTWA 3AKQA 3VBSC 3MIGA 5C9AB 5KHGA 4JTOA 4AGRA 2R0FA 2JD4A 1Y7BA 2CAVA 1UCXA 4RL7A 4DPNA 2Z69A 1O91A 2K2SA 5JI7A 3ZFGC 5F1RA 1UZZA 1QJY1 1Q3EA 1CN1A 1RUJ2 1WW5A 4QPIA 5J96B 5C8CC 2G9FA 5J98B 4IEXA 3D5OA 2JJ6A 1H8VA 5FLHA 4N7IA 1YFYA 2D97A 1OPMA 1ZZCA 4AVAA 2JG9C 5IK4A 2HJIA 5DXDA 2VOVA 2JECA 1W0OA 3V65A 1CONA 3UV9A 1RITA 1V6NA 4B4QA 1SMVA 1QJZA 3ALQA 1PGL1 3A0NA 4KGGA 3IPVB 2MEV1 4L99A 3VGIA 1AR91 2PFWA 3KMHA 2WNEA 4K3UA 4PLMA 2D5HA 1C8NA 1VBD3 3NKGA 3VBRB 4WM7A 3VZOA 4H14A 3JB8A 1RVF3 5J3UA 3H7JA 3JZVA 4YVWC 1I1EA 3PLQA 3IIAA 2XB6C 1SLBA 5ACA3 4W6WA 1J1LA 1CIWA 1CD3G 1HRI1 2ATFA 2ZPXA 1NCRC 1NCQC 2YDEA 1GKBA 1V6MA 2VXRA 3OYWB 1MQTA 1QJX3 2WS91 4KU7A 2ENRA 2PAMA 4DY5A 4B3NA 1NYWA 3L2HA 2GZWA 4E2GA 1GNZA 4BWOA 5JSPA 3WDWA 5FPXA 1VBC1 4WM8B 2XBO3 4CTEA 5J37A 3ZXLA 2DVGA 2NMOA 4TWTA 4LO6B 3ZN6A 4D69A 4QQHA 1ZBE2 1W6NA 2GC1A 3MLKA 4Q0VA 1R1A2 3RYRA 5BNPA 5I0UA 1IZ3A 3L9JT 5CVRA 1GZWB 3TN92 1AL21 4KWKA 5CG9A 2ZX1A 3FLPA 2R16A 1KQRA 2R30A 1R092 5T55A 1DDLA 4QM8A 4NR1A 3NWKA 3RI9A 1H9PA 2YYOA 3POSA 2ZMLA 4COWA 1MS0A 2HWF2 2EF6A 1I3HA 2B8MA 1ENSA 5J7MA 1BEV1 3O7OA 2X5IA 4WM7C 1LOEA 1GBGA 2HWE2 1KXGA 4MV2A 4RS5A 4Q1PA 3DL3A 1J1TA 1IGOA 3RDIA 1QWRA 1FPN2 2XH6A 2GH2A 4YLZA 1BXHA 4AHZA 5IK5A 2ET7A 1MQTC 3WUCA 3TRSB 3TB0A 3MI8A 4Y1VA 2K0GA 4DQAA 1MS4A 5GZCA 4XFAA 1LHUA 2DUQA 4KWLA 2OVUA 4DXZA 4MGIE 3ZSKA 3AP7A 3OBRA 4K8FA 1OQEA 1Q8VA 2XJPA 2A6ZA 4QT6A 1ND2B 1QNWA 1AR63 1VRH3 2R043 3M70A 3LOBA 1CPNA 3VZNA 3ZYRA 5IK8A 4AWDA 2BWAA 2VH9A 5FTTC 2A6WA 5BNPC 3MW2A 5HXVA 3U10A 5IUQA 1RUD1 1NA1A 4KWJA 2MHFA 4AHXA 4AG4A 4GQ7A 3AMQA 3WG4A 1CAWA 3B9IA 3E5QA 4EROA 2B7YA 5JOZA 4I0AA 3J8F2 3IMNA 2XVKA 4FPYA 1S0CA 1CPMA 3LGRA 3LA2A 3UL2A 4ES8A 5E1RA 3AP4A 4LBQB 1CVNA 2WFF3 2EXKA 2HWC1 1LKNA 4QPYA 1WD4A 1R082 4FPGA 2X5IC 1KJLA 2HWD1 1BYHA 2PHFA 3AXDA 4A7KA 1UU6A 5BNOA 4GULA 2R49A 4RS5C 3VBSB 4IEZA 1V9U2 1G9CA 4BPZA 2CAUA 3WDXA 1AR71 1AYN1 3ZSJA 2X29A 1H1IA 2AZ5A 1YO8A 3ZO0B 4GXLA 2Q5TA 2GC0A 3FFQA 4D7YA 1D2QA 5C8CB 3QCWA 1RHI3 1PGW2 2WNUB 3RMXA 1FNYA 3GHNA 5BNNC 4PLNA 3KCYA 2CYFA 4KH9A 4LUMA 5E16A 1TME2 4UW6A 2YC0A 3VKOA 3OCPA 4LHKA 4Z07A 5B2GB 1LHNA 3CNAA 1AYM2 3N3HA 4N53B 4Q4X2 3WXPA 1O5UA 4XF1A 4Q4W3 3GZUC 1K5MB 3T2TA 1OHFA 4Y1YA 3FMGA 1QJY3 4N43A 5CFDA 3O12A 3PMEA 1F2NA 1G9FA 2W68A 2Q0AA 3WCSA 3B00A 1NA1C 3JD72 2D6OX 3WD5A 4WZFA 1POV3 1IS4A 4YVWB 2WT1A 3USUB 3W9AA 1COV1 1LESA 3B3QE 3LB9A 1YIPA 4YSFA 1NCQB 4D3WA 3IDBB 4G3YC 3LSEA 1N47A 1RUI3 1LODA 2MEV3 1SLAA 1AR93 5KWRA 3AMPA 5FOBB 3RYPA 5F9TA 3IBMA 3AYCA 4QPGA 1NG0A 4GB31 1LULA 5BNOC 4Z1VA 5A3MA 2PTMA 3RPQA 3NSTA 4XIKA 5T5PA 3MYXA 3LCPA 2ZGKA 1FOD1 1IS6A 2ZX4A 3WW2A 1JXNA 4QQLA 4YRDA 1BMV2 1G7YA 4L97A 4KBBA 4QPIB 2JG8A 4BHPA 5AFEA 1F5JA 2WS93 2XLGA 3MIDA 1Z0HA 2O8QA 1EP0A 2UYBA 5C4WA 3HT2A 4GWMA 1ULEA 5AFBA 4HL0A 3RJRA 4QGNA 3ZXDA 3H1MA 2IFWA 3N7JA 4FQ4A 1UL9A 2W39A 1AXYA 1RUOA 1WCKA 5T52A 4XMAA 2O8OA 4RSUA 2B5HA 3FUQA 4QQ2A 4N43C 3KGLA 4LULA 1SEFA 5CFDC 4OUSA 2E51A 3LA3A 3AMNA 5CNAA 1RUC2 1G8WA 5BY5A 1AR81 1BVVA 4WV8A 4WM7B 4EN8B 5AVAA 1BVP1 1ZX5A 2ZGMA 4JGYA 5CFCA 3E6BA 2ZHNA 3MIBA 4LHNA 3AFGA 5AC93 1YJLA 1DGWX 5C8WA 3RQ0A 4ASLA 2ZGSA 1QDCA 2EXJA 4HSLA 1OLQA 1LHOA 1RC6A 3B5LB 1VBE1 1HRI2 1KITA 4WBBA 1U5XA 1ND3A 2VW0A 4QPGC 1HRV2 3QLQA 3FUOA 1BEV3 2ZHKA 3KSCA 1FXZA 1ZZ9A 3AMMA 3DF0A 2WLQA 4MGZE 2A73B 1RUG2 2IC1A 4SLIA 1VBC2 3ZN6B 4EWDA 4J1WA 2DVAA 1KFUL 1GV9A 4G9SB 4JCKA 2CNAA 1W6NB 3THTA 5JI9A 4MYEA 1XXNA 2WNVA 2D6NA 2HWB1 2Y0OA 1OOPC 4RQPA 4H7MA 3ATGA 3CEWA 5SV5A 1VR3A 4LBOA 5HCAA 4KU8A 4A7ZA 1LOGA 2VNRA 3P3PA 5HCFA 5C4WC 2R1DA 2UY9A 3NL1A 3DPRC 4IEQA 4AVBA 4ZKTB 4KNCA 3N7LA 4Q29A 3ZFEB 4NPRA 1H8TA 5K8SA 1VBB1 3KLSA 4LR4A 2DFCA 4XJ8A 3HQXA 4NOTA 1AX1A 2GDFA 2A3XA 5GZDA 2UYAA 4FTEA 3OYWA 1C28A 1RIRA 2ZGNA 2X5IB 1RUD3 3OF1A 4RS5B 3LKJA 4Y1UA 2P37A 1JH5A 4F83A 4IXLA 4FP2A 4QQOA 4R8HA 4JGYC 5JSOA 5CFCC 3E6CC 4Y5Z0 4WVWA 4EWEA 5JOXA 2D5FA 4V1PA 5FDBA 1PO13 4HVQA 3IN9A 1RUNA 5T54A 2RR11 1ND3C 2JICA 4BIFA 4UW3A 3S7IA 1RUH2 1UPIA 3U07A 2R0HA 3O0VA 1NY71 3CU7A 1PIV1 1VBD1 4LE4A 1RVF1 4HVOA 1AXKA 4CRQA 2O1QA 1AYN3 1PVXA 5DG1A 2VMGA 1X82A 2WNVC 2XL9A 5A32A 5GZGA 3FX3A 2JE7A 4RQPC 1PVC2 1RUE1 3D0SA 2XVGA 1UD1A 3LA7A 4C0BA 4FBFA 1NA1B 1LHVA 4QM9A 3MIEA 2PA7A 1CAWB 4NN0A 4FPJA 1D4M1 1VBA1 5K9YA 1O7FA 2YUEA 3I8TA 5EZWA 3VBRC 2WZPP 4AW7A 4KGQA 5JWPA 3JU9A 1WA4A 1H8TC 5FMOL 1JN2P 4FPLA 1PMIA 1CR7A 4XPVA 2FZ2A 2DU0A 5GLUA 3FLRA 3TNPB 3NW4A 3WLUA 4PIZA 3WHTA 1WMEA 1SLTA 1X8EA 1HQNA 5BNOB 5JLVA 5K7PA 4P14A 5EXOA 2HWC2 4JDOA 3ES4A 1NXMA 1WLWA 2D3RA 5CG8A 2KM2A 3QACA 1O3RA 4K40A 2P3JA 3MF9A 4K9SA 1COV3 1B35A 1GICA 2HWD2 5BUVA 1CX4A 4AVSA 1BQPA 4MLOA 3MDPA 5KXBA 1PO22 2P2KA 1AR72 1F31A 1I9RA 4B29A 5F6LB 1CESA 1REEA 4IV3A 5JPNB 1RMU2 1S0FA 2W52A 2ZGOA 2XKPA 4CDUA 4C90A 2NN8A 3HR9A 4GB33 1H0BA 4AXOA 1LECA 4K6BA 2R073 1IKPA 1FV2A 2WKKA 1PNFA 4M0HA 1LOFA 1FOD3 3W59A 3D6EA 3KCCA 3TWIA 4HK9A 4URTA 5J48A 5CFDB 1U12A 3HMYA 4IV1A 1RL3A 5KHKA 1Q8OA 1WBLA 1REFA 4FAHA 3BOPA 3NV2A 1RUF3 4DINB 4J6GA 3D0JA 1ALYA 1YI7A 5D8AA 1EV12 2YROA 1LRHA 2EA7A 1WGPA 2NMNA 4QD2A 4XJAA 1XYPA 3JBG1 3SCFA 3M2MA 5KBFA 5J36A 1QJU2 2XPJA 2WL1A 2JENA 1QHDA 1W6PA 2R062 5EWSA 3PVOA 1AR61 3NV1A 5T5OA 3M3QA 1TNRA 1RGSA 1O4YA 4BZ4A 1FMD2 3M1HA 1TEIA 4QPGB 1QNYA 4HZFA 4JRAA 4XF0A 4DZGA 3BALA 2ZABA 3O0WA 3N36A 1J3RA 1EAH2 4O9GA 3DV8A 4ONUA 3V0BA 3AP9A 4YGBA 5DUWA 3WDUA 4F7ZA 4AI8A 3H3UA 2DCZA 2CGNA 2DV9A 2JG8B 1ND2C 1V70A 4YG0A 1LEMA 1G86A 1C8M1 4GMP3 1H1AA 1VBE3 3MLJA 4HPKA 5GZEA 3D4KA 4L2NA 3J4UH 3SITA 2WSUA 5I8TA 4CDUC 4XFIA 3AX4A 2WINB 3VBFA 5FCCA 2OA2A 4ZU7A 2ZZJA 1F9KA 3WDYA 3O14A 4BE3A 2CL2A 4L92A 4E2QA 4AGGA 3VHPA 4JQRA 4L8QA 4YM3A 4RD7A 1O5LA 3VBUA 1S0IA 4AK3A 4FT8A 4QX5A 3IDEA 1RHI1 3P3NA 3MGUA 1YLLA 1GQGA 1QDOA 1GZ9A 4WVMA 4XQWA 2IXCA 4JGYB 1AR82 2RJLA 3QH7A 4MH0E 1LEDA 3BU7A 2RMU2 1VAKA 3WW4A 4Z92B 1FI2A 1VBB3 2TEPA 4Q4W1 4GKYA 2D6KA 3FHIB 2UWCA 5KC5A 2WFPA 1ND3B 4XXAA 3T1LA 1DZTA 2BVBA 3RNSA 3WG1A 5T50A 4XIOA 1JUHA 3AYAA 2VG9A 2WNUC 1ZBA2 3OBTA 1JTZX 4LHLA 4AVCA 1NOVA 4OHYA 2IFRA 2ZKNA 1POV1 2CWMA 1NXD1 4DRRA 4JV4A 4EN9B 4JTNA 4FXKB 4UXAA 3ZYIB 2VULA 2WNVB 2ZAHA 4N53C 1V6IA 1QMJA 2QZ3A 5E88A 5AVPA 4E4ZA 3USSA 1MACA 4RQPB 5FLIA 1LJ7A 3WP4A 1K5MC 1YFWA 2EIGA 1YWKA 3MIHA 1VB2A 4NWWA 1IS3A 4S2HA 2RR13 1ZREA 1RUI1 4Q8KA 2F4PA 4AHWA 3HBZA 3WP5A 4OVEA 1VB4A 2HWB2 5DUVA 3QD6A 4FCAA 1YFUA 3PVBB 4RHV1 3ZPYA 4M01A 1CGPA 1IS5A 4IEUA 2A70A 1FAYA 1ULDA 2RS31 4CP0A 2CWSA 2DU1A 1PIV3 4UBHA 1QF3A 4FXGB 2JXAA 3RSJA 1H8TB 2R6QA 2Q8OA 1W6QA 4FOYA