2LM3A

Structure of the rhesus monkey trim5alpha pryspry domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
205
structure length
205
Chain Sequence
TELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Ligase
molecule keywords Tripartite motif-containing protein 5
total genus 36
structure length 205
sequence length 205
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2lm3A00
4P9LA 2WL1A 2YUEA 2E63A 2LM3A 4XW3A 4B3NA 4WVMA 3TOJA 4P9IA 4KG0A 4N7UA 3ZO0B 4WVMB 5F6KA 3UV9A 4N7IA 4QT6A 4P9JA 4X8NA 5JI9A 4X8PA 4B8EA 5JIAA 2YYOA 3KB5A 4V1PA 2VOKA 2FBEA 5C33A 5JIUA 2IWGB 5JI7A 5F6LB
chains in the Genus database with same CATH superfamily
3MDPA 3HD8B 3T1MA 1HX6A 3KT4A 3VZMA 4WM8C 2GC1A 4YG6A 1SDDB 1F15A 1C28A 1LTEA 1RUD2 3ASIA 4IV3C 5K4LA 3RDIA 2QQPA 4CCOA 3ZFEB 1W8WA 2ZHMA 3MBWA 5IVJA 5FP7A 4XBLA 4XXAA 1ZZCA 2GP3A 2JJ6A 3U75A 4QPWA 3RMYA 4HMZA 4QQLA 4MG2A 4LO8A 1XSQA 2VZPA 4ARXA 5C5UA 1JMUB 1CX4A 1ULGA 4XFAA 2VOVA 4E4HA 5C8CC 4WM7C 1CJPA 3MF6A 3WR0A 4R9DA 1JU4A 1O91A 5CFDB 1TG7A 1DGRN 3WP5A 4Q0VA 2EA7A 5J37A 4BU2A 4COZA 1WW7A 3PIGA 3MW2A 4AGGA 1Y7BA 1Q5OA 1LHUA 3GBGA 4BQWA 4CDQA 4DRRA 4NPRA 1LOFA 4AI2A 1FNYA 1W2NA 2QQLA 4RR3C 3W20A 1HRI1 3VBOC 4JAAA 1S0FA 3NRUA 1C5HA 2MNGA 3CHXA 4FOQA 4M3CF 3V56A 3EQEA 3NQHA 3SKVA 4MXWB 2VTFA 4J1WA 1LJ7A 1NAEA 2RHPA 2ZHNA 1U5ZA 3FX3A 1MZEA 3PVOA 2D6KA 3WG1A 4CCCA 3OBAA 5KC6A 5LK7B 3O1MA 1FMD1 2JG8B 3CBNA 1E5SA 1X8EA 3MIGA 4BE3A 3VBHC 1RHI3 5F3CA 3AKPA 3BGAA 5J7MA 1D4M2 2QQMA 1R1ZA 3T2OA 5LEKA 4QXBA 2C5DA 1A6CA 1CWPA 1UPIA 2RM23 2BPA2 2PA7A 2X05A 1O4ZA 3M7AA 2QQWA 1YI9A 3IN9A 3OBTA 4LIUA 4UFMA 4EYUA 3WW2A 3WF1A 5JUVA 4FPEA 1F5FA 1LULA 3R6SA 4ORFA 1POV0 2CGNA 2DCYA 4N53A 4P00B 1KRIA 5FY5A 4D0QA 5JDBA 2CGPA 3OUIA 5L19A 5JZGB 1RUG2 1UX6A 2ZPXA 1AR61 2MEV1 1H2MA 3FN9A 3BKZA 1YYNA 3JCIA 5J36A 4BZ4A 4I3PA 3TEWA 2K46A 2ZGPA 2XHNA 3WZ1A 4IEPA 1CZTA 3P5BA 3VBSB 5IFPA 1VBC2 1UD1A 4WM8A 5FMCA 5FPBA 4E8DA 2JKBA 3ES1A 2FZ2A 4YZ5A 1BKZA 4AQ6A 5BXXA 3WT3A 2DCJA 2PHLA 2JE8A 2WT2A 5E8AA 1NCRA 2JDUA 4PBPA 1S0EA 1OF4A 2OQ6A 1Q8QA 3VHNA 1XE8A 3VZNA 5AC93 5ACA1 3ILFA 4QPGC 4E8CA 3LA2A 3BTZA 5IVYA 1DDLA 1AR81 5FXXA 5ABJC 5ABJB 1NCRC 1WMFA 3DL3A 4Z1VA 5C8CA 4YNIA 1K5MA 1W6NB 4OUEA 4CA9A 3VBFA 2D6LX 1HRI2 2VL4A 1QJU2 5C9AA 4MV2A 3KCYA 1OT5A 3O0XA 1RUE1 1DLCA 1QJX1 2ET7A 4LBNA 4KU8A 4Z2AA 4LQRA 4GJYA 1BZWA 1NCQC 1S0BA 3I2IA 3J7NA 3A21A 1WCUA 4NWVA 4RQPA 4X6RB 3VBSC 1OVPA 2MEV2 1AR62 2WFF3 4MUVA 1IG0A 2RDQA 3ZFGC 1HQNA 3VBUB 4OHZA 1AYN2 3VBRA 5BNPC 2RR12 1BYHA 3T3YA 4HANA 3K4DA 3ZKYA 4CE8A 1MPXA 4W6YA 2VW2A 2UY9A 4IV1C 4Y20B 1JOJA 1PZ8A 5D2AA 1JOBA 2WFF2 4PHZA 4COVA 5ANNA 5FZDA 1UZVA 4WV8A 5L9BA 3OGJA 1E5HA 3OPWA 2W3JA 1CZVA 4PI2A 3NKTA 1UYPA 2GN7A 3E5UA 4TSVA 4N9HA 1F8VA 1ENQA 4H7MA 4LO7A 1AJOA 1AL22 3SEEA 1C8M2 2P17A 4Y5TA 4P14A 1QJZA 3PUAA 1JUIA 1XXNA 2PLV3 2OKXA 4CU6A 3VBHA 2GMEA 3A0KA 4CZSA 4Z07A 2R16A 3CDZB 3LDKA 4FFHA 4HSLA 4SLIA 2AEYA 4UW4A 4G3YC 3SCFA 3ON7A 2HWC1 1Z7S2 3UGFA 4BH9A 3V0BA 4LJHA 3LAGA 3OYWA 4AYUA 2Y6FA 2VMHA 2Q8DA 3VHPA 2GH2A 1RITA 3PHMA 2E7AA 1R1A2 5IK5A 1VRH3 1QNYA 2VMEA 2HWB1 3KD4A 1NLQA 3V0BB 4MHRA 1XQNA 5JVVA 4P9XA 2BNNA 2W0XA 2ZGMA 3QCWA 4EE2A 3FWEA 4HKWA 4CEWB 3AXDA 1PM7A 1NQJA 1MZ5A 3VBUC 5A1FA 1UNBA 2YHJA 3HNBM 1AR71 1GZWB 2YU2A 1DYKA 4NMIA 3DXUA 1UN1A 3DCQA 2WZEA 5A7WA 5C71A 1QKQA 4IV3A 1VMHA 5M0TA 2WNUB 1RUD1 1XOYA 3QH6A 2B4KA 1I5PA 2W91A 2HEWF 3TEXA 1SZBA 1D4M1 2C1FA 2RR11 4H14A 1H2NA 2YC0A 4AHZA 3VDDA 4PDWA 1AHSA 1MR5A 1OSGA 1RUI3 3EBRA 3NNMA 4TLGA 4XFIA 5JMOA 4KQ7A 1SFYA 5FPZA 4BIFA 2FMDA 2D5FA 4LHLA 2WQ4A 3T30A 1COV3 4JHTA 3NV3A 5FXVA 3U0ZA 2YB7A 3ORJA 3PTYA 2EXIA 3LOBA 3TB0A 3ZYGA 1VBB2 1C4RA 1H1IA 1SACA 1W0PA 3IPVA 2VR4A 4QB1A 2IXIA 3O1PA 3ES4A 5EXOA 2X29A 1W8NA 1AR63 2MEV3 4Y1YA 4XACA 3O12A 1UMZA 1W2UA 4QPGB 1W6QB 4ITCA 1XE0A 4LHKA 3U10A 2XJUA 2GSYA 3I2HA 4LMFA 1GKBA 1BMV2 2N7GA 4LE3A 1OQEA 2ZX3A 5F3EA 4KI5M 3I3DA 2WNVB 5A32B 5T52A 1YQ2A 3NV1A 4URAA 2W39A 3RFRA 1PO11 1RINA 5GLWA 2BWCA 1N3PA 3E6BA 1GQGA 2ZKNA 4CDWC 3HN3A 1HLCA 1W8HA 3TWIA 1TEIA 1BHGA 4H2AA 4FTBA 1GNZA 3GCWA 3JXSA 5H9QA 2JDNA 1ENSA 2WFF1 1WW4A 1GZ9A 3POJA 3OGSA 1O5LA 1Q43A 4DS0A 3WNKA 1RJ8A 2WO2A 5C70A 2JICA 3N7KA 1WZXA 2Z42A 2Y38A 3M8LA 3PLQA 4A6OA 3ZO0B 5CKNA 1AYN1 1DHKB 2VNVA 1N47A 4CEYA 1SG3A 1ND3B 4AVAA 4Z92B 5FZHA 3U11A 2HBTA 2XR4A 4JRLA 4YSFA 4JDMA 4OMDA 1QXJA 2R32A 1CAXA 4KWJA 4MGQA 2ZGQA 1JTZX 1SMVA 4RFRB 4JHZA 4AI9A 1IS3A 2PHRA 4AEMA 1LESA 2R0HA 4XFHA 3WY6A 3LEKA 4IV3B 2P4EA 4RR3B 1VB4A 2XJQA 3ZXDA 1OPOA 4LA3A 1POQA 3BTYA 4AGVA 4CDUA 1DBNA 2WN2A 5ERLA 4D6SA 1BVP1 3OF1A 1YQ8A 3VBOB 4BA6A 4MGZE 3ZIXA 2Z4FA 3FL7A 2BVVA 3ROUA 1BQPA 2ARBA 3OPZA 2ZMKA 3UK9A 1H4HA 1UZWA 3LEIA 1KS4A 2ILMA 1QF3A 4JGYA 1G7YA 5DUWA 3USUA 4D7YA 4F3JA 4LNVA 1K5JA 2A3XA 4OVEA 3GBFA 4JDNA 4WM7B 1YFWA 4XDOA 5FZOA 3V65A 4D7TA 4LKDA 3E5XA 1UW8A 3TN91 1UIJA 4XJZA 2PHWA 4YM0A 2XKPA 3K51A 3AJZA 1OUXA 2C9AA 2J7MA 2PAKA 4LLFA 2PAMA 1W0NA 3D0SA 2BYVE 2D3RA 3ACHA 1F31A 3LPFA 4UFLA 4LORA 1HB3A 3SEPA 2GDFA 2H0BA 1LOFC 4XQWA 1F2NA 5LBFA 2BTVC 1UMIA 1K5MC 5CNAA 3AKRA 3U78A 4WVZA 1DIWA 5T5JA 2P1BA 1YC61 1JYTA 2D5HA 4R9AA 2HWF3 1PZ9A 3OGVA 4KL1A 1LHNA 3ALQA 4ZZ8A 5C33A 4LTAA 1GNHA 4BJ0A 4BISA 2VNRA 2AYHA 2W87A 4Y1UA 3T0DA 4CCJA 3R4DB 3B7MA 1UMHA 4QPYA 1APNA 3HOBA 1ENXA 1NE6A 5CG8A 3CF6E 4LOSA 2ZGNA 5FLHA 3VKFC 3T2TA 4HOOA 4G4FA 3WQBA 4DY5A 1SCRA 4UI9L 5BNOA 2C0ZA 1WBFA 2HWE1 2QBXA 4DEVA 3SKJE 1UAIA 2YPDA 3I2FA 4BQ5A 1RUJ2 2EF6A 2TEPA 4IUGA 2WO1A 5FPUA 3HAGA 2G4IA 4CXXA 3SHRA 4YRDA 4DY3A 2JG9C 2WAOA 3POFA 4LR4A 1LGBA 5GM0A 1V9U2 2Y64A 3EO6A 5IUQA 1VBC1 5I93A 3HJRA 1AR91 1WCDJ 4XABA 4EWDA 1HRV1 1VBD1 4AGRA 5LRSA 5FMOS 3A7QA 1JYNA 1AYM3 3APBA 1X7NA 3MHZA 4KH9A 2YGLA 4CDUB 1BBT3 3IDBB 2B5HA 1PNGA 2GNBA 1YNAA 2VZUA 3TOJA 4E27A 3R05A 1RVF1 5A7OA 3AKQA 4XQ4A 2NM1A 5FBZA 1CJDA 5K0UC 2EAAA 1VAVA 4M3CE 5CA6A 4P9GA 3ZN6B 1RUOA 2W2IA 2D97A 2EXKA 3TYJA 1UZZA 2DCKA 1ULDA 3MLKA 4N8MA 4FOWA 5FZ3A 1QOTA 4NRMA 4QQOA 4BK4A 1SQ4A 4CDWB 1YCIA 4FVVA 1LHWA 2DU0A 1QH7A 1XNKA 4GZ9A 4IEVA 4KWLA 5IJRA 3VD5A 4TTGA 2HH9A 2HJIA 1QJU3 3EJKA 1CIWA 2XKOA 4HN0A 4ES8A 1FNZA 2CL2A 3OGRA 3SQOA 4S2HA 3K75B 2B45X 5FQ0A 3BTXA 4XFCA 1OMIA 2X5IB 4HT1T 3B3QE 1AL23 1QJU1 3ZSLA 4AK3A 3I3QA 1FPN3 1J1TA 2JKXA 4XF1A 1IG3A 2UURA 4IQPA 1J58A 2ZGKA 4ZKTB 2BOIA 5JAXA 4QX1A 5JSPA 4J6GA 1TNRA 2UWBA 2WS91 4MGKE 3ZFFA 4LXLA 5DZEA 3BUCA 1UZYA 5CFCA 3BPZA 1PX3A 1ZBE1 2VZVA 3ZSJA 2Y8KA 2JECA 3HPNA 4NE9A 4QQHA 3ZYHA 1HN0A 4BPZA 1R081 2VO5A 2A70A 3ACGA 4JGYB 5T3NA 4MO3M 3NL1A 1GOGA 2W5FA 3AMQA 4AAPA 2Y6KA 3RZJA 2FCTA 1VIWB 2CAVA 4K1ZA 4K40A 1H8TB 2WZR1 1CAUB 1HXS2 4XTPA 2D6NA 1W2TA 2DTYA 2D6MA 4JCKA 3ZXJA 4IE6A 1RHI2 1O3RA 5CEHA 4BM8A 4HG6B 4WZFA 2XJRA 3RWNA 5CFDC 2BBAA 2XJSA 1W9WA 4HVRA 1RL3A 2DUOA 4AFAA 1H9WA 1D0HA 1NYWA 4HPKB 1W9SA 2VBDA 4K9SA 4ARYA 5FO8B 3DYMA 1FPN2 3Q8EA 3KWVA 1MVEA 4QB6A 1QH6A 2KM2A 5KHGA 3WF0A 5GJ6A 4PT6A 2WS92 3ZFEC 3HQUA 4M4RA 4V2VA 3BI3A 3VBFC 4U36A 3MI8A 4FI9A 4OYUA 4XFFA 3IWZA 2YROA 2WINB 3HBZA 3C7EA 3AP5A 4LBQD 3IMNA 3NV4A 5LASA 2BUKA 4B1MA 4ASMB 1OHFA 1YFYA 2ZGLA 2Q1MA 1RUH2 3DV8A 3EMRA 1OURA 4PF5A 4DINB 2GNMA 3PU8A 1VRBA 1T6BX 2DFCA 4TN7A 2BGPA 1PVC1 1REFA 5FZ0A 4OQ8A 1V6MA 4CCLA 2DYCA 3AL6A 5C3PA 5LZ6A 4PLOA 2BVBA 3FBYA 3HVDA 4QDSA 2HEVF 3NAPC 4CDXC 1JZ7A 2Z69A 1RVF3 1V6JA 1SBEA 3AYAA 2A3YA 4IETA 4MOAA 4B7KA 1ZBA3 1VBB3 2G1MA 1CAXB 3IDCB 2LTNA 2RM22 5BV6A 2QCSB 2VNOA 3EXUA 1HB2A 1UY0A 3H42B 3SCHA 1D7PM 1STMA 3ZPYA 2WO7A 4CP0A 5IVCA 2ZHKA 3A22A 2RMU3 3I2OA 2ATFA 4UYBA 4FT8A 2RS31 3GGLA 4GMP1 5F6LB 1H2LA 4I09A 1PZ7A 1ULFA 2EALA 4BLIA 2WWUA 3N3HA 4OUMA 2DVFA 5DZGA 5FYCA 1H8TA 1FV2A 1H30A 1UYYA 2X5IC 5FKCA 3V0AB 4NR1A 4Q8KA 1HRV3 1VBD3 3KVAA 4LUMA 2QDRA 1OF3A 4NIGA 4NRQA 3MPBA 1MEC3 1AYN3 1J1LA 1KFXL 4JVAA 3G6JB 1VPHA 1SPPA 4X8PA 1Z7S1 5DZFA 1DFQA 4EQVA 4CP9B 4MSVA 5A32A 4TYSA 1G9DA 3RRDA 5FZ4A 1MEC1 4KG8A 1IKPA 1DZRA 4OI2A 2RM21 2OW4A 1C8M1 2G9GA 1Q3EA 5AVAA 2Z2SB 2D98A 5FP3A 3FJSA 1J59A 5G04L 2WQZC 1J83A 3O0VA 4RFT0 1HW5A 2GAUA 4Y22A 1H2KA 2GALA 2PHDA 2ADEA 1LRHA 1REDA 3MFAA 4QGNA 2VQ0A 3VD4A 4Z2WA 3U07A 3ST7A 4XURA 4XILA 2P34A 3IT8A 4P9JA 4XBQA 2BP6A 3NW4A 5FYBA 2IZWA 1SHWB 3AFKA 3FMGA 2JE7A 4ASKA 2OVUA 1SLBA 2IVIB 4XJAA 1YQ6A 4XUNA 3TEYA 2NYYA 3RQ0A 3C7GA 3ETPA 2Y6GA 3JU9A 2J1RA 2UYAA 1LKNA 3MW3A 2YDEA 1MS1A 1LOBA 2R072 4P9LA 3O1TA 1FX5A 3C3VA 4CCEA 4EZ4A 3BIEA 4KGGA 4A7ZA 2H0VA 1NCQA 5FTTC 4W8JA 2QZ3A 4DUVA 4NJ4A 5SV5A 4EN6B 2TBVA 5JOWA 2AR6A 3PDQA 3QACA 1PIV3 1DQ1A 3ACFA 4AG4A 4M00A 2YYOA 2DFBA 2CDOA 4LA2A 1K12A 4M01A 1PGSA 5T50A 3SC7X 1BEV1 1WCSA 3T0BA 3ZXKA 2FDIA 4Q4Y1 3KVBA 2WZR2 5FY7A 3DEMA 4AE2A 4K6BA 2ZKLA 1PIV1 2C6SA 2JDAA 2Q30A 1C1FA 2VULA 2YGMA 3IKWA 3Q8AA 4I3GA 1JHJA 1D0GA 1ULCA 1YHFA 2RS12 4QU2A 2VZTA 4CUCA 1MS5A 1FOD3 1GWKA 2JDYA 2YY1A 4V2WA 2PFWA 1DGWX 5J96B 2V72A 2Q1ZB 1FT9A 3FFQA 3CZUA 5A3PA 4ONUA 1GBGA 4MGSA 1PO12 2WLPA 3POSA 1LOGA 3ZDVA 4AWDA 1ZZBA 2R30A 2J42A 3J7MA 1TME1 4HVOA 4E4SA 4JGZC 4W65A 4FFIA 5FQ0B 1QJX2 4OLLA 1WCKA 1D4M3 2Y6HA 1OH3A 4URTA 1DGLA 4FFGA 5EYYA 1S0CA 1N1YA 4AVBA 5GZEA 1CQ9A 1XYPA 4YW4A 4IEOA 3ZFGB 4DZGA 1WMXA 3DKWA 3GF6A 4GXLA 5L9RA 4P9IA 3LFMA 4XJ8A 1H1MA 1FXZA 1S4CA 1JU3A 1RUC1 1X8MA 3NWKA 4HK9A 4MH0E 3VBUA 4Q29A 1UZ0A 1W05A 2W1QA 2VXRA 2ZCWA 2WT0A 2IXCA 1NT0A 1G9AA 3I97A 2JENA 3RYRA 4IEWA 2CHHA 4MX3A 5DG1A 5KR7A 4AAXA 4YW7A 3HQRA 5KHIA 4XUOA 1DGWA 4JQRA 1HV0A 2VMFA 5DG2A 3WF2A 5GLVA 2Q5TA 2J22A 2WWSA 1QJY2 4XHBA 5EP9A 1AZDA 3VDAA 3IMMA 4GB33 4OULA 2XVKA 3WF3A 3ZSMA 1MZFA 1UX7A 1TMF3 1HXS1 1ZX5A 1QMJA 2E6VA 1ZRDA 1F9KA 3BTAA 2WN3A 2RR13 3PJQA 3X29B 3ZKUA 1SLLA 2VUAA 1AR92 4HONA 1R082 1AYM1 5FY9A 1UYZA 1XNBA 5JI9A 1PO21 1QWRA 2VZSA 3WHUA 5JIAA 3AP7A 5GZFA 4Y33A 1S1AA 1S2KA 2DVBA 1IKQA 3P3NA 5CFCC 1JZ6A 2WQ8A 4XFGA 2FBEA 2XXZA 5FP4A 1OOPB 5LB6A 3CZJA 4UFKA 2P3JA 3M3EA 4AEKA 4YGCA 3UL2A 4MVTA 1T6GC 3U37A 3ZFFC 2FDHA 3I4IA 3JD72 2BBVA 3PVBB 3OBRA 4DO0A 4UW6A 1LEDA 3N7LA 2X8KA 2GNDA 1US3A 1ZA4A 5F6KA 4AFCA 1CAWA 1OC1A 2E31A 1F5JA 1T2XA 3CNAA 4UAPA 3ZR6A 1UWWA 1W8TA 1VBE2 4BQ2A 1DP0A 1SLTA 2DVAA 2A6ZA 3WDXA 2XBO3 4NO4A 1W2OA 2IC1A 3UYJA 1W6NA 3W9AA 2HWF2 4QPIA 4AI8A 2JG8A 1QXPA 5FJKA 3CJIC 1GYKA 5E88A 2IXJA 1AX2A 1RMU1 2VE1A 3RGBA 4LO4B 4LKSA 2FMYA 3WSOA 1LEMA 1ST8A 5FFOC 4K8RB 4QPIB 1F35A 3I59A 3KM5A 4XCAA 2E7QA 2VW0A 1CX1A 5LA2A 1OD3A 5I8YA 1PMJX 1RVF2 4AVCA 4DMIA 5CADA 1SPPB 3OUHA 3THPA 4COWA 4DPNA 3H8RA 1VLNA 5JSRA 4Q4V3 4CP9A 4GJZA 3TNQA 3U4SA 1WGPA 3DPRC 2QQOA 3D5OA 2OXBA 4GALA 1WCQA 3RZZA 3UJQA 1N3QA 2VZRA 4YVWA 2Y6LA 4GA9A 4C1WA 1V6KA 1POV3 5GLUA 3FHQA 1OLRA 2QE3A 4ISRA 4LKEA 1HV1A 4BHPA 3H8OA 3LGRA 1ZZ6A 2A3WA 1RXFA 3L2YA 2XPJA 5FYZA 2QZ2A 4C8DA 1RUJ1 4Q4Y3 1RUE2 4IEUA 4Q4V2 2FQPA 1EY2A 3K2OA 4B4RA 1JYCA 3PL0A 1UOGA 4GIQA 2RJLA 4J25A 2WZ8A 4R4ZA 2QDNA 3B93A 1S0DA 3O1SA 2VUCA 5KXBA 2P2KA 4XYXA 4AW7A 4CEYB 2W95A 3CO2A 1U5XA 1MS9A 4TXWA 2YXSA 2PAEA 2RS32 4QM8A 3N7JA 5T54A 3AL5A 5GLTA 2VCAA 1CAVA 1S0GA 1XB9A 3NJZA 2VZ3A 3VDDC 5C9AB 4YFZA 1REEA 5CFCB 2BGOA 1ZRFA 1F4AA 3U1XA 2K0GA 3SH5A 2QQNA 1CN1A 2E26A 5C5TA 1NCQB 2LM3A 1KDMA 5AVPA 3RWKX 4W50A 1IS5A 5AC92 1EPZA 1Z0HA 1QY4A 2QQIA 1OLMA 4RR3A 5EWSA 1PM4A 2W46A 2JG9A 1ASJ2 2JDHA 4EWAA 3CLPA 4RHV3 5CB7A 3VZOA 1YWKA 2CGOA 4XUQA 5EHDA 4EZHA 1CIYA 3DPRB 2LW8A 2AH2A 1JN2P 1PVC2 2E51A 2ERFA 1UOBA 1ND3C 2VH9A 3ATGA 3BPSA 3BU7A 3USSA 3WG3A 3KQRA 4CXYA 2E7TA 3PNAA 4OI0A 3MV01 2XLAA 4CUBA 4MGIE 1ND2C 4YGEA 4MADA 2AREA 4FFFA 4OCTA 3KHCA 4OQ9A 3O14A 1IOAA 1RXGA 2XLGA 4NPMA 5FXZA 4CCDA 1YEWA 2YFZA 4IE5A 2WKKA 4A44A 2FDKA 3AB0A 2HLEA 3UV9A 3WV6A 2EIBA 1Q8OA 4K21A 1H8VA 2QKDA 3MUY1 1RGSA 4PIXA 3AK0A 2UU8A 3PMEA 4FSJA 1FPN1 4QHZA 3KF5A 1W6QA 3ZSEA 2WIIB 4LK6A 3THTA 2DV9A 4OZXA 1XRUA 1YIFA 4Q0UA 1N1VA 4ASLA 3MLJA 4LBOA 4AOCA 2BV4A 1ND2B 2XBO2 1D4VB 5ABJA 2JDMA 1O4YA 2J1TA 1DZTA 1VBE3 2A71A 4FOYA 4NHXA 4YVWC 3ZXFA 5BUVA 2WYFA 4PQ9A 3LFIA 1UL9A 2ZOEB 3M3IA 4A7KA 4BQ3A 3MFCA 1Y9GA 1FI2A 4UW3A 1ZBE3 1VR3A 3CEWA 1L7QA 1GOFA 1OI6A 4QQ2A 1DG6A 2IXKA 4KNCA 4YZ3A 2JDZA 2R043 4LBQA 1VP6A 4XAEA 3BOWA 3K3OA 5E6HA 3JD73 3URFA 4YARA 3GZEA 2DTWA 4N43A 5FLIA 5JOZA 1X82A 4XF9A 5FUPA 2ZX0A 1K5MB 2Z79A 1JBCA 4BXSV 3AMPA 4C0BA 2GP5A 5A7SA 2CDPA 2VGDA 3ENRA 2WSUA 3CJIA 3FUQA 5BY5A 2C26A 1J3PA 1FV3A 2XDVA 4IW3A 1QJX3 2QFEA 2WAAA 1UY2A 1W9TA 2GC2A 4YW2A 5CG9A 2LS6A 3BVCA 3S5AA 2DVGA 3LDRA 4JV4A 4W6WA 2JE9A 2L9LA 1K45A 4O65A 2AUYA 3ZLIA 1JZ3A 4QDQA 1BLZA 1CAUA 4IEQA 5KHHA 4DRVA 1H0BA 1AX1A 5GZGA 4HXCA 3AP6A 5BNPA 2XUMA 1VBA1 2QQUA 1C3HA 4L97A 5F5QA 3T2PA 3FZ3A 2NN8A 4XIKA 3IAPA 1D2QA 3HIFA 1ZA7A 3ABZA 5HCBA 2PELA 4CEYC 1DYPA 2YU1A 3ELNA 4RD7A 1BK0A 2PLV1 4DUXA 3VBHB 5FY4A 3WD5A 1NXD1 1QU0A 1C8NA 3FLPA 2B39A 2JDPA 2A6VA 2GU9A 1UKGA 2MHFA 2O0OA 3GNEA 5LATA 2HWC3 3NAPB 2WBKA 5FZOB 3DF0A 1JYIA 2ET1A 1MS3A 4COYA 4CYDA 1SLCA 4AL9A 2YBPA 3M3OA 1NUKA 3LIGA 5FYIA 5F37A 3J9SA 1SLAA 3H7JA 1POV1 2O8QA 1VRH1 1JHNA 2WJSA 3HBKA 4MYEA 4QHBA 3B00A 4EROA 5J98B 2Q8EA 2WSVA 4FPOB 4D6QA 5B4NA 5JPMB 4YVSA 1NCRB 4GWNA 4UFHA 4AI1A 3KZ4C 5LEJA 1CPMA 4PCRA 2TNFA 3WNXA 3IDAA 4NIAA 1AR73 3S30A 3H1MA 2RMU2 3VKMA 2F4LA 4R9CA 1OKOA 1A78A 5F7UA 2YV8A 5JSOA 1IPSA 5J09A 1G86A 2AZ5A 2B9UA 3LCPA 3N4MA 1OA4A 2RS33 4QM9A 5IYYA 3B9CA 4RS5C 3PUHA 2AC1A 4Q4X2 2VQAA 2HWE2 4PDWC 1RUG3 1HXS3 2VCCA 1BBT1 4DXSA 5J3UA 3D8CA 2QJVA 3N35A 5D8AB 3WEZA 2JWPA 1WMEA 2D44A 3MV11 2P6HA 4F7ZA 1V6NA 4I0BA 5FUNA 4XZPA 1VBC3 1WLCA 3CJXA 3I3BA 2OPKA 1JZ4A 5FZIA 4XZUG 5JMCA 5A3OA 3N9OA 4WZCA 5A3WA 3L9JT 2JIJA 4BQ4A 4MZUA 5EIYB 2RDSA 3AKTA 1PGL1 5FZGA 3MPPG 4QGMA 1AX0A 5FAXA 1U5IA 3N9NA 3TRSB 5F1RA 3DECA 4Q1RA 1ZYBA 2VCBA 3ECQA 1UU5A 4HPKA 5T55A 3T4HB 4ZS2A 2HWD3 3WQ0A 5JR2A 1PMIA 1ZZ7A 2FZ1A 3NSTA 3LIHA 1I9RA 4Y26A 5EJ3A 3ZX7A 1O8PA 1GP5A 5FYUA 1IGOA 3MIFA 5CFDA 5CISA 3VGIA 2WT1A 4QX0A 2VTXA 5C4WA 2DWRA 2HWD1 2G19A 2P3IA 2PMWB 3PUQA 4JKLA 3RJRA 4N90A 4FBFA 1DZQA 1ONAA 2G9FA 2CSGA 3KHBA 3WW4A 1OOPA 4HN1A 1W39A 5ISLA 3H3LA 1UKRA 1MVQA 3OOXA 5F3IA 5DUUA 1ND3A 3OG2A 1NXMA 4LLOA 1GNYA 5DAWA 2D6OX 2VD7A 1RUF1 1WW5A 4MHUA 5EQUA 4XW3A 2WO3A 1CESA 1WMDA 1VE0A 4Y1VA 4AVSA 3KV6A 3JB8A 2OX0A 2F6BA 2GMPA 2NQYA 3A0NA 2J1SA 1G8WA 3PVNA 3WQ7A 4B8EA 3IIAA 5FZ8A 1JW6A 4JC1A 1GQHA 4R4XA 1R1A3 1XPWA 1ZZ8A 4HL0A 1H9PA 5HCHA 2X53S 5DABA 3ZYRA 1B09A 3MZHA 2VAUA 2WZR3 4C91A 2R041 3J26N 2RDNA 2LUWA 3ZXGA 4Z82A 2A6YA 2JXAA 5CAZA 1R091 2ZGOA 3DXTA 2YUEA 3IM0A 3I7DA 3T2QA 1FYUA 4HLTA 4XC9A 4P5YA 3RJ2X 3WCRA 2GMMA 1HN1A 4Z8BA 2WABA 1NY72 2QQJA 4DXRA 4LBJA 4N7IA 3MGUA 3RPQA 4P08A 2OUJA 2Q4SA 3DN7A 3PUSA 4HKLA 3ZR5A 3C7HA 1S0IA 4YWAA 3D4KA 5H9RA 4ZU7A 1V6OA 3ZXLA 1AYM2 1QHDA 3F95A 3E97A 5F5CA 3NVCA 5F32A 2ZEWA 4QHOA 1KFUL 1UXZA 4QMAA 3CU7A 3I2KA 4JZRA 4R8HA 1A34A 4N43C 4FXKB 3VBRC 4AVVA 2IWGB 3DYPA 3GBWA 4XBNA 4COUA 4YGBA 5BNNB 5KHJA 5CZKA 4GD4A 5C3QA 3HQXA 5K9YA 3RG0A 1DLLA 1EAH1 3KGLA 2BDRA 1ZBA2 4LK7A 3LZZA 4C1XA 2Q0AA 3PVEA 2X10A 1AR93 5CBLA 4Q0PA 4RGKA 5FP8A 2QQVA 3H9AA 5FYHA 3F2ZA 3DKQA 2Y26A 1FMD3 3J7LA 4JX0A 1HIXA 1H8TC 1QIQA 3I8TA 4LBMA 3MF9A 2XJTA 5C3OA 4CU8A 2RE9A 2DBNA 3HMYA 3W5NA 1OFSA 1PGW2 1ALYA 1NZCA 1QOOA 3AM2A 3ZFFB 3AVSA 1IZ3A 5LBCA 4BDVB 1URXA 5CKMA 5FZ7A 3I2JA 1OOPC 3I59B 3BOPA 1XNCA 3IB3A 1NKGA 3WNNA 2WL1A 1EYBA 1PK6C 4PI0A 2EAKA 2O1QA 5FPLA 2JIGA 4ZS3A 4QQPA 2UWAA 3WCSA 4QXHA 4AZZA 5APAA 1NLSA 2NMOA 4P02B 5GZCA 4C0HA 1LNSA 4QX2A 3BCWA 4GB32 3GYDA 2ZJCA 4PQQA 2J1UA 4BXFA 1HKDA 1L7LA 1OXCA 4K7JA 2HWD2 3NO8A 5DUVA 1RTVA 3I54A 4Q4X3 3KV5A 5FJHA 5HXMA 2WC2A 3JBG3 3ILNA 2J1AA 1DQ0A 5K0UA 4NHKA 4QX7A 4UBGA 1LOAA 3ZFEA 1F4HA 5BYNA 2WFPA 1PMHX 1JYXA 5FZEA 1RUI1 5A33B 4NHLA 3LSEA 3C8XA 2BGCA 4FPGA 2ZZQA 1LHVA 3T4VA 5DAVA 5FMDA 1FATA 1WBLA 4J1XA 1B35C 3LOIA 3LSDA 1WW6A 1COV1 3AVRA 4FPJA 3WG2A 5FZ6A 4EN7B 1PIV2 3Q8CA 4TWTA 5FV3A 4O61A 1WKYA 4FTEA 3T1LA 2ZEXA 3T09A 3W59A 4EV0A 1LU2A 1OFNA 1QQP2 2CWSA 3ETQA 1EAH2 4FP3A 4LE4A 4QT6A 5FMOL 5FZLA 4D8MA 3JD71 5I8SA 1Q8PA 4Q26A 4BOWA 1VMJA 2RG4A 3H50A 3OD0A 3K46A 4K20A 4RSUA 5DDJ3 1FOD2 2XMLA 4GB31 5FYYA 2YZ4A 5FWEA 4XVHA 4JDOA 3LA7A 2EICA 4XIOA 4S2GA 1CVNA 1YLLA 1X36A 1GV9A 4AQSA 3B94A 2W94A 4DB5A 3KQ4B 4AHXA 4B3NA 2WS93 1GOHA 2BOJA 1NY71 2VMCA 1UU6A 1R64A 4N7UA 3VBFB 1XYOA 1MQTC 2WLQA 3THCA 4LIVA 5IVBA 3JQWA 3ITQA 5G05L 5KHKA 4META 3POIA 1SFNA 1W6MB 3ZXAC 1N1TA 2OQ7A 5ACA3 4XAAA 5F39A 2VW1A 4IL7A 5GZDA 2B42B 1AUYA 4HSJA 1NG0A 2WNUA 4M4PA 3B9IA 1S0JA 1S2BA 3O7OA 1O3SA 5KXDA 1IS6A 1NA1A 2EIDA 1MS8A 3MUZ1 4NAMA 4EN0A 2ZHLA 5AFBA 1LGNA 3AX4A 4LPLA 1EAH3 1RMU2 3TNPB 2HEYF 5BNQA 2R1DA 4IE4A 1HJGA 4X6QB 3ME2A 4KWUA 1XJAA 4YM3A 2NP0A 1R083 4JTNA 1AR82 1EPWA 3M70A 4XDPA 3VB9A 4GULA 2WA3A 4JGYC 4H7LA 1I6XA 2I2SA 1ULOA 5KXCA 5A3LA 2ZGTA 1COV2 5A7QA 4LBLA 3LB9A 1Q8VA 1PK6A 3RI8A 3WUDA 1VBA2 1XBFA 1LU1A 2ARAA 4M0NA 3OUJA 2DUQA 4NUBA 4YYOA 2V4AA 4PIYA 4Q0QA 2B7YA 1JODA 1E57A 5IT6A 2CY6A 1PK6B 1GQPA 5I0TA 4CXWA 1UYXA 1AXKA 4QKBA 1YJLA 2XQXA 4JKKA 2I45A 4NIHA 4HVQA 3WP6A 2VU9A 2JB4A 2D40A 4Y24A 5F9TA 2RVAA 5A1LA 3O1RA 1RUD3 4G9SB 4OUSA 1QNWA 4GMP3 5JOYA 4A6SA 4OI1A 4ZXKA 5LA1A 4MXWA 5B2GB 2PXJA 5BNOB 1CAWB 5FDBA 4M0HA 3ZDSA 1BXHA 4K8FA 3WHTA 1QOSA 4RHV1 2EXJA 1G9CA 2BU9A 2SLIA 4AFBA 2Y60A 2ENRA 1ZRIA 1JYWA 1KITA 2WNVC 3U14A 3W21A 2HBUA 1FMD2 2J1EA 4PIZA 2FCVA 1VMFA 1Y3TA 2XG3A 3HEIA 5LY2A 1IQAA 3VKLA 2F17A 2G9ZA 4A45A 4XMAA 4AQTA 5A1AA 3WDYA 1WA6X 4EN9B 4UF0B 1S55A 4AEDA 1B35B 4OHXA 2GNTA 5CIRA 4XJ9A 4NIIA 1U0AA 5FCCA 5JXGA 4Q4X1 5K0UB 2J1VA 1W9FA 2FD8A 1JI6A 3N9PA 5FPAA 2D43A 5IVFA 2NMNA 2HWE3 5FZ9A 5IWFA 3O1OA 3AZZA 4NHMA 5FZMA 3ZYIB 2LALA 1CZSA 3E5QA 2FDJA 2R062 1UCXA 3KT7A 4MXVA 2VUDA 5DAXA 3GZUC 4XETA 3TAYA 2VOKA 5IVEA 2A6WA 3OD4A 4HK8A 3SH4A 2FCUA 3AFGA 2IXHA 2OA2A 2WNEA 4GKXA 3VD3A 5FREA 4Q4W3 5GLZA 4JGZA 1Z7S3 3RNSA 3USUB 1QEXA 4CUGA 2KD7A 2IFRA 3DYOA 5FY1A 1NA1C 1YXWA 3GDBA 2D3PA 3R4UA 2C9KA 1O4TA 3N7MA 3RZHA 3NV2A 2R1BA 2P6CA 2RS11 4AEDC 4YG0A 1BK1A 3A23A 2ZX4A 2WWJA 4QWNA 2FDGA 2LRPA 1GSLA 4ZU4A 2ARCA 2YC2A 2VXJA 2RS13 5T5LA 4FPCA 4QDRA 4LO5B 4LEJA 5FPXA 3FFZA 4V1PA 4QAWA 3WDTA 2XH6A 4L99A 3HT2A 2EXHA 3I2GA 3WLUA 4CDUC 1W2AX 5IAXA 3QD6A 4QGLA 2RJKA 2OZJA 2VQTA 5I0DA 1X33A 1ZRCA 1NX9A 1W9YA 4RL7A 1PO13 5DDJ2 2FHRA 3UKNA 4CVUA 2IUWA 2V73A 4ZHNA 1WA4A 5L7OA 1W6PA 1IQDC 1BEV2 4HFSA 4HZFA 4S2DA 2LROA 3R4SA 4GQ7A 3UETA 3UGHA 2WZPP 1BVVA 1MACA 1AL21 4UW5A 2JG9B 4AI3A 4DNYA 5C8WA 5CKQA 1OKQA 1JYVA 4MGTA 3ACIA 2RDRA 3P1IA 4TLFA 3PIJA 3WXPA 3POWA 4L9BA 4YW1A 1C57A 3RYPA 3KT1A 1S2EA 1M4WA 4GWIA 3WDUA 2VVFA 3H7YA 4FQZA 5IHRA 1V70A 1VJ2A 3V64A 5FP9A 1HDKA 1XNTA 3AJYA 4GH4A 4L8QA 3VV1A 1W03A 5A6XA 4RYDA 1BEV3 3I49A 4O7XA 2RS52 4E9KA 3HNYM 5LW9A 3KV9A 2DVDA 4YGDA 5BNPB 3P3PA 5FKBA 1OA2A 3ZN4A 2W1UA 1H6YA 1RUE3 5FMBA 4F8AA 4CCMA 4Q8LA 1YUDA 3VUOA 4BIOA 5HCAA 3AC0A 2ZEZA 1SDWA 2GN3A 4MGYE 2XUEA 4TZDA 3V0AA 4NIDA 4Y5SA 3KF3A 1WLDA 4PJYA 4XDQA 1C5IA 1UO9A 2AGSA 4GMP0 5JZGC 1AR72 3HWJA 3LDBA 4R9BA 1OD5A 4BQYA 5KXEA 3ZYJB 4XF3A 3VN4A 3WOGA 2ZEYA 4B7EA 1YRZA 1N1SA 4QX8A 1RUJ3 2JX9A 1XNAA 3Q9OA 4FPHA 2VMGA 1YJKA 4AF9A 4H3WA 3NJXA 2ARXA 5GALA 4LKFA 1LODA 5DQ0A 2ID4A 1VAKA 2OS2A 5A3NA 4IV1B 1KEXA 1LAJA 1LOEA 1YFXA 4OHWA 4M3CB 2JB8A 3J4UH 4IEZA 5C7GA 1ZM1A 1TME3 2VOWA 4O9EA 3OB8A 3HT1A 3JBG2 1UF2C 4Q4W1 1SBFA 2W08A 1SFPA 3IDEA 3NNGA 1W8UA 1ENRA 1OH4A 5F8PA 1I1EA 1OLQA 3LD8A 3SMHA 4WVMA 3NJVA 3OJBA 1X9TA 3ACLA 2BNOA 4H55A 5FO9B 2R042 1RUH1 1HQLA 3A4UA 2A6XA 4PLNA 5HV0A 5FZ1A 1C8M3 1NZIA 1QDCA 4Q27A 2EIEA 1O3QA 1RJ7A 3E6DA 2VJXA 5CYYA 1DYOA 4YW6A 1ODNA 1A8DA 4JRAA 1H4GA 4NVPA 1O7FA 4CP2A 2WR9A 2XWJB 3H1YA 2VBPA 1WWYA 4YVWB 3IPVB 1RUC2 4XTMA 1WLTA 1CGPA 5JI7A 4XF4A 1TVGA 3AKSA 5TSWA 5FYTA 3FUOA 3VDBA 3POBA 2ZA9A 3MIHA 1DCSA 2XQRA 3NAPA 3INAA 3ZN6A 1UXXX 3S6PA 2XBO1 4EN8B 3C7FA 2A5ZA 3JBG1 3OGGA 4RS5B 1XU2A 2PTMA 5T5PA 3WG4A 2IVJA 2W1WA 2F4PA 5FLJA 3NKGA 1AR83 2UY8A 3D3AA 4XUPA 4AHYA 4CU7A 1G6NA 1O8SA 2R071 5JXJA 5FYVA 1ZZ9A 4BMBA 5C3SA 3JUUA 4JQTA 5A6QA 5KBFA 1CONA 1UY4A 1GU3A 1RUNA 3ZYBA 5I0RA 1H6XA 2R6QA 2VQUA 3C7OA 3J7HA 4A3ZA 5FYMA 2P3KA 2PHTA 5FXWA 3VHOA 4PBOA 5LRRA 2XGXA 2DF7A 4LBKA 4NAOA 3GJAA 5AC91 3MICA 2XVGA 5F5IA 2RS51 4CEWA 4BWOA 2R7EB 4D3WA 4E2SA 5E1RA 1ASJ3 1GP6A 2W1SA 3E1F1 1PO22 3PU3A 1JXNA 3BU0A 1KD7A 4IE0A 2UWCA 4KG0A 4QX3A 4Q5OA 4M3CA 2Z5WA 2WNUC 2RS53 2ZS6B 1CD3G 1EV11 3HR9A 3IBMA 3J8F1 3K4ZA 1RMU3 3K48A 3SLIA 2VUJA 3UGGA 1LCLA 1A3KA 2GZWA 4NRPA 4I30A 1ACCA 1X9PA 2BZDA 1KJRA 4FPLA 4LHSA 4DUWA 5CVRA 1MS0A 5FYSA 2HWB2 2IFWA 5EFUA 4YPJA 3ZPOA 3S0MA 5BPXA 3SCGA 3RZLA 1WD4A 2A73B 1B35A 2D6PA 1NOVA 2OIIA 2ZTNA 3EYPA 3GCXA 4L2NA 4B29A 4E4ZA 1RB8G 4Q4V1 5H9PA 3RSJA 3FHIB 3QH7A 3WDWA 3ZMNA 2PHFA 1HB1A 4JKMA 3H1WA 4CEWC 3SH3A 1DGRA 1AVBA 2HWB3 3D82A 4XOGA 5KC5A 4AXOA 5E89A 1ZVFA 2B8MA 3EHKA 3I3EA 3KCXA 5IATA 2ETEA 4F83A 2CU5A 1OPMA 1TQ5A 4XF0A 4ATFA 5A3TA 4DXZA 1JZ8A 4ET7A 2DBIA 2O8OA 2P37A 1XE7A 4CPBA 1PVXA 2VMIA 5AFEA 4LO6B 1QGLA 4DFSA 4IE7A 4CPBD 3LKJA 5EJ1B 4DEQA 1EV12 1TE1B 3J8F2 5K8SA 4NWWA 4PF1A 5GKAC 3WUCA 2BNMA 4KGQA 4P9WA 3ZYPA 1AJKA 2KXLA 2PN5A 3M1HA 4IV1A 2BFUL 4BQXA 1MZ6A 3GHNA 3H8UA 5I91A 1CAVB 4XFBA 3AP9A 4BMEA 4P9YA 4BCUA 5JCTA 1GICA 5LBEA 2DU1A 4CDQB 2JD9A 2VOTA 3H0OA 1PGW1 2TUNA 5EYXA 5FK7A 4AI0A 4CDQC 1JZ2A 3LE0A 3ZFGA 5IK7A 2VTXJ 3ILRA 3O1UA 4FO9A 2YBKA 4ZU5A 3OY8B 3PTRB 3MIBA 5IAVA 4D6RA 3RZKA 4JTOA 3QOPA 1VB2A 1W8ZA 1DQ2A 3VLBB 4D69A 4L0PA 1PNFA 1Q8SA 3CJIB 2V09A 1SEFA 1OUSA 1WD3A 2RJ2A 3ZMOA 3POEA 2R063 1L7RA 4IXLA 2I74A 3WVJA 2JEMA 2DCZA 1JS9A 1VALA 2ZZJA 4DQAA 4A41A 3NNFA 3WP3A 4XHXA 2VECA 2WNOA 5LBBA 4XUTA 4AHWA 1K3IA 2R061 1Q56A 3CMGA 4YW5A 1GANA 1GWMA 3AMHA 1O5UA 1OQ1A 2R073 3BIWE 4IDZA 4LITA 1VBE1 1UY3A 1Z78A 1ZRRA 4N53B 2KA3A 1W04A 4FTSA 5C4WC 2R0FA 3BODA 4N53C 3JQXA 4YG3A 3PMSA 3UJOA 1HB4A 3LEGA 4CUAA 3EB7A 3WNPA 4Y4RA 2ZABA 4EJRA 1Y9QA 1GFF2 3M3CA 4GAZA 1XNDA 3FHAA 1EP0A 3LQCA 4ZZ5A 1RUG1 3N9QA 5H9SA 2DDUA 3KS7A 1FAYA 4Y4YA 4KWKA 1GLHA 1JH5A 1GR3A 2HYKA 2DURA 4K3UA 5DMYA 5FZCA 1X50A 2VMDA 2D7FA 2VG9A 4OI4A 1RUF3 4AVTA 5I0UA 1DU3D 1KGYA 4FPFA 3N9MA 5IFTA 1CPNA 4CDXA 3ZIWA 5ANQA 1BCXA 3B02A 2PQQA 5C4WB 1W28A 4BB3A 4YW3A 2R49A 1LHOA 2X5IA 4QKFA 5ACA2 3LWCA 4D94A 3LF7A 3ZSKA 2WUHA 4HKOA 1QJY1 2VVDA 1RUF2 4DOUA 3POGA 4NHYA 4B4QA 3AZVA 4ZONA 3AZWA 4BK5A 3WF4A 1UPSA 5FOJB 5FR3A 5FRAA 5L9VA 1IHMA 1QXRA 1ULPA 2XVLA 3OY8A 3PJYA 2B46X 3NMBA 3QBQA 5F5AA 2BFUS 3KV4A 1XC6A 1GWLA 1DF0A 1Y4WA 4X8NA 4Y1ZA 5JZGA 5HV4A 5E16A 5B4XA 3KLSA 4WBBA 4CP1A 2VNGA 2ZBJA 3AYCA 4UFIA 4JGZB 4W6XA 1U5YA 3WW3A 1LENA 4HBNA 1LB2A 5IK8A 1VAMA 1VBA3 1YQ5A 4CU9A 4E4DX 2QNKA 1SCSA 4GH4B 5T5OA 5FOBB 3MW4A 4O9GA 4XCBA 4QB2A 2XL7A 1JUHA 4YZ1A 2I07B 4XMIA 5EPAA 3I3MA 3VKNA 5EZWA 2H6BA 1KXGA 1O59A 2VZQA 5A6ZA 4QPIC 2BWAA 3OCPA 4QPGA 2AENA 5L7OC 1W8OA 3IAQA 3RI9A 4I01A 2RV9A 2CWMA 1W6OB 2BJSA 2Y6JA 4A2UA 2XWBB 5FWJA 4QU1A 4A4AA 3ZOIA 1A8MA 3CQOA 4INDA 2XL9A 3SNMA 2W47A 4I0AA 4IGPA 1LR5A 1G9BA 1AXZA 3W58A 2HWF1 3B5LB 3PUIA 1H1AA 1SBDA 1HRI3 4FAGA 4RS5A 1V9U1 3VZLA 3H3UA 5JLVA 5FZKA 3RZMA 4GH4C 5C6CA 4ATEA 2CTVA 3Q8BA 5IK4A 4WM8B 5A3UA 2NLRA 4GWJA 2W92A 1PGL2 5FK8A 1UQXA 1W90A 3AZYA 3K3NA 5BNNA 2ZXQA 1YI7A 3MLLA 3NNJA 4PLMA 5CU1A 2WRAA 4L92A 5HBAA 1ND2A 1O3TA 1CR7A 1FOD1 4U2AA 4DIQA 4KBBA 3S7IA 1QQP3 1UOFA 4FPKA 4OFGA 5DN2A 5HI0A 1KJLA 1RYYA 1KDKA 5L36A 4CCKA 2WDBA 1C1LA 3VD7A 5JXIA 1JZ5A 4ZY9A 5A7PA 5C8CB 1YIPA 1GZCA 1QQP1 2W52A 2HKXA 2VM9A 2XLFA 3ZYFA 3KSCA 2CAUA 3AP4A 3POYA 5C3RA 2YG0A 2ADDA 4IESA 1V6LA 4A42A 1VRH2 1J3QA 1W99A 2ZMNA 3TBDA 2PQSA 4OHVA 1QDOA 4LUKA 1LOCA 1UIKA 1E5IA 4UBHA 1NQDA 2PHUA 1TME2 5I8TA 2XONA 4W4ZA 4N9IA 4UWDA 1V6IA 2ZAHA 1U12A 4RQPB 3THDA 4E2QA 3BB6A 3VBOA 5LWBA 5FY0A 2YPJA 2VZ1A 2VC9A 2CNAA 3WINE 4OZOA 2EVXA 2RMU1 3AMMA 1PO23 5JXHA 3FLRA 5A7NA 4YM1A 1AL0G 3BYWA 2DCTA 2BEOA 3M2MA 4DXTA 2PLV2 2GH8A 3AMNA 5D8AA 2ZX2A 1WUVA 4E2GA 1YFUA 1J84A 2VCMA 2E9QA 5DXDA 4CDWA 4FPYA 5A80A 4EWEA 4Y20A 1PHMA 3FBMA 2VOXA 1OA3A 2V5DA 5SV8A 2Y34A 2YC4A 3OBZA 1RUH3 2MPFA 3DGTA 3T0AA 4BQ1A 3R0RA 2VZOA 5I0SA 3H3ZA 2P5BA 2QTWB 5FO7B 2A75A 3MYXA 5A33A 3VZKA 4CDXB 3MIDA 1R1A1 1M06G 1MQTB 2QVSB 3QLQA 3UKTA 1RC6A 2PHXA 5K7PA 4Y5Z0 3VKOA 4XE9A 1G9FA 4LT5A 3FC0A 2W68A 1GMMA 4XXPA 4I02A 3WNMA 4BYYA 5BNOC 2GC3A 1D2SA 2HWC2 3E6CC 2ORXA 3D6EA 5DDJ1 3MO4A 3JZVA 3M4FA 3OEAA 4IGOA 3N9LA 3GZAA 1RUI2 5LY1A 5FZBA 3T08A 1XSRA 2SBAA 1NLRA 3GM8A 2P3YA 3OYWB 4YZ2A 4XJUA 4BLJA 5KWRA 3OTFA 5LA0A 3HNMA 1XU1A 2D3SA 5BNNC 2A1XA 4FAHA 1OLME 2EIGA 4FQ4A 4AR2A 4D7SA 1P8JA 2V4VA 3B69A 3GJBA 4ZPIA 1KQRA 3N36A 4XPVA 2BQPA 3WDVA 4R52A 5L7OB 1I5ZA 4YFWA 4HETA 3WNLA 3NNLA 3VL9A 4LOTA 5FIXA 3FLTA 3M3QA 5D1IA 4FP2A 4QD2A 4QKDA 5F2SA 1ZREA 5FUIA 4UF0A 4AEDB 2AEZA 1QJY3 3MIEA 4KMQA 4QKNA 5IW0A 1PX4A 1ZBE2 2Y0IA 2XJVA 3KMHA 4A3XA 1IPJA 3VL8A 4WVVA 1W3XA 2D93A 1W6MA 3WW1A 4S2FA 1AXYA 1E5RA 2OPWA 3GXUA 4CRQA 1IPKA 1V9U3 1DQ6A 3DPRA 1YQCA 2NPIA 1EV13 2BERA 3J8F3 3VDDB 5C9AC 3KGZA 4IGQA 4Q2FA 5HXVA 2FDFA 4NN0A 4QXCA 1V0AA 1R093 5D21A 3FE5A 1US2A 1W6OA 3SITA 3TN92 1PVC3 4P5HA 4ZXEA 1GP4A 4FOVA 4QX5A 5FBJA 1W3VA 3SISA 3U4XA 3CL1A 2Q8OA 1DQ5A 1N3OA 3UESA 2VVEA 1ZBA1 1ZNPA 4C90A 2A7AA 4Y1XA 4B4PA 3RVHA 3GALA 3L2HA 1OQDA 4KBZA 1W0OA 4YLZA 5JWPA 1JOPA 4QXKA 4RGGA 4WVWA 5JR7B 5HPOA 5JPNB 3VD9A 1UU4A 2WNVA 1V00A 3RS6A 1MQTA 3WQ1A 1YO8A 2JD4A 2DUPA 3Q8FA 3ZXEA 4A7YA 5J1XA 4IERA 3O0WA 3S7EA 3LEMA 4Y22B 4UOJA 2O14A 4NROA 4RHV2 2Q8CA 4L11A 3MEPA 5HCFA 2K2SA 3K4AA 3ZM8A 2W9XA 3ZVXA 2C24A 4GWMA 4UFJA 2XHKA 3D0JA 4CTEA 1GZTA 3BALA 5JOXA 1RHI1 5J48A 2UYBA 1TNFA 5DPNA 1SLIA 2ZGRA 1EUUA 4AFDA 1W6PB 3O1VA 3KB5A 3KCCA 3IIIA 1J3RA 5DAQA 3ZN5A 1R092 4LBQB 1RIRA 5DUXA 3VBRB 4ES9A 3S5QA 4N43B 3GZTB 2IXLA 4Q4W2 4AEJA 5LCWL 3RYKA 1RUC3 3OPTA 2KR2A 1ULEA 2YFUA 3LA3A 1VBB1 1NA1B 2ZAAA 1QJEA 3VZJA 4YVSC 1OVSA 2AACA 5F2WA 1Y9MA 4B1LA 4FXGB 1NE4A 4MLOA 1KS5A 1HQWA 2VBBA 1W06A 1L3JA 5LK5A 2VY0A 1IS4A 3AYEA 3BN6A 4IEYA 1I3HA 1O6UA 2CV6A 4OHYA 4I0WB 4Q4Y2 1MS4A 2E53A 2ZACA 4NOTA 1BMV1 4YZ4A 3SXWA 5D8AC 2H6CA 4XQDA 2BRTA 3AYDA 4K1YA 2PYTA 3I2DA 3HN1A 4Q1PA 3WP4A 1BJQA 3AZXA 3WNOA 1UY1A 4FCAA 1BBT2 2XJPA 1K42A 4NPLA 3RZGA 4Q0SA 3OSDA 4LULA 2ZX1A 4WM7A 4UT5A 1Y43B 2YBSA 2NZ9A 2VPVA 3JB4C 3PURA 4RN5A 4AFMA 2E32A 5A3MA 1QJFA 2OUHA 4OMCA 4AQ2A 2QUOA 2YMZA 3B01A 3CIHA 1UOJA 4IEXA 3VBSA 1ASJ1 2K9ZA 4XEZA 3P6BA 3UKVA 4RGAA 5A70A 3UT0A 1OBNA 4XJWA 2ES3A 2Y0OA 2ZGUA 5LA9A 4ISQA 1ODMA 2HYXA 4GKYA 2BW8A 2Y33A 2C4XA 1XYNA 3O5SA 5L73A 1TMF1 2CYFA 1LECA 3TEZA 3OEBA 5DAPA 5EJZB 3DUIA 2JG8C 3H8XA 5FPVA 2Q1FA 4KU7A 4YM2A 1AF9A 4RA0A 2ZGSA 4YVSB 3LPGA 4UXAA 4Y3OA 5EV7A 4CCNA 3UNPA 3W5MA 3NJYA 4LHNA 2OZ6A 4RQPC 3S57A 2E63A 3G7DA 2ORZA 2XOMA 4PDWB 4SBVA 3RMXA 3WX5A 1HRV2 1VBD2 3K77A 5FY8A 4I2OA 2WA4A 4WVMB 1GZWA 1MEC2 2V5YA 4CSWA 1WLWA 3VHRA 3TN93 1HJFA 2OT7A 1GUIA 2X09A 2OYZA 2B9VA 2JDKA 3AXEA 5A7WB 1TMF2 3IZOA 5FZAA 2XB6C 3VDCA 1DQ4A 1LGCA 3CKHA 5FZFA 1W8FA 1EUTA 2WYSA 3GHMA 5F3GA 2E33A 2ZMLA 5A6YA 5JIUA 2GC0A 2QQKA 5IVVA 3C2UA 1TZOA
chains in the Genus database with same CATH topology
3MDPA 3HD8B 3T1MA 1HX6A 3KT4A 3VZMA 4WM8C 2GC1A 4YG6A 1LTEA 1C28A 1RUD2 3ASIA 4IV3C 2QQPA 3RDIA 3ZFEB 2ZHMA 4XBLA 4XXAA 1ZZCA 2JJ6A 3RMYA 4HMZA 4QQLA 4LO8A 1CX4A 1ULGA 4XFAA 2VOVA 5C8CC 4WM7C 1CJPA 3MF6A 3WR0A 4R9DA 1O91A 5CFDB 1DGRN 3WP5A 4Q0VA 2EA7A 5J37A 4COZA 1WW7A 3MW2A 4AGGA 1Y7BA 1Q5OA 1LHUA 3GBGA 4DRRA 4CDQA 4NPRA 1LOFA 4AI2A 1FNYA 4RR3C 1HRI1 3VBOC 4JAAA 1S0FA 1C5HA 2MNGA 4FOQA 4M3CF 3V56A 3EQEA 4MXWB 4J1WA 1LJ7A 2ZHNA 2RHPA 3PVOA 1U5ZA 3FX3A 1MZEA 3WG1A 2D6KA 5KC6A 5LK7B 1FMD1 2JG8B 3MIGA 1X8EA 4BE3A 3VBHC 1RHI3 3AKPA 5J7MA 1D4M2 1R1ZA 5LEKA 2C5DA 1A6CA 1UPIA 2RM23 2BPA2 2PA7A 1O4ZA 3M7AA 1YI9A 3IN9A 3OBTA 3WW2A 4FPEA 1F5FA 1LULA 3R6SA 4ORFA 1POV0 2CGNA 2DCYA 4N53A 1KRIA 5JDBA 2CGPA 5L19A 1RUG2 1UX6A 2ZPXA 1AR61 2MEV1 1H2MA 1YYNA 3JCIA 5J36A 4BZ4A 4I3PA 2ZGPA 3WZ1A 4IEPA 3VBSB 1VBC2 1UD1A 4WM8A 2JKBA 3ES1A 2FZ2A 4YZ5A 1BKZA 4AQ6A 5BXXA 3WT3A 2DCJA 2PHLA 2WT2A 5E8AA 1NCRA 4PBPA 1S0EA 3VZNA 1Q8QA 3VHNA 1XE8A 5AC93 5ACA1 3ILFA 4QPGC 3LA2A 1DDLA 1AR81 5ABJC 5ABJB 1NCRC 1WMFA 3DL3A 4Z1VA 5C8CA 4YNIA 1K5MA 1W6NB 3VBFA 2D6LX 1HRI2 1QJU2 5C9AA 4MV2A 3KCYA 3O0XA 1RUE1 1QJX1 2ET7A 4LBNA 4KU8A 1BZWA 1NCQC 1S0BA 4RQPA 3VBSC 4NWVA 4X6RB 2MEV2 1AR62 2WFF3 4MUVA 3ZFGC 1HQNA 3VBUB 4OHZA 1AYN2 3VBRA 5BNPC 2RR12 1BYHA 4HANA 4W6YA 2VW2A 2UY9A 4IV1C 4Y20B 1JOJA 1PZ8A 2WFF2 4COVA 4WV8A 3OGJA 3NKTA 2GN7A 3E5UA 4TSVA 1F8VA 4N9HA 1ENQA 4H7MA 4LO7A 1AJOA 1AL22 1C8M2 2P17A 4P14A 1QJZA 1JUIA 1XXNA 2PLV3 3VBHA 2GMEA 3A0KA 4CZSA 4Z07A 2R16A 4HSLA 4SLIA 4UW4A 4G3YC 3SCFA 2HWC1 1Z7S2 4BH9A 3V0BA 3LAGA 3OYWA 4AYUA 2VMHA 3VHPA 2GH2A 1RITA 3PHMA 2E7AA 1R1A2 5IK5A 1VRH3 1QNYA 3V0BB 2HWB1 3KD4A 1XQNA 5JVVA 4P9XA 2BNNA 2W0XA 2ZGMA 3QCWA 3FWEA 4HKWA 4CEWB 3AXDA 1PM7A 1NQJA 1MZ5A 3VBUC 2YHJA 1AR71 1GZWB 1DYKA 1UN1A 1QKQA 4IV3A 2WNUB 1RUD1 3QH6A 2HEWF 1D4M1 2C1FA 2RR11 4H14A 1H2NA 2YC0A 4AHZA 3VDDA 4PDWA 1AHSA 1MR5A 1OSGA 1RUI3 3EBRA 4XFIA 4KQ7A 1SFYA 5FPZA 4BIFA 2FMDA 2D5FA 4LHLA 2WQ4A 1COV3 3NV3A 3U0ZA 3PTYA 2EXIA 3LOBA 3TB0A 3ZYGA 1VBB2 1C4RA 1H1IA 1SACA 1W0PA 3IPVA 2IXIA 3ES4A 5EXOA 2X29A 1AR63 2MEV3 4Y1YA 3O12A 1UMZA 1W2UA 4QPGB 1W6QB 4ITCA 4LHKA 3U10A 2XJUA 2GSYA 1GKBA 1BMV2 2N7GA 4LE3A 1OQEA 2ZX3A 5A32B 2WNVB 5T52A 3NV1A 2W39A 1PO11 1RINA 5GLWA 2BWCA 1N3PA 3E6BA 1GQGA 2ZKNA 4CDWC 1HLCA 3TWIA 1TEIA 4FTBA 1GNZA 5H9QA 1ENSA 2WFF1 1WW4A 1GZ9A 1O5LA 1Q43A 4DS0A 1RJ8A 2JICA 3N7KA 2Z42A 2Y38A 3M8LA 3PLQA 3ZO0B 1AYN1 1DHKB 1N47A 4CEYA 1ND3B 4AVAA 3U11A 4YSFA 4JRLA 4JDMA 1QXJA 2R32A 1CAXA 4KWJA 2ZGQA 1JTZX 1SMVA 1IS3A 2PHRA 4AEMA 1LESA 2R0HA 4XFHA 3WY6A 4IV3B 4RR3B 1VB4A 2XJQA 3ZXDA 1OPOA 4LA3A 4AGVA 4CDUA 1DBNA 5K9YA 1BVP1 3OF1A 3VBOB 4BA6A 4MGZE 3ZIXA 2BVVA 3ROUA 1BQPA 2ARBA 3OPZA 2ZMKA 3UK9A 1H4HA 1KS4A 2ILMA 1QF3A 4JGYA 1G7YA 5DUWA 3USUA 4D7YA 4F3JA 4LNVA 2A3XA 4OVEA 4WM7B 3GBFA 4JDNA 1YFWA 3V65A 4D7TA 3E5XA 1UW8A 3TN91 1UIJA 4XJZA 2PHWA 4YM0A 2XKPA 3K51A 3AJZA 2C9AA 4LLFA 2PAKA 2PAMA 3D0SA 2BYVE 2D3RA 1F31A 2GDFA 2H0BA 1LOFC 4XQWA 1F2NA 2BTVC 1K5MC 5CNAA 3AKRA 4WVZA 1DIWA 5T5JA 2D5HA 4R9AA 2HWF3 1PZ9A 4KL1A 1LHNA 3ALQA 5C33A 4LTAA 1GNHA 2VNRA 2AYHA 4Y1UA 3R4DB 3B7MA 4QPYA 1APNA 1ENXA 1NE6A 5CG8A 3CF6E 3VKFC 2ZGNA 5FLHA 4DY5A 3T2TA 4G4FA 1SCRA 5BNOA 2C0ZA 1WBFA 2HWE1 1UAIA 1RUJ2 2EF6A 2TEPA 3HAGA 2G4IA 3SHRA 4YRDA 4DY3A 2JG9C 4LR4A 5GM0A 5JZGB 1LGBA 5IUQA 1V9U2 5I93A 3EO6A 4Z92B 1VBC1 4EWDA 1AR91 1WCDJ 1HRV1 1VBD1 4AGRA 5LRSA 5FMOS 1AYM3 3APBA 1X7NA 4KH9A 2YGLA 4CDUB 1BBT3 3IDBB 2B5HA 1PNGA 2GNBA 1YNAA 3TOJA 4E27A 3R05A 1RVF1 3AKQA 4XQ4A 2NM1A 5FBZA 1CJDA 5K0UC 2EAAA 1VAVA 4M3CE 5CA6A 4P9GA 3ZN6B 1RUOA 2D97A 2EXKA 3TYJA 1UZZA 2DCKA 1ULDA 3MLKA 4FOWA 1QOTA 4QQOA 1SQ4A 4CDWB 1YCIA 4FVVA 1LHWA 2DU0A 1QH7A 1XNKA 4IEVA 4KWLA 2HJIA 1QJU3 3EJKA 1CIWA 2XKOA 4HN0A 4ES8A 1FNZA 2CL2A 4S2HA 5FQ0A 2B45X 4XFCA 1OMIA 2X5IB 4HT1T 3B3QE 1AL23 1QJU1 3ZSLA 4AK3A 1FPN3 1J1TA 4XF1A 2UURA 4IQPA 4ZKTB 1J58A 2ZGKA 5JAXA 4J6GA 1TNRA 2UWBA 2WS91 4MGKE 3ZFFA 5DZEA 1UZYA 5CFCA 3BPZA 1ZBE1 3ZSJA 2JECA 4QQHA 4BPZA 1R081 2A70A 4JGYB 5T3NA 3NL1A 3AMQA 1VIWB 2CAVA 4K1ZA 4K40A 1H8TB 2WZR1 1CAUB 1HXS2 4XTPA 2D6NA 2DTYA 2D6MA 4JCKA 3ZXJA 1RHI2 1O3RA 4BM8A 4WZFA 2XJRA 3RWNA 5CFDC 2XJSA 4HVRA 1RL3A 2DUOA 4AFAA 1H9WA 1D0HA 1NYWA 4HPKB 4K9SA 5FO8B 1FPN2 1MVEA 1QH6A 2KM2A 5KHGA 5GJ6A 2WS92 3ZFEC 3VBFC 4U36A 3MI8A 4XFFA 3IWZA 2YROA 2WINB 3HBZA 3AP5A 4LBQD 3IMNA 3NV4A 2BUKA 4ASMB 1OHFA 1YFYA 2ZGLA 2Q1MA 1RUH2 3DV8A 4PF5A 4DINB 2GNMA 2DFCA 1PVC1 1REFA 1V6MA 2DYCA 4PLOA 2BVBA 3FBYA 2HEVF 3NAPC 4CDXC 2Z69A 1RVF3 1V6JA 1SBEA 3AYAA 2A3YA 4IETA 4B7KA 1ZBA3 1VBB3 1CAXB 3IDCB 2LTNA 2RM22 5BV6A 2QCSB 2VNOA 3EXUA 3SCHA 3ZPYA 4CP0A 2ZHKA 2RMU3 2ATFA 4FT8A 2RS31 4GMP1 5F6LB 1H2LA 4I09A 1PZ7A 1ULFA 2EALA 4BLIA 3N3HA 4OUMA 2DVFA 5DZGA 1H8TA 1FV2A 1H30A 2X5IC 3V0AB 4NR1A 4Q8KA 1HRV3 1VBD3 4LUMA 2QDRA 3MPBA 1MEC3 1AYN3 1J1LA 1KFXL 4JVAA 3G6JB 4X8PA 1Z7S1 5DZFA 1DFQA 4MSVA 5A32A 4TYSA 1G9DA 3RRDA 1MEC1 4KG8A 1IKPA 1DZRA 4OI2A 2RM21 2OW4A 1C8M1 2G9GA 1Q3EA 5AVAA 2Z2SB 2D98A 1J59A 3FJSA 2WQZC 3O0VA 4RFT0 1HW5A 2GAUA 4Y22A 1H2KA 2GALA 2PHDA 1LRHA 1REDA 3MFAA 4QGNA 2VQ0A 4Z2WA 3U07A 3ST7A 4XILA 2P34A 3IT8A 4P9JA 4XBQA 3NW4A 2IZWA 3AFKA 3FMGA 2JE7A 2OVUA 1SLBA 4XJAA 2NYYA 3RQ0A 3JU9A 2UYAA 1LKNA 3MW3A 2YDEA 1MS1A 1LOBA 2R072 4P9LA 1FX5A 3C3VA 4KGGA 4A7ZA 2H0VA 1NCQA 5FTTC 2QZ3A 5SV5A 4EN6B 2TBVA 5JOWA 2AR6A 3QACA 1PIV3 1DQ1A 4AG4A 4M00A 2YYOA 2DFBA 4LA2A 4M01A 5T50A 1PGSA 1BEV1 1WCSA 3ZXKA 4Q4Y1 2WZR2 4AE2A 4K6BA 2ZKLA 1PIV1 2Q30A 2VULA 3IKWA 2YGMA 1C1FA 4I3GA 1D0GA 1ULCA 1YHFA 2RS12 4QU2A 1MS5A 1FOD3 2YY1A 2PFWA 1DGWX 5J96B 2Q1ZB 1FT9A 3FFQA 4ONUA 1GBGA 1PO12 2WLPA 3POSA 1LOGA 4AWDA 1ZZBA 2R30A 1TME1 4HVOA 4E4SA 4JGZC 4W65A 5FQ0B 1QJX2 4OLLA 1WCKA 1D4M3 4URTA 1DGLA 5EYYA 1S0CA 1N1YA 4AVBA 5GZEA 1CQ9A 1XYPA 4YW4A 4IEOA 3ZFGB 4DZGA 3DKWA 4GXLA 3GF6A 4P9IA 4XJ8A 1H1MA 1FXZA 1RUC1 1X8MA 3NWKA 4HK9A 4MH0E 3VBUA 4Q29A 2VXRA 2ZCWA 2WT0A 2IXCA 1G9AA 2JENA 3RYRA 4IEWA 4MX3A 5DG1A 5KHIA 1DGWA 4JQRA 1HV0A 5DG2A 5GLVA 2Q5TA 2WWSA 1QJY2 4XHBA 1AZDA 4GB33 4OULA 2XVKA 3ZSMA 1MZFA 1TMF3 1HXS1 1ZX5A 1QMJA 2E6VA 1ZRDA 1F9KA 3BTAA 2RR13 3PJQA 3X29B 1SLLA 2VUAA 1AR92 1R082 1AYM1 1XNBA 5JI9A 1PO21 1QWRA 3WHUA 5JIAA 3AP7A 5GZFA 1S1AA 1S2KA 2DVBA 1IKQA 3P3NA 5CFCC 4XFGA 2FBEA 1OOPB 2P3JA 3M3EA 4AEKA 4YGCA 3UL2A 4MVTA 1T6GC 3ZFFC 3I4IA 3JD72 2BBVA 3PVBB 3OBRA 4UW6A 1LEDA 3N7LA 2X8KA 2GNDA 1ZA4A 5F6KA 4AFCA 1CAWA 3CNAA 1F5JA 1VBE2 2DVAA 1SLTA 2A6ZA 3WDXA 2XBO3 4NO4A 2IC1A 1W6NA 3W9AA 2HWF2 4QPIA 4AI8A 2JG8A 1QXPA 3CJIC 1GYKA 5E88A 2IXJA 1AX2A 1RMU1 4LO4B 2FMYA 1LEMA 5FFOC 4QPIB 3I59A 3KM5A 2E7QA 2VW0A 5I8YA 1RVF2 4AVCA 4DMIA 5CADA 3THPA 4COWA 4DPNA 1VLNA 5JSRA 4Q4V3 3TNQA 1WGPA 3DPRC 3D5OA 3RZZA 4GALA 3UJQA 1N3QA 4YVWA 4GA9A 4C1WA 1V6KA 1POV3 5GLUA 1OLRA 2QE3A 4ISRA 1HV1A 4BHPA 3LGRA 1ZZ6A 2A3WA 3L2YA 2XPJA 2QZ2A 1RUJ1 4Q4Y3 1RUE2 4IEUA 4Q4V2 2FQPA 1EY2A 4B4RA 1JYCA 4GIQA 2RJLA 4R4ZA 2QDNA 3B93A 1S0DA 5KXBA 2P2KA 4XYXA 4AW7A 4CEYB 3CO2A 1U5XA 1MS9A 2YXSA 2PAEA 2RS32 4QM8A 3N7JA 5T54A 5GLTA 1CAVA 1S0GA 3NJZA 3VDDC 5C9AB 5CFCB 4YFZA 1REEA 1ZRFA 2K0GA 3SH5A 1CN1A 1NCQB 2LM3A 1KDMA 5AVPA 1IS5A 5AC92 1EPZA 1Z0HA 1QY4A 5EWSA 4RR3A 2JG9A 1ASJ2 4EWAA 3CLPA 4RHV3 5CB7A 3VZOA 1YWKA 2CGOA 3DPRB 2AH2A 1JN2P 1PVC2 2E51A 2ERFA 2VH9A 1ND3C 3ATGA 3BU7A 3WG3A 3USSA 3KQRA 2E7TA 3PNAA 4OI0A 2XLAA 4MGIE 1ND2C 4YGEA 2AREA 3O14A 1IOAA 2XLGA 2WKKA 3AB0A 3UV9A 3WV6A 1Q8OA 4K21A 1H8VA 2QKDA 1RGSA 4PIXA 3AK0A 2UU8A 3PMEA 4FSJA 1FPN1 3ZSEA 1W6QA 2WIIB 3THTA 2DV9A 4OZXA 1XRUA 1YIFA 4Q0UA 1N1VA 4ASLA 3MLJA 4LBOA 1ND2B 2XBO2 5ABJA 1D4VB 1O4YA 1DZTA 1VBE3 2A71A 4FOYA 4YVWC 3ZXFA 5BUVA 4PQ9A 1UL9A 2ZOEB 3M3IA 4A7KA 3MFCA 1FI2A 4UW3A 1ZBE3 1VR3A 3CEWA 1OI6A 4QQ2A 1DG6A 2IXKA 4KNCA 4YZ3A 2JDZA 2R043 4LBQA 1VP6A 4YARA 3BOWA 3JD73 3URFA 2DTWA 4N43A 5FLIA 5JOZA 1X82A 4XF9A 2ZX0A 1K5MB 2Z79A 1JBCA 3AMPA 4C0BA 2VGDA 3ENRA 2WSUA 3CJIA 3FUQA 5BY5A 1J3PA 1FV3A 1QJX3 2QFEA 2GC2A 4YW2A 5CG9A 2DVGA 4JV4A 4W6WA 2JE9A 2AUYA 4DRVA 1CAUA 4IEQA 5KHHA 5GZGA 1H0BA 1AX1A 3AP6A 5BNPA 2XUMA 1VBA1 1C3HA 4L97A 5F5QA 3FZ3A 2NN8A 4XIKA 1D2QA 3HIFA 5HCBA 2PELA 4CEYC 1DYPA 3ELNA 4RD7A 2PLV1 3VBHB 3WD5A 1NXD1 1QU0A 1C8NA 3FLPA 2B39A 2MHFA 2A6VA 2GU9A 1UKGA 2O0OA 3GNEA 3ZN5A 1JYIA 2HWC3 3NAPB 3DF0A 2ET1A 1MS3A 4COYA 4CYDA 1SLCA 3M3OA 3J9SA 1SLAA 3H7JA 1POV1 2O8QA 1VRH1 1JHNA 2WJSA 4MYEA 4QHBA 3B00A 4EROA 5J98B 2WSVA 4FPOB 5JPMB 4YVSA 1NCRB 4GWNA 4AI1A 3KZ4C 5LEJA 1CPMA 4PCRA 2TNFA 3WNXA 1AR73 3S30A 3H1MA 2RMU2 3VKMA 4R9CA 1A78A 2YV8A 5JSOA 5J09A 1G86A 2AZ5A 2B9UA 3LCPA 3N4MA 1OA4A 2RS33 4QM9A 3B9CA 4RS5C 4Q4X2 2VQAA 2HWE2 4PDWC 1RUG3 1HXS3 1BBT1 5J3UA 3D8CA 2QJVA 3N35A 5D8AB 1WMEA 2D44A 4F7ZA 1V6NA 4I0BA 4XZPA 1VBC3 1WLCA 3CJXA 2OPKA 5JMCA 4WZCA 3L9JT 4MZUA 3AKTA 1PGL1 3MPPG 4QGMA 1AX0A 5FAXA 1U5IA 5F1RA 3TRSB 4Q1RA 1ZYBA 3ECQA 1UU5A 4HPKA 5T55A 2HWD3 3WQ0A 1PMIA 1ZZ7A 2FZ1A 3NSTA 5EJ3A 1I9RA 4Y26A 3ZX7A 1IGOA 3MIFA 5CFDA 3VGIA 2WT1A 5C4WA 2DWRA 2HWD1 2P3IA 3RJRA 4N90A 4FBFA 1DZQA 1ONAA 2G9FA 3WW4A 1OOPA 4HN1A 1W39A 1UKRA 1MVQA 5DUUA 1ND3A 1NXMA 4LLOA 2D6OX 1RUF1 1WW5A 4XW3A 1CESA 1WMDA 4Y1VA 4AVSA 3JB8A 2F6BA 2GMPA 2NQYA 3A0NA 1G8WA 3PVNA 3WQ7A 4B8EA 3IIAA 1JW6A 4JC1A 1GQHA 4R4XA 1R1A3 1ZZ8A 4HL0A 1H9PA 2X53S 3ZYRA 1B09A 3MZHA 2WZR3 4C91A 2R041 3J26N 2LUWA 3ZXGA 4Z82A 2A6YA 2JXAA 5CAZA 1R091 2ZGOA 2YUEA 3IM0A 3I7DA 1FYUA 4HLTA 3RJ2X 3WCRA 2GMMA 4Z8BA 1NY72 4LBJA 4N7IA 3MGUA 3RPQA 5KC5A 2OUJA 2Q4SA 3DN7A 4HKLA 1S0IA 4ZU7A 3D4KA 5H9RA 1V6OA 3ZXLA 1AYM2 1QHDA 3E97A 3NVCA 1KFUL 4QMAA 3CU7A 4R8HA 4N43C 4FXKB 3VBRC 4AVVA 2IWGB 3GBWA 4XBNA 4COUA 4YGBA 5BNNB 5KHJA 3HQXA 3RG0A 1DLLA 1EAH1 3KGLA 1ZBA2 3LZZA 4C1XA 2Q0AA 3PVEA 1AR93 5CBLA 4Q0PA 3H9AA 2Y26A 1FMD3 1HIXA 1H8TC 3I8TA 4LBMA 3MF9A 2XJTA 2RE9A 3HMYA 1OFSA 3AM2A 1PGW2 1ALYA 1NZCA 1QOOA 3ZFFB 1IZ3A 1URXA 1OOPC 3I59B 3BOPA 1XNCA 2WL1A 1EYBA 1PK6C 2EAKA 2O1QA 4QQPA 2UWAA 3WCSA 1NLSA 2NMOA 5GZCA 4C0HA 3BCWA 4GB32 3GYDA 2ZJCA 1HKDA 4K7JA 2HWD2 3NO8A 5DUVA 1RTVA 3I54A 4Q4X3 2WC2A 3JBG3 3ILNA 1DQ0A 5K0UA 4NHKA 4UBGA 1LOAA 3ZFEA 5BYNA 2WFPA 1RUI1 5A33B 4NHLA 3LSEA 2BGCA 4FPGA 2ZZQA 1LHVA 1FATA 1WBLA 4J1XA 1B35C 3LOIA 3LSDA 1WW6A 1COV1 4FPJA 3WG2A 4EN7B 4FTEA 1PIV2 4TWTA 3T1LA 3W59A 4EV0A 1LU2A 1OFNA 1QQP2 2CWSA 3ETQA 1EAH2 4FP3A 4LE4A 4QT6A 5FMOL 3JD71 5I8SA 1Q8PA 4Q26A 4BOWA 3OD0A 3H50A 4RSUA 4K20A 5DDJ3 1FOD2 4GB31 2YZ4A 4JDOA 3LA7A 4XIOA 4S2GA 1CVNA 1YLLA 1X36A 1GV9A 4AQSA 3B94A 4DB5A 4AHXA 4B3NA 2WS93 1NY71 1UU6A 4N7UA 3VBFB 1XYOA 1MQTC 2WLQA 3JQWA 5KHKA 4META 3ZXAC 1SFNA 1W6MB 1N1TA 5ACA3 2VW1A 4IL7A 5GZDA 2B42B 1AUYA 4HSJA 1NG0A 2WNUA 3B9IA 1S0JA 1S2BA 3O7OA 1O3SA 5KXDA 1IS6A 1NA1A 1MS8A 4EN0A 2ZHLA 5AFBA 1LGNA 3AX4A 1EAH3 1RMU2 3TNPB 2HEYF 5BNQA 2R1DA 4X6QB 3ME2A 4YM3A 2NP0A 1R083 4JTNA 1AR82 1EPWA 3M70A 4GULA 2WA3A 4JGYC 4H7LA 1I6XA 2I2SA 5KXCA 5A3LA 2ZGTA 1COV2 4LBLA 3LB9A 1Q8VA 1PK6A 3RI8A 3WUDA 1VBA2 1LU1A 4M0NA 2DUQA 4YYOA 4PIYA 4Q0QA 2B7YA 1E57A 5IT6A 2CY6A 1PK6B 5I0TA 1AXKA 1YJLA 2I45A 4HVQA 3WP6A 2VU9A 2D40A 4Y24A 5F9TA 1RUD3 4G9SB 4OUSA 1QNWA 4GMP3 5JOYA 4OI1A 4ZXKA 4MXWA 5B2GB 5BNOB 5FDBA 1CAWB 4M0HA 3ZDSA 1BXHA 4K8FA 3WHTA 1QOSA 4RHV1 2EXJA 1G9CA 2SLIA 4AFBA 2ENRA 1KITA 2WNVC 1FMD2 4PIZA 1Y3TA 2XG3A 1IQAA 3VKLA 4XMAA 4AQTA 3WDYA 4EN9B 4AEDA 1S55A 1B35B 4OHXA 2GNTA 5CIRA 4XJ9A 1U0AA 5FCCA 5K0UB 4Q4X1 2D43A 2NMNA 2HWE3 3AZZA 4NHMA 3ZYIB 2LALA 3E5QA 3KT7A 4MXVA 2R062 1UCXA 3GZUC 4XETA 3TAYA 2VOKA 2A6WA 3OD4A 4HK8A 3SH4A 3AFGA 2IXHA 2OA2A 2WNEA 4GKXA 5FREA 4Q4W3 5GLZA 4JGZA 1Z7S3 3RNSA 3USUB 2IFRA 1NA1C 1YXWA 2D3PA 3R4UA 1O4TA 3N7MA 3NV2A 2R1BA 2RS11 4AEDC 4YG0A 1BK1A 2ZX4A 1GSLA 4ZU4A 2RS13 5T5LA 4FPCA 4LO5B 4LEJA 5FPXA 3FFZA 4V1PA 3WDTA 2XH6A 4L99A 3HT2A 2EXHA 4CDUC 3WLUA 3QD6A 4QGLA 2RJKA 2OZJA 1X33A 1ZRCA 5DDJ2 4RL7A 1PO13 3UKNA 2FHRA 2V73A 1WA4A 5L7OA 1W6PA 1BEV2 4HFSA 4HZFA 4S2DA 4GQ7A 3R4SA 2WZPP 1BVVA 1MACA 1AL21 4UW5A 2JG9B 4AI3A 4DNYA 1OKQA 4TLFA 3WXPA 3POWA 4L9BA 4YW1A 1C57A 3RYPA 3KT1A 1M4WA 3WDUA 2VVFA 3H7YA 4FQZA 1V70A 1VJ2A 3V64A 1HDKA 3AJYA 4GH4A 4L8QA 3VV1A 1BEV3 2RS52 4E9KA 4YGDA 2DVDA 5BNPB 3P3PA 1OA2A 3ZN4A 1RUE3 4F8AA 4Q8LA 1YUDA 3VUOA 4BIOA 5HCAA 1SDWA 2GN3A 4MGYE 4TZDA 3V0AA 1WLDA 4PJYA 4XDQA 1C5IA 2AGSA 4GMP0 5JZGC 1AR72 3HWJA 4R9BA 1OD5A 5KXEA 3ZYJB 4XF3A 3VN4A 3WOGA 4B7EA 1YRZA 1N1SA 1RUJ3 2JX9A 4FPHA 3Q9OA 2VMGA 1YJKA 4AF9A 4H3WA 2ARXA 5GALA 1LODA 1VAKA 4IV1B 1LOEA 1YFXA 4OHWA 4M3CB 3J4UH 4IEZA 1ZM1A 1TME3 2VOWA 4O9EA 3HT1A 3JBG2 1UF2C 4Q4W1 1SBFA 2W08A 3IDEA 1ENRA 1I1EA 1OLQA 3SMHA 4WVMA 3OJBA 3ACLA 2BNOA 4H55A 5FO9B 2R042 1RUH1 1HQLA 3A4UA 2A6XA 4PLNA 1C8M3 1QDCA 4Q27A 1O3QA 1RJ7A 3E6DA 1A8DA 4JRAA 1H4GA 4NVPA 1O7FA 4CP2A 2XWJB 3H1YA 4YVWB 3IPVB 1RUC2 4XTMA 1WLTA 1CGPA 5JI7A 4XF4A 3AKSA 5TSWA 3FUOA 2ZA9A 3MIHA 3NAPA 3INAA 3ZN6A 3S6PA 4EN8B 2XBO1 2A5ZA 3JBG1 3OGGA 4RS5B 1XU2A 2PTMA 5T5PA 3WG4A 2F4PA 5FLJA 3NKGA 1AR83 2UY8A 4AHYA 1G6NA 2R071 1ZZ9A 4BMBA 3JUUA 5KBFA 1CONA 1RUNA 5I0RA 2R6QA 2P3KA 2PHTA 3VHOA 4PBOA 5LRRA 2XGXA 2DF7A 4LBKA 5AC91 3MICA 2XVGA 4CEWA 2RS51 4E2SA 4BWOA 4D3WA 5E1RA 1ASJ3 1PO22 1JXNA 1KD7A 2UWCA 4KG0A 4M3CA 2Z5WA 2WNUC 2RS53 2ZS6B 1CD3G 1EV11 3HR9A 3IBMA 3J8F1 3K48A 1RMU3 3SLIA 2VUJA 1LCLA 1A3KA 2GZWA 4I30A 1KJRA 4FPLA 5CVRA 1MS0A 2HWB2 2IFWA 5EFUA 3S0MA 5BPXA 3SCGA 1WD4A 2A73B 1B35A 2D6PA 1NOVA 2OIIA 2ZTNA 4L2NA 4B29A 4E4ZA 1RB8G 4Q4V1 5H9PA 3RSJA 3FHIB 3QH7A 3WDWA 3ZMNA 2PHFA 4CEWC 3H1WA 3SH3A 1DGRA 1AVBA 2HWB3 3D82A 4XOGA 4AXOA 5E89A 1ZVFA 2B8MA 3EHKA 3KCXA 2ETEA 4F83A 1OPMA 1TQ5A 4XF0A 4ATFA 4DXZA 2O8OA 2P37A 1XE7A 1PVXA 2VMIA 5AFEA 4LO6B 1QGLA 4DFSA 3LKJA 1EV12 1TE1B 3J8F2 5K8SA 4NWWA 5GKAC 3WUCA 2BNMA 4KGQA 4P9WA 3ZYPA 1AJKA 2KXLA