2LMKA

Solution structure of mouse pheromone esp1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
GSNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocrine gland-secreting peptide 1
publication title Structure of the Mouse Sex Peptide Pheromone ESP1 Reveals a Molecular Basis for Specific Binding to the Class-C G-Protein-Coupled Vomeronasal Receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 4
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2011-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.60 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2lmkA00
2LMKA
chains in the Genus database with same CATH superfamily
2B39A 2KK2A 2NSWA 2ERLA 3KLSA 3KXRA 3CU7A 4E2KA 1DD9A 2JMSA 4EDGA 1ERCA 2AU3A 2KC6A 2NSVA 1EQNA 4EDKA 2LMKA 4EDRA 4EDVA 1DDEA 3B39A 4EDTA 4EE1A
chains in the Genus database with same CATH topology
2B39A 2KK2A 2NSWA 2ERLA 3KLSA 3KXRA 3CU7A 4E2KA 1DD9A 2JMSA 4EDGA 1ERCA 2AU3A 2KC6A 2NSVA 1EQNA 4EDKA 2LMKA 4EDRA 4EDVA 1DDEA 3B39A 4EDTA 4EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMK A; 
#chains in the Genus database with same CATH topology
 2B39 A;  2KK2 A;  2NSW A;  2ERL A;  3KLS A;  3KXR A;  3CU7 A;  4E2K A;  1DD9 A;  2JMS A;  4EDG A;  1ERC A;  2AU3 A;  2KC6 A;  2NSV A;  1EQN A;  4EDK A;  2LMK A;  4EDR A;  4EDV A;  1DDE A;  3B39 A;  4EDT A;  4EE1 A; 
#chains in the Genus database with same CATH homology
 2B39 A;  2KK2 A;  2NSW A;  2ERL A;  3KLS A;  3KXR A;  3CU7 A;  4E2K A;  1DD9 A;  2JMS A;  4EDG A;  1ERC A;  2AU3 A;  2KC6 A;  2NSV A;  1EQN A;  4EDK A;  2LMK A;  4EDR A;  4EDV A;  1DDE A;  3B39 A;  4EDT A;  4EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...