2LMLA

Solution nmr structure of holo acyl carrier protein from geobacter metallireducens refined with nh rdcs, northeast structural genomics consortium target gmr141
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of 4'-phosphopantetheine - GmACP3 from Geobacter metallireducens: a specialized acyl carrier protein with atypical structural features and a putative role in lipopolysaccharide biosynthesis.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Transport protein
molecule keywords Putative acyl carrier protein
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lmlA00
4NEOA 2KGEA 2KW2A 1T8KA 2FQ1A 3EJDA 3LMOA 2XZ0D 2FACA 5HVCA 4DG9A 2FVEA 2L22A 3GZLA 2KG8A 2KG6A 4BPFA 2K94A 2CG5B 2KGDA 2N5HA 3EJBA 5CZDB 3EJEA 2FVAA 2N6ZA 4H2XC 2MD9A 2LKIA 2LTEA 3CE7A 2K0YA 2XZ1C 1AF8A 2LPKA 4PXHB 2JGPA 2K0XA 4BPGA 2FAEA 2KWLA 2CQ8A 2LIWA 2FADA 2KORA 2KOQA 1HY8A 4H2WC 2N6YA 2K92A 3NY7B 4BPHA 2L9FA 2GDXA 2JU2A 2KGCA 4PWVB 4IZ6A 1HQBA 2MR8A 2LOLA 2EHTA 1ACPA 1L0HA 2L0QA 1VKUA 2M5RA 2FHSC 2K93A 2MR7A 2FQ2A 2L4BA 2MVUA 2VSQA 5KP8B 2AVAA 2CNRA 1DV5A 1DNYA 2MF4A 3RG2A 2JU1A 5HV8A 2GDWA 1NQ4A 2AF8A 2QNWA 4R0MA 2MY5A 4H2YC 2JQ4A 2KR5A 5EJDA 2N5IA 2GDYA 2EHSA 1OR5A 2LIUA 2KG9A 4HKGA 2KOOA 1L0IA 2LMLA 2MVVA 2CGQA 5KP7B 2LL8A 2ROQA 2N50A 2FVFA 4CA3A 2FQ0A 2AFDA 2DNWA 5KP6B 2N98A 2AFEA 2X2BA 1F80D 1X3OA 2KGAA 2K2QA 2KOPA 2PNGA 4MRTC 3GZMA 2KOSA 1KLPA
chains in the Genus database with same CATH superfamily
1M6NA 4NEOA 1VQ7P 2FQ1A 3CCLP 3LMOA 1Z6MA 1YJNP 2XZ0D 2FACA 4DG9A 2KG8A 2KG6A 3G0VA 2CG5B 2KGDA 3VRLC 2M8PA 5CZDB 2FVAA 2OTLP 3CE7A 2PENA 4PXHB 3DS2A 1VHNA 2JYLA 5BS1A 3HYBA 1KC8Q 1EIAA 1UJZA 2CQ8A 2KORA 1K30A 1VQLP 4BPHA 2PEKA 2OTJP 2VLNA 2JU2A 4PWVB 1YJ9P 1JJ2O 2E1MA 2MR8A 2LOLA 3CMEP 2BHVA 1GXHA 1L0HA 3CCJP 2L0QA 2GZFA 5I4TG 2BUOA 5JPAA 3CCSP 2MR7A 5HGLA 2P9XA 3M1MA 1YJWP 2JU1A 2M8LA 1NQ4A 3DS5A 2PY8A 1VQ8P 2VLQA 3U43A 1QVFO 4H2YC 1M90Q 5F2NA 4HKGA 3CCRP 2LMLA 2MVVA 3DS4A 2GZEA 3MGEA 1GPJA 2AFEA 1VQKP 2KGAA 2K2QA 2PNGA 1A43A 1T8KA 2KODA 1M1KQ 3H0DA 1IMQA 3NTEA 5HVCA 3GZLA 1KQSO 4BPFA 3CMAP 2PEIA 2N5HA 3EJBA 1VQ6P 3EJEA 7CEIA 2N6ZA 4H2XC 3CD6P 2MD9A 2LKIA 5F2OA 2XZ1C 3HZQA 4F37A 2K0XA 3CCVP 3DPHA 3Q20A 2FAEA 1K8AQ 4GR2A 5EW5E 2FADA 1HY8A 1YI2P 2DGYA 3G28A 3I56P 2L9FA 4PH1A 2JBGA 2KGCA 3G1GA 4IZ6A 4XFZA 4UHPB 2EHTA 4U0DA 3CCEP 2JB0A 2NO8A 1Q82Q 3DS3A 1VQPP 2JO0A 3DS1A 2L4BA 4XROA 3CCUP 2MVUA 3H47A 2M8NA 1BXIA 2MF4A 1IUQA 2AF8A 1Q7YQ 1E0HA 2LF4A 2XT1A 4U0CA 1VQ9P 2XV6A 5EJDA 2N5IA 1K9MQ 3G6EP 1OR5A 2JYGA 1AYIA 4U0FA 3CXCO 2FVFA 2N98A 2GZGA 1F80D 2XXMA 3RG6C 1S72P 2KOSA 2KW2A 3G71P 1RO2A 3DTJA 1M6EX 2OARA 2FVEA 4COPA 1MZ8A 2QEXP 1EOQA 2GZIA 3E2DA 2LTEA 2K0YA 1AF8A 2LPKA 1RO0A 2ERHA 2PEQA 1VQ5P 1YIJP 2KWLA 3CCQP 1K73Q 2LIWA 2KOQA 3B4QA 2EG5A 1QVGO 4H2WC 2K92A 3NY7B 1M74A 4U0EA 2PEOA 1HQBA 4XFYA 1VQOP 3CC4P 1VKUA 3I55P 1FR2A 1CEIA 2K93A 2PEJA 2JAZA 5KP8B 2AVAA 2CNRA 3RG2A 3GJNA 2GDWA 4PH0A 4R0MA 1NJIQ 1ZNVA 2MY5A 1E6JP 2VLPA 5HGOA 3G26A 2GDYA 4GR6A 4QNBA 4WYMA 1UNKA 2LIUA 2KG9A 1L0IA 2CGQA 2LL8A 2VLOA 2ROQA 2FQ0A 2AFDA 3B5IA 2X2BA 1IMPA 1X3OA 4MRTC 3WBHA 1VQMP 1ZMBA 2KGEA 4XRQA 2EIAA 3EJDA 3CCMP 1KD1Q 4IPYA 2Z46A 2L22A 2K94A 3H4EA 3G1IA 1AUMA 1N8RQ 3G29A 2JGPA 1EMVA 3CC2P 1GXGA 3P05A 5HGMA 4BPGA 2Z45A 2N6YA 1D1DA 2GYKA 2GDXA 3CPWO 1YITP 1BAJA 1Q81Q 2GZJA 1VQNP 1ACPA 2WPTA 2M5RA 5BS2A 2FHSC 3CC7P 5F2KA 2K5XA 2FQ2A 3DS0A 2VSQA 4U0AA 1DV5A 1DNYA 3GKLC 1YHQP 2PEMA 2L6EA 4M0IA 5HV8A 2QNWA 1W2BO 2EFJA 4XFXA 3G21A 1RNIA 3OW2O 1A8OA 2QA4P 2JQ4A 2KR5A 2CWOA 2EHSA 1Q86Q 1QRJA 2KOOA 5KP7B 2K0DX 2N50A 4CA3A 4COCA 5DCKA 3LRYA 2DNWA 1VQ4P 5KP6B 2Z44A 4U0BA 4QKOA 2KOPA 2ONTA 3GZMA 3G4SP 5HGNA 1KLPA
chains in the Genus database with same CATH topology
4NEOA 2KGEA 2KW2A 1T8KA 2FQ1A 3EJDA 3LMOA 2XZ0D 2FACA 5HVCA 4DG9A 2FVEA 2L22A 3GZLA 2KG8A 2KG6A 4BPFA 2K94A 2CG5B 2KGDA 2N5HA 3EJBA 5CZDB 3EJEA 2FVAA 2N6ZA 4H2XC 2MD9A 2LKIA 2LTEA 3CE7A 2K0YA 2XZ1C 1AF8A 2LPKA 4PXHB 2JGPA 2K0XA 4BPGA 2FAEA 2KWLA 2CQ8A 2LIWA 2FADA 2KORA 2KOQA 1HY8A 4H2WC 2N6YA 2K92A 3NY7B 4BPHA 2L9FA 2GDXA 2JU2A 2KGCA 4PWVB 4IZ6A 1HQBA 2MR8A 2LOLA 2EHTA 1ACPA 1L0HA 2L0QA 1VKUA 2M5RA 2FHSC 2K93A 2MR7A 2FQ2A 2L4BA 2MVUA 2VSQA 5KP8B 2AVAA 2CNRA 1DV5A 1DNYA 2MF4A 3RG2A 2JU1A 5HV8A 2GDWA 1NQ4A 2AF8A 2QNWA 4R0MA 2MY5A 4H2YC 2JQ4A 2KR5A 5EJDA 2N5IA 2GDYA 2EHSA 1OR5A 2LIUA 2KG9A 4HKGA 2KOOA 1L0IA 2LMLA 2MVVA 2CGQA 5KP7B 2LL8A 2ROQA 2N50A 2FVFA 4CA3A 2FQ0A 2AFDA 2DNWA 5KP6B 2N98A 2AFEA 2X2BA 1F80D 1X3OA 2KGAA 2K2QA 2KOPA 2PNGA 4MRTC 3GZMA 2KOSA 1KLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEO A;  2KGE A;  2KW2 A;  1T8K A;  2FQ1 A;  3EJD A;  3LMO A;  2XZ0 D;  2FAC A;  5HVC A;  4DG9 A;  2FVE A;  2L22 A;  3GZL A;  2KG8 A;  2KG6 A;  4BPF A;  2K94 A;  2CG5 B;  2KGD A;  2N5H A;  3EJB A;  5CZD B;  3EJE A;  2FVA A;  2N6Z A;  4H2X C;  2MD9 A;  2LKI A;  2LTE A;  3CE7 A;  2K0Y A;  2XZ1 C;  1AF8 A;  2LPK A;  4PXH B;  2JGP A;  2K0X A;  4BPG A;  2FAE A;  2KWL A;  2CQ8 A;  2LIW A;  2FAD A;  2KOR A;  2KOQ A;  1HY8 A;  4H2W C;  2N6Y A;  2K92 A;  3NY7 B;  4BPH A;  2L9F A;  2GDX A;  2JU2 A;  2KGC A;  4PWV B;  4IZ6 A;  1HQB A;  2MR8 A;  2LOL A;  2EHT A;  1ACP A;  1L0H A;  2L0Q A;  1VKU A;  2M5R A;  2FHS C;  2K93 A;  2MR7 A;  2FQ2 A;  2L4B A;  2MVU A;  2VSQ A;  5KP8 B;  2AVA A;  2CNR A;  1DV5 A;  1DNY A;  2MF4 A;  3RG2 A;  2JU1 A;  5HV8 A;  2GDW A;  1NQ4 A;  2AF8 A;  2QNW A;  4R0M A;  2MY5 A;  4H2Y C;  2JQ4 A;  2KR5 A;  5EJD A;  2N5I A;  2GDY A;  2EHS A;  1OR5 A;  2LIU A;  2KG9 A;  4HKG A;  2KOO A;  1L0I A;  2LML A;  2MVV A;  2CGQ A;  5KP7 B;  2LL8 A;  2ROQ A;  2N50 A;  2FVF A;  4CA3 A;  2FQ0 A;  2AFD A;  2DNW A;  5KP6 B;  2N98 A;  2AFE A;  2X2B A;  1F80 D;  1X3O A;  2KGA A;  2K2Q A;  2KOP A;  2PNG A;  4MRT C;  3GZM A;  2KOS A;  1KLP A; 
#chains in the Genus database with same CATH topology
 1M6N A;  4NEO A;  1VQ7 P;  2FQ1 A;  3CCL P;  3LMO A;  1Z6M A;  1YJN P;  2XZ0 D;  2FAC A;  4DG9 A;  2KG8 A;  2KG6 A;  3G0V A;  2CG5 B;  2KGD A;  3VRL C;  2M8P A;  5CZD B;  2FVA A;  2OTL P;  3CE7 A;  2PEN A;  4PXH B;  3DS2 A;  1VHN A;  2JYL A;  5BS1 A;  3HYB A;  1KC8 Q;  1EIA A;  1UJZ A;  2CQ8 A;  2KOR A;  1K30 A;  1VQL P;  4BPH A;  2PEK A;  2OTJ P;  2VLN A;  2JU2 A;  4PWV B;  1YJ9 P;  1JJ2 O;  2E1M A;  2MR8 A;  2LOL A;  3CME P;  2BHV A;  1GXH A;  1L0H A;  3CCJ P;  2L0Q A;  2GZF A;  5I4T G;  2BUO A;  5JPA A;  3CCS P;  2MR7 A;  5HGL A;  2P9X A;  3M1M A;  1YJW P;  2JU1 A;  2M8L A;  1NQ4 A;  3DS5 A;  2PY8 A;  1VQ8 P;  2VLQ A;  3U43 A;  1QVF O;  4H2Y C;  1M90 Q;  5F2N A;  4HKG A;  3CCR P;  2LML A;  2MVV A;  3DS4 A;  2GZE A;  3MGE A;  1GPJ A;  2AFE A;  1VQK P;  2KGA A;  2K2Q A;  2PNG A;  1A43 A;  1T8K A;  2KOD A;  1M1K Q;  3H0D A;  1IMQ A;  3NTE A;  5HVC A;  3GZL A;  1KQS O;  4BPF A;  3CMA P;  2PEI A;  2N5H A;  3EJB A;  1VQ6 P;  3EJE A;  7CEI A;  2N6Z A;  4H2X C;  3CD6 P;  2MD9 A;  2LKI A;  5F2O A;  2XZ1 C;  3HZQ A;  4F37 A;  2K0X A;  3CCV P;  3DPH A;  3Q20 A;  2FAE A;  1K8A Q;  4GR2 A;  5EW5 E;  2FAD A;  1HY8 A;  1YI2 P;  2DGY A;  3G28 A;  3I56 P;  2L9F A;  4PH1 A;  2JBG A;  2KGC A;  3G1G A;  4IZ6 A;  4XFZ A;  4UHP B;  2EHT A;  4U0D A;  3CCE P;  2JB0 A;  2NO8 A;  1Q82 Q;  3DS3 A;  1VQP P;  2JO0 A;  3DS1 A;  2L4B A;  4XRO A;  3CCU P;  2MVU A;  3H47 A;  2M8N A;  1BXI A;  2MF4 A;  1IUQ A;  2AF8 A;  1Q7Y Q;  1E0H A;  2LF4 A;  2XT1 A;  4U0C A;  1VQ9 P;  2XV6 A;  5EJD A;  2N5I A;  1K9M Q;  3G6E P;  1OR5 A;  2JYG A;  1AYI A;  4U0F A;  3CXC O;  2FVF A;  2N98 A;  2GZG A;  1F80 D;  2XXM A;  3RG6 C;  1S72 P;  2KOS A;  2KW2 A;  3G71 P;  1RO2 A;  3DTJ A;  1M6E X;  2OAR A;  2FVE A;  4COP A;  1MZ8 A;  2QEX P;  1EOQ A;  2GZI A;  3E2D A;  2LTE A;  2K0Y A;  1AF8 A;  2LPK A;  1RO0 A;  2ERH A;  2PEQ A;  1VQ5 P;  1YIJ P;  2KWL A;  3CCQ P;  1K73 Q;  2LIW A;  2KOQ A;  3B4Q A;  2EG5 A;  1QVG O;  4H2W C;  2K92 A;  3NY7 B;  1M74 A;  4U0E A;  2PEO A;  1HQB A;  4XFY A;  1VQO P;  3CC4 P;  1VKU A;  3I55 P;  1FR2 A;  1CEI A;  2K93 A;  2PEJ A;  2JAZ A;  5KP8 B;  2AVA A;  2CNR A;  3RG2 A;  3GJN A;  2GDW A;  4PH0 A;  4R0M A;  1NJI Q;  1ZNV A;  2MY5 A;  1E6J P;  2VLP A;  5HGO A;  3G26 A;  2GDY A;  4GR6 A;  4QNB A;  4WYM A;  1UNK A;  2LIU A;  2KG9 A;  1L0I A;  2CGQ A;  2LL8 A;  2VLO A;  2ROQ A;  2FQ0 A;  2AFD A;  3B5I A;  2X2B A;  1IMP A;  1X3O A;  4MRT C;  3WBH A;  1VQM P;  1ZMB A;  2KGE A;  4XRQ A;  2EIA A;  3EJD A;  3CCM P;  1KD1 Q;  4IPY A;  2Z46 A;  2L22 A;  2K94 A;  3H4E A;  3G1I A;  1AUM A;  1N8R Q;  3G29 A;  2JGP A;  1EMV A;  3CC2 P;  1GXG A;  3P05 A;  5HGM A;  4BPG A;  2Z45 A;  2N6Y A;  1D1D A;  2GYK A;  2GDX A;  3CPW O;  1YIT P;  1BAJ A;  1Q81 Q;  2GZJ A;  1VQN P;  1ACP A;  2WPT A;  2M5R A;  5BS2 A;  2FHS C;  3CC7 P;  5F2K A;  2K5X A;  2FQ2 A;  3DS0 A;  2VSQ A;  4U0A A;  1DV5 A;  1DNY A;  3GKL C;  1YHQ P;  2PEM A;  2L6E A;  4M0I A;  5HV8 A;  2QNW A;  1W2B O;  2EFJ A;  4XFX A;  3G21 A;  1RNI A;  3OW2 O;  1A8O A;  2QA4 P;  2JQ4 A;  2KR5 A;  2CWO A;  2EHS A;  1Q86 Q;  1QRJ A;  2KOO A;  5KP7 B;  2K0D X;  2N50 A;  4CA3 A;  4COC A;  5DCK A;  3LRY A;  2DNW A;  1VQ4 P;  5KP6 B;  2Z44 A;  4U0B A;  4QKO A;  2KOP A;  2ONT A;  3GZM A;  3G4S P;  5HGN A;  1KLP A; 
#chains in the Genus database with same CATH homology
 4NEO A;  2KGE A;  2KW2 A;  1T8K A;  2FQ1 A;  3EJD A;  3LMO A;  2XZ0 D;  2FAC A;  5HVC A;  4DG9 A;  2FVE A;  2L22 A;  3GZL A;  2KG8 A;  2KG6 A;  4BPF A;  2K94 A;  2CG5 B;  2KGD A;  2N5H A;  3EJB A;  5CZD B;  3EJE A;  2FVA A;  2N6Z A;  4H2X C;  2MD9 A;  2LKI A;  2LTE A;  3CE7 A;  2K0Y A;  2XZ1 C;  1AF8 A;  2LPK A;  4PXH B;  2JGP A;  2K0X A;  4BPG A;  2FAE A;  2KWL A;  2CQ8 A;  2LIW A;  2FAD A;  2KOR A;  2KOQ A;  1HY8 A;  4H2W C;  2N6Y A;  2K92 A;  3NY7 B;  4BPH A;  2L9F A;  2GDX A;  2JU2 A;  2KGC A;  4PWV B;  4IZ6 A;  1HQB A;  2MR8 A;  2LOL A;  2EHT A;  1ACP A;  1L0H A;  2L0Q A;  1VKU A;  2M5R A;  2FHS C;  2K93 A;  2MR7 A;  2FQ2 A;  2L4B A;  2MVU A;  2VSQ A;  5KP8 B;  2AVA A;  2CNR A;  1DV5 A;  1DNY A;  2MF4 A;  3RG2 A;  2JU1 A;  5HV8 A;  2GDW A;  1NQ4 A;  2AF8 A;  2QNW A;  4R0M A;  2MY5 A;  4H2Y C;  2JQ4 A;  2KR5 A;  5EJD A;  2N5I A;  2GDY A;  2EHS A;  1OR5 A;  2LIU A;  2KG9 A;  4HKG A;  2KOO A;  1L0I A;  2LML A;  2MVV A;  2CGQ A;  5KP7 B;  2LL8 A;  2ROQ A;  2N50 A;  2FVF A;  4CA3 A;  2FQ0 A;  2AFD A;  2DNW A;  5KP6 B;  2N98 A;  2AFE A;  2X2B A;  1F80 D;  1X3O A;  2KGA A;  2K2Q A;  2KOP A;  2PNG A;  4MRT C;  3GZM A;  2KOS A;  1KLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...