2LMLA

Solution nmr structure of holo acyl carrier protein from geobacter metallireducens refined with nh rdcs, northeast structural genomics consortium target gmr141
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of 4'-phosphopantetheine - GmACP3 from Geobacter metallireducens: a specialized acyl carrier protein with atypical structural features and a putative role in lipopolysaccharide biosynthesis.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Transport protein
molecule keywords Putative acyl carrier protein
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lmlA00
2FADA 2JGPA 1L0IA 2KWLA 2KG9A 4BPGA 2KOPA 5CZDB 1ACPA 3LMOA 4BPFA 2KOOA 5KP7B 2K0XA 2LL8A 3NY7B 2M5RA 3GZMA 4CA3A 2GDXA 2N5HA 5HVCA 2AF8A 4DG9A 2MVVA 1DV5A 2GDWA 2KG8A 2K94A 2L22A 4HKGA 1OR5A 2L4BA 2FQ1A 1AF8A 1HQBA 4MRTC 2K92A 2QNWA 2N50A 3CE7A 2MY5A 3EJBA 4H2XC 2JU2A 2N98A 2LKIA 2KGEA 2KGCA 2K93A 3GZLA 2KGDA 2KGAA 2MD9A 2K0YA 2DNWA 1T8KA 2EHTA 4PXHB 2FQ0A 2JU1A 3RG2A 2LTEA 2LOLA 5KP8B 1NQ4A 2LMLA 5EJDA 2MVUA 2FACA 2CG5B 1KLPA 4PWVB 2FHSC 2JQ4A 4R0MA 2AFEA 2L0QA 2KOSA 2FVEA 1HY8A 1VKUA 1L0HA 2XZ0D 1DNYA 1X3OA 2L9FA 3EJDA 2AFDA 2X2BA 4H2YC 4BPHA 3EJEA 2KORA 2K2QA 4NEOA 2VSQA 4H2WC 2MR7A 2LIWA 2N6ZA 2AVAA 2GDYA 2CGQA 2FVAA 2CQ8A 2MR8A 2CNRA 2FQ2A 2XZ1C 2MF4A 2N6YA 2FAEA 4IZ6A 2EHSA 2ROQA 1F80D 5KP6B 2KG6A 2LIUA 2KW2A 2N5IA 2KR5A 2LPKA 2PNGA 2KOQA 5HV8A 2FVFA
chains in the Genus database with same CATH superfamily
1L0IA 4PH0A 2M8NA 4M0IA 3LMOA 3MGEA 2PENA 2XXMA 2N5HA 1CEIA 2EIAA 2GDWA 2GZFA 2GZEA 4HKGA 1YJ9P 1AF8A 1VQ6P 5BS1A 4MRTC 1VQ7P 1ZMBA 2MY5A 2N98A 1N8RQ 3CC2P 3DS0A 3GZLA 2MD9A 4U0FA 2DNWA 2LOLA 5HGLA 2EG5A 2K5XA 5BS2A 1YJNP 1K9MQ 2KODA 4PH1A 1UNKA 5EJDA 2CG5B 4PWVB 3B4QA 2FHSC 2JQ4A 1QVFO 2FVEA 1FR2A 4U0DA 2BHVA 5HGOA 2VLNA 3DS5A 5EW5E 2L9FA 3Q20A 3EJEA 4COPA 3CCLP 2OARA 1M74A 3CCSP 3HZQA 2GZJA 5JPAA 3E2DA 2AVAA 1VQNP 3LRYA 1K73Q 2CNRA 3RG6C 2XZ1C 4IZ6A 2ROQA 2DGYA 3CD6P 2GZGA 3P05A 4COCA 3G6EP 1M6NA 2LPKA 1A8OA 4GR6A 1YITP 3G29A 1Q7YQ 2ONTA 1E0HA 4XROA 4IPYA 5CZDB 4U0EA 2K0XA 2LL8A 3GZMA 2AF8A 1AYIA 4GR2A 3CC7P 1M1KQ 1MZ8A 2K94A 1HQBA 4XFXA 3CE7A 2JO0A 3I55P 3G4SP 2KGCA 2K93A 2JB0A 1VQOP 2KGDA 1GXGA 7CEIA 3CPWO 3DS2A 3RG2A 3G1GA 1YHQP 4XRQA 1VQ8P 2GZIA 1KQSO 2FACA 1KC8Q 1M6EX 2AFEA 2ERHA 2KOSA 2LF4A 1IMPA 3CCMP 1L0HA 1D1DA 2XZ0D 1RNIA 3EJDA 3H47A 2AFDA 4QNBA 2KORA 4U0AA 1AUMA 1Q86Q 2LIWA 2CQ8A 1QVGO 2PEOA 2MF4A 1GXHA 2EHSA 3GKLC 5KP6B 2LIUA 2L6EA 2KW2A 1A43A 1E6JP 2KR5A 1W2BO 3G28A 3OW2O 3DS3A 4U0CA 5HV8A 2FADA 2JGPA 2KWLA 2KG9A 3H4EA 2KOPA 1ACPA 1RO2A 1RO0A 1QRJA 4BPFA 2KOOA 5KP7B 4XFZA 1EIAA 5HGMA 1Q82Q 2Z46A 5HVCA 2MVVA 2QA4P 1VQ4P 1UJZA 1OR5A 2FQ1A 2E1MA 2QNWA 3HYBA 2N50A 3EJBA 4H2XC 4UHPB 2LKIA 3DS1A 2JAZA 5DCKA 3CMEP 2KGEA 3CXCO 4WYMA 2BUOA 2JYLA 2KGAA 2PEKA 3CCEP 5F2KA 2K0YA 2EHTA 1KD1Q 2JU1A 2OTLP 4QKOA 2XV6A 1IMQA 3VRLC 1VQLP 5KP8B 2LMLA 3CCUP 1VQ9P 3G26A 4R0MA 1VQMP 1ZNVA 1K30A 1VKUA 1M90Q 4F37A 1X3OA 4H2YC 1VQ5P 2VLQA 2K2QA 2WPTA 4NEOA 3G71P 3I56P 1VQPP 4H2WC 2MR7A 2GDYA 2CGQA 1YI2P 3NTEA 2FQ2A 4U0BA 5I4TG 2GYKA 2PY8A 3CC4P 3CCQP 2QEXP 2KG6A 1K8AQ 2N5IA 1GPJA 2OTJP 2JYGA 1DNYA 2VLOA 4BPGA 2P9XA 1EOQA 2K0DX 3NY7B 2XT1A 2M5RA 4CA3A 2GDXA 4DG9A 2Z45A 1DV5A 1IUQA 2KG8A 2L22A 2L4BA 2K92A 1BXIA 3CCVP 2JU2A 2VLPA 2PEMA 1VHNA 2PEIA 1Q81Q 1BAJA 1T8KA 1YIJP 3WBHA 3CMAP 4PXHB 2FQ0A 2LTEA 3B5IA 1Z6MA 5HGNA 1NQ4A 3CCJP 2MVUA 1KLPA 1NJIQ 2PEJA 2L0QA 1HY8A 4XFYA 1S72P 3DPHA 3CCRP 2M8LA 3M1MA 2EFJA 4BPHA 2X2BA 3G0VA 3G21A 3DTJA 2Z44A 2M8PA 3G1IA 1YJWP 2JBGA 2VSQA 5F2NA 2N6ZA 2NO8A 5F2OA 2PEQA 3U43A 3GJNA 2MR8A 2FVAA 2N6YA 2CWOA 2FAEA 1JJ2O 1F80D 3DS4A 2PNGA 3H0DA 1VQKP 2KOQA 1EMVA 2FVFA
chains in the Genus database with same CATH topology
2FADA 2JGPA 1L0IA 2KWLA 2KG9A 4BPGA 2KOPA 5CZDB 1ACPA 3LMOA 4BPFA 2KOOA 5KP7B 2K0XA 2LL8A 3NY7B 2M5RA 3GZMA 4CA3A 2GDXA 2N5HA 5HVCA 2AF8A 4DG9A 2MVVA 1DV5A 2GDWA 2KG8A 2K94A 2L22A 4HKGA 1OR5A 2L4BA 2FQ1A 1AF8A 1HQBA 4MRTC 2K92A 2QNWA 2N50A 3CE7A 2MY5A 3EJBA 4H2XC 2JU2A 2N98A 2LKIA 2KGEA 2KGCA 2K93A 3GZLA 2KGDA 2KGAA 2MD9A 2K0YA 2DNWA 1T8KA 2EHTA 4PXHB 2FQ0A 2JU1A 3RG2A 2LTEA 2LOLA 5KP8B 1NQ4A 2LMLA 5EJDA 2MVUA 2FACA 2CG5B 1KLPA 4PWVB 2FHSC 2JQ4A 4R0MA 2AFEA 2L0QA 2KOSA 2FVEA 1HY8A 1VKUA 1L0HA 2XZ0D 1DNYA 1X3OA 2L9FA 3EJDA 2AFDA 2X2BA 4H2YC 4BPHA 3EJEA 2KORA 2K2QA 4NEOA 2VSQA 4H2WC 2MR7A 2LIWA 2N6ZA 2AVAA 2GDYA 2CGQA 2FVAA 2CQ8A 2MR8A 2CNRA 2FQ2A 2XZ1C 2MF4A 2N6YA 2FAEA 4IZ6A 2EHSA 2ROQA 1F80D 5KP6B 2KG6A 2LIUA 2KW2A 2N5IA 2KR5A 2LPKA 2PNGA 2KOQA 5HV8A 2FVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2JGP A;  1L0I A;  2KWL A;  2KG9 A;  4BPG A;  2KOP A;  5CZD B;  1ACP A;  3LMO A;  4BPF A;  2KOO A;  5KP7 B;  2K0X A;  2LL8 A;  3NY7 B;  2M5R A;  3GZM A;  4CA3 A;  2GDX A;  2N5H A;  5HVC A;  2AF8 A;  4DG9 A;  2MVV A;  1DV5 A;  2GDW A;  2KG8 A;  2K94 A;  2L22 A;  4HKG A;  1OR5 A;  2L4B A;  2FQ1 A;  1AF8 A;  1HQB A;  4MRT C;  2K92 A;  2QNW A;  2N50 A;  3CE7 A;  2MY5 A;  3EJB A;  4H2X C;  2JU2 A;  2N98 A;  2LKI A;  2KGE A;  2KGC A;  2K93 A;  3GZL A;  2KGD A;  2KGA A;  2MD9 A;  2K0Y A;  2DNW A;  1T8K A;  2EHT A;  4PXH B;  2FQ0 A;  2JU1 A;  3RG2 A;  2LTE A;  2LOL A;  5KP8 B;  1NQ4 A;  2LML A;  5EJD A;  2MVU A;  2FAC A;  2CG5 B;  1KLP A;  4PWV B;  2FHS C;  2JQ4 A;  4R0M A;  2AFE A;  2L0Q A;  2KOS A;  2FVE A;  1HY8 A;  1VKU A;  1L0H A;  2XZ0 D;  1DNY A;  1X3O A;  2L9F A;  3EJD A;  2AFD A;  2X2B A;  4H2Y C;  4BPH A;  3EJE A;  2KOR A;  2K2Q A;  4NEO A;  2VSQ A;  4H2W C;  2MR7 A;  2LIW A;  2N6Z A;  2AVA A;  2GDY A;  2CGQ A;  2FVA A;  2CQ8 A;  2MR8 A;  2CNR A;  2FQ2 A;  2XZ1 C;  2MF4 A;  2N6Y A;  2FAE A;  4IZ6 A;  2EHS A;  2ROQ A;  1F80 D;  5KP6 B;  2KG6 A;  2LIU A;  2KW2 A;  2N5I A;  2KR5 A;  2LPK A;  2PNG A;  2KOQ A;  5HV8 A;  2FVF A; 
#chains in the Genus database with same CATH topology
 1L0I A;  4PH0 A;  2M8N A;  4M0I A;  3LMO A;  3MGE A;  2PEN A;  2XXM A;  2N5H A;  1CEI A;  2EIA A;  2GDW A;  2GZF A;  2GZE A;  4HKG A;  1YJ9 P;  1AF8 A;  1VQ6 P;  5BS1 A;  4MRT C;  1VQ7 P;  1ZMB A;  2MY5 A;  2N98 A;  1N8R Q;  3CC2 P;  3DS0 A;  3GZL A;  2MD9 A;  4U0F A;  2DNW A;  2LOL A;  5HGL A;  2EG5 A;  2K5X A;  5BS2 A;  1YJN P;  1K9M Q;  2KOD A;  4PH1 A;  1UNK A;  5EJD A;  2CG5 B;  4PWV B;  3B4Q A;  2FHS C;  2JQ4 A;  1QVF O;  2FVE A;  1FR2 A;  4U0D A;  2BHV A;  5HGO A;  2VLN A;  3DS5 A;  5EW5 E;  2L9F A;  3Q20 A;  3EJE A;  4COP A;  3CCL P;  2OAR A;  1M74 A;  3CCS P;  3HZQ A;  2GZJ A;  5JPA A;  3E2D A;  2AVA A;  1VQN P;  3LRY A;  1K73 Q;  2CNR A;  3RG6 C;  2XZ1 C;  4IZ6 A;  2ROQ A;  2DGY A;  3CD6 P;  2GZG A;  3P05 A;  4COC A;  3G6E P;  1M6N A;  2LPK A;  1A8O A;  4GR6 A;  1YIT P;  3G29 A;  1Q7Y Q;  2ONT A;  1E0H A;  4XRO A;  4IPY A;  5CZD B;  4U0E A;  2K0X A;  2LL8 A;  3GZM A;  2AF8 A;  1AYI A;  4GR2 A;  3CC7 P;  1M1K Q;  1MZ8 A;  2K94 A;  1HQB A;  4XFX A;  3CE7 A;  2JO0 A;  3I55 P;  3G4S P;  2KGC A;  2K93 A;  2JB0 A;  1VQO P;  2KGD A;  1GXG A;  7CEI A;  3CPW O;  3DS2 A;  3RG2 A;  3G1G A;  1YHQ P;  4XRQ A;  1VQ8 P;  2GZI A;  1KQS O;  2FAC A;  1KC8 Q;  1M6E X;  2AFE A;  2ERH A;  2KOS A;  2LF4 A;  1IMP A;  3CCM P;  1L0H A;  1D1D A;  2XZ0 D;  1RNI A;  3EJD A;  3H47 A;  2AFD A;  4QNB A;  2KOR A;  4U0A A;  1AUM A;  1Q86 Q;  2LIW A;  2CQ8 A;  1QVG O;  2PEO A;  2MF4 A;  1GXH A;  2EHS A;  3GKL C;  5KP6 B;  2LIU A;  2L6E A;  2KW2 A;  1A43 A;  1E6J P;  2KR5 A;  1W2B O;  3G28 A;  3OW2 O;  3DS3 A;  4U0C A;  5HV8 A;  2FAD A;  2JGP A;  2KWL A;  2KG9 A;  3H4E A;  2KOP A;  1ACP A;  1RO2 A;  1RO0 A;  1QRJ A;  4BPF A;  2KOO A;  5KP7 B;  4XFZ A;  1EIA A;  5HGM A;  1Q82 Q;  2Z46 A;  5HVC A;  2MVV A;  2QA4 P;  1VQ4 P;  1UJZ A;  1OR5 A;  2FQ1 A;  2E1M A;  2QNW A;  3HYB A;  2N50 A;  3EJB A;  4H2X C;  4UHP B;  2LKI A;  3DS1 A;  2JAZ A;  5DCK A;  3CME P;  2KGE A;  3CXC O;  4WYM A;  2BUO A;  2JYL A;  2KGA A;  2PEK A;  3CCE P;  5F2K A;  2K0Y A;  2EHT A;  1KD1 Q;  2JU1 A;  2OTL P;  4QKO A;  2XV6 A;  1IMQ A;  3VRL C;  1VQL P;  5KP8 B;  2LML A;  3CCU P;  1VQ9 P;  3G26 A;  4R0M A;  1VQM P;  1ZNV A;  1K30 A;  1VKU A;  1M90 Q;  4F37 A;  1X3O A;  4H2Y C;  1VQ5 P;  2VLQ A;  2K2Q A;  2WPT A;  4NEO A;  3G71 P;  3I56 P;  1VQP P;  4H2W C;  2MR7 A;  2GDY A;  2CGQ A;  1YI2 P;  3NTE A;  2FQ2 A;  4U0B A;  5I4T G;  2GYK A;  2PY8 A;  3CC4 P;  3CCQ P;  2QEX P;  2KG6 A;  1K8A Q;  2N5I A;  1GPJ A;  2OTJ P;  2JYG A;  1DNY A;  2VLO A;  4BPG A;  2P9X A;  1EOQ A;  2K0D X;  3NY7 B;  2XT1 A;  2M5R A;  4CA3 A;  2GDX A;  4DG9 A;  2Z45 A;  1DV5 A;  1IUQ A;  2KG8 A;  2L22 A;  2L4B A;  2K92 A;  1BXI A;  3CCV P;  2JU2 A;  2VLP A;  2PEM A;  1VHN A;  2PEI A;  1Q81 Q;  1BAJ A;  1T8K A;  1YIJ P;  3WBH A;  3CMA P;  4PXH B;  2FQ0 A;  2LTE A;  3B5I A;  1Z6M A;  5HGN A;  1NQ4 A;  3CCJ P;  2MVU A;  1KLP A;  1NJI Q;  2PEJ A;  2L0Q A;  1HY8 A;  4XFY A;  1S72 P;  3DPH A;  3CCR P;  2M8L A;  3M1M A;  2EFJ A;  4BPH A;  2X2B A;  3G0V A;  3G21 A;  3DTJ A;  2Z44 A;  2M8P A;  3G1I A;  1YJW P;  2JBG A;  2VSQ A;  5F2N A;  2N6Z A;  2NO8 A;  5F2O A;  2PEQ A;  3U43 A;  3GJN A;  2MR8 A;  2FVA A;  2N6Y A;  2CWO A;  2FAE A;  1JJ2 O;  1F80 D;  3DS4 A;  2PNG A;  3H0D A;  1VQK P;  2KOQ A;  1EMV A;  2FVF A; 
#chains in the Genus database with same CATH homology
 2FAD A;  2JGP A;  1L0I A;  2KWL A;  2KG9 A;  4BPG A;  2KOP A;  5CZD B;  1ACP A;  3LMO A;  4BPF A;  2KOO A;  5KP7 B;  2K0X A;  2LL8 A;  3NY7 B;  2M5R A;  3GZM A;  4CA3 A;  2GDX A;  2N5H A;  5HVC A;  2AF8 A;  4DG9 A;  2MVV A;  1DV5 A;  2GDW A;  2KG8 A;  2K94 A;  2L22 A;  4HKG A;  1OR5 A;  2L4B A;  2FQ1 A;  1AF8 A;  1HQB A;  4MRT C;  2K92 A;  2QNW A;  2N50 A;  3CE7 A;  2MY5 A;  3EJB A;  4H2X C;  2JU2 A;  2N98 A;  2LKI A;  2KGE A;  2KGC A;  2K93 A;  3GZL A;  2KGD A;  2KGA A;  2MD9 A;  2K0Y A;  2DNW A;  1T8K A;  2EHT A;  4PXH B;  2FQ0 A;  2JU1 A;  3RG2 A;  2LTE A;  2LOL A;  5KP8 B;  1NQ4 A;  2LML A;  5EJD A;  2MVU A;  2FAC A;  2CG5 B;  1KLP A;  4PWV B;  2FHS C;  2JQ4 A;  4R0M A;  2AFE A;  2L0Q A;  2KOS A;  2FVE A;  1HY8 A;  1VKU A;  1L0H A;  2XZ0 D;  1DNY A;  1X3O A;  2L9F A;  3EJD A;  2AFD A;  2X2B A;  4H2Y C;  4BPH A;  3EJE A;  2KOR A;  2K2Q A;  4NEO A;  2VSQ A;  4H2W C;  2MR7 A;  2LIW A;  2N6Z A;  2AVA A;  2GDY A;  2CGQ A;  2FVA A;  2CQ8 A;  2MR8 A;  2CNR A;  2FQ2 A;  2XZ1 C;  2MF4 A;  2N6Y A;  2FAE A;  4IZ6 A;  2EHS A;  2ROQ A;  1F80 D;  5KP6 B;  2KG6 A;  2LIU A;  2KW2 A;  2N5I A;  2KR5 A;  2LPK A;  2PNG A;  2KOQ A;  5HV8 A;  2FVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...