2LMLA

Solution nmr structure of holo acyl carrier protein from geobacter metallireducens refined with nh rdcs, northeast structural genomics consortium target gmr141
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
b'MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acyl carrier protein
publication title Solution structure of 4'-phosphopantetheine - GmACP3 from Geobacter metallireducens: a specialized acyl carrier protein with atypical structural features and a putative role in lipopolysaccharide biosynthesis.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Transport protein
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lmlA00
4H2WC 2FADA 2K92A 2FVAA 4MRTC 2LKIA 1X3OA 2QNWA 2LPKA 2LMLA 1L0IA 2FHSC 2KGEA 2KOQA 2LOLA 4BPHA 1HY8A 2XZ0D 2LTEA 1L0HA 2FVFA 4H2YC 2FVEA 1KLPA 2AFDA 5KP6B 2KGAA 2KGCA 2MD9A 2K94A 5CZDB 1HQBA 2FQ0A 2KOOA 5KP7B 2VSQA 2K93A 1DNYA 2M5RA 2N5HA 3EJEA 4CA3A 2FQ2A 2FACA 4H2XC 2K0XA 3CE7A 2JGPA 2K2QA 2L0QA 4HKGA 4IZ6A 1VKUA 2K0YA 2DNWA 2GDYA 2KWLA 5EJDA 3GZMA 4R0MA 4NEOA 2KG9A 2XZ1C 1F80D 2CNRA 2CQ8A 2MVUA 2KG8A 3LMOA 2JU2A 4BPGA 1DV5A 2JQ4A 2KGDA 2N6ZA 2GDXA 2N6YA 4BPFA 2CGQA 2MF4A 2MVVA 3RG2A 2X2BA 2KG6A 2LL8A 2MR7A 3GZLA 2MR8A 2EHSA 2CG5B 2KW2A 1AF8A 3EJBA 1T8KA 4PXHB 2N98A 5KP8B 2ROQA 4PWVB 3EJDA 1OR5A 2JU1A 2N50A 1ACPA 2AFEA 5HVCA 2LIWA 2N5IA 3NY7B 2AVAA 2AF8A 2L4BA 2GDWA 2FAEA 2KR5A 2L22A 2EHTA 2MY5A 2FQ1A 4DG9A 2KORA 2KOSA 2L9FA 2LIUA 2KOPA 5HV8A 1NQ4A 2PNGA
chains in the Genus database with same CATH superfamily
4H2WC 5HGNA 4M0IA 3CCLP 5DCKA 3CCSP 3E2DA 1X3OA 5I4TG 4GR2A 2KGEA 1YJNP 2QA4P 4U0EA 1VQKP 4BPHA 2XXMA 2XZ0D 1Q81Q 3I55P 2OARA 1KLPA 2AFDA 1UJZA 2KGAA 1QVGO 2K94A 1HQBA 1N8RQ 5KP7B 3U43A 2VSQA 2M5RA 3EJEA 3P05A 2JB0A 3CCEP 3HZQA 3CCQP 5EJDA 4R0MA 5HGLA 3B4QA 1Z6MA 4BPGA 3I56P 1DV5A 3Q20A 1VQMP 1KQSO 2N6YA 2MVVA 1BXIA 2LL8A 1Q7YQ 1Q82Q 1MZ8A 1NJIQ 3CCRP 5F2KA 3EJBA 1T8KA 2N98A 2ROQA 1OR5A 3DPHA 1YI2P 3VRLC 2AFEA 2LIWA 1VQ8P 2N5IA 3NY7B 2AF8A 2L4BA 4QKOA 4U0AA 2FQ1A 2KOSA 2L9FA 2LIUA 2VLPA 2GZJA 1NQ4A 4COCA 1K73Q 1RO2A 4MRTC 4COPA 2LKIA 1AYIA 1FR2A 5HGOA 2LMLA 1L0IA 1VQOP 2M8LA 2PEOA 2VLNA 2LTEA 2GZGA 3G1GA 3DS5A 4H2YC 2ONTA 5KP6B 2KGCA 2MD9A 5CZDB 2FQ0A 2PENA 2K93A 4PH1A 1S72P 4CA3A 2FACA 2BUOA 2K0XA 2OTJP 3CPWO 2E1MA 2L0QA 4HKGA 4IZ6A 2CWOA 3RG6C 3GKLC 3CCMP 3GZMA 1AUMA 2KG9A 1Q86Q 1F80D 4XFYA 1VQPP 2KODA 2MVUA 2JQ4A 5JPAA 3G29A 3H4EA 2PEKA 1YIJP 2MF4A 3DTJA 1VQLP 3RG2A 2X2BA 2XV6A 2MR7A 2MR8A 4PH0A 4WYMA 2KW2A 5KP8B 1K8AQ 3CC7P 2XT1A 4PWVB 1IMQA 2EG5A 1M6EX 1RNIA 2GZIA 2AVAA 2PEQA 3H47A 5BS2A 2KR5A 2L22A 1K9MQ 4DG9A 2EIAA 2GZEA 7CEIA 3CC4P 3DS4A 3CC2P 2PEJA 1IUQA 2EFJA 2JYLA 2QEXP 1CEIA 2KOQA 1ZMBA 1GPJA 1L0HA 3NTEA 1GXGA 3M1MA 3CMEP 1VHNA 2NO8A 2PEMA 1W2BO 1DNYA 2N5HA 3WBHA 4GR6A 4XFXA 1EOQA 4XFZA 1QRJA 3G1IA 2OTLP 4H2XC 1YJWP 3CE7A 3DS2A 1ZNVA 2DGYA 2JGPA 2K2QA 2Z44A 1YITP 2K0YA 2DNWA 2GDYA 5HGMA 2Z46A 3HYBA 3G4SP 2JYGA 2CNRA 2KG8A 3DS3A 4U0FA 3CMAP 4QNBA 2KGDA 3CCUP 1VQ4P 2CGQA 2WPTA 1YJ9P 1A8OA 2LF4A 1YHQP 2JAZA 2KG6A 3GZLA 2EHSA 1JJ2O 1M90Q 1EMVA 2VLOA 3CD6P 2K0DX 3DS1A 2VLQA 1VQ9P 2N50A 1BAJA 2GDWA 2FAEA 2EHTA 1EIAA 3G0VA 5F2NA 1IMPA 2L6EA 4F37A 4U0DA 2KOPA 5HV8A 3B5IA 2PNGA 2JBGA 3G28A 2FADA 4IPYA 3G71P 3LRYA 4UHPB 2K92A 2BHVA 2FVAA 1KC8Q 2Z45A 2QNWA 2LPKA 2FHSC 1M74A 2GYKA 2LOLA 1UNKA 1HY8A 2PY8A 2FVFA 1VQNP 2FVEA 2KOOA 1A43A 1QVFO 1VQ5P 2P9XA 3G26A 2FQ2A 1K30A 4XRQA 1VKUA 2KWLA 2M8PA 3DS0A 4NEOA 2XZ1C 3CCJP 5EW5E 5BS1A 2CQ8A 2K5XA 3LMOA 2JU2A 3MGEA 3CXCO 2M8NA 2PEIA 1KD1Q 2N6ZA 2GDXA 3GJNA 1GXHA 4BPFA 3G21A 3OW2O 2CG5B 1AF8A 3G6EP 2ERHA 4PXHB 1RO0A 1M6NA 1E0HA 3EJDA 2GZFA 2JO0A 2JU1A 1ACPA 5HVCA 1M1KQ 1E6JP 4U0CA 2MY5A 3CCVP 5F2OA 1VQ6P 1D1DA 2KORA 1VQ7P 4U0BA 3H0DA 4XROA
chains in the Genus database with same CATH topology
4H2WC 2FADA 2K92A 2FVAA 4MRTC 2LKIA 1X3OA 2QNWA 2LPKA 2LMLA 1L0IA 2FHSC 2KGEA 2KOQA 2LOLA 4BPHA 1HY8A 2XZ0D 2LTEA 1L0HA 2FVFA 4H2YC 2FVEA 1KLPA 2AFDA 5KP6B 2KGAA 2KGCA 2MD9A 2K94A 5CZDB 1HQBA 2FQ0A 2KOOA 5KP7B 2VSQA 2K93A 1DNYA 2M5RA 2N5HA 3EJEA 4CA3A 2FQ2A 2FACA 4H2XC 2K0XA 3CE7A 2JGPA 2K2QA 2L0QA 4HKGA 4IZ6A 1VKUA 2K0YA 2DNWA 2GDYA 2KWLA 5EJDA 3GZMA 4R0MA 4NEOA 2KG9A 2XZ1C 1F80D 2CNRA 2CQ8A 2MVUA 2KG8A 3LMOA 2JU2A 4BPGA 1DV5A 2JQ4A 2KGDA 2N6ZA 2GDXA 2N6YA 4BPFA 2CGQA 2MF4A 2MVVA 3RG2A 2X2BA 2KG6A 2LL8A 2MR7A 3GZLA 2MR8A 2EHSA 2CG5B 2KW2A 1AF8A 3EJBA 1T8KA 4PXHB 2N98A 5KP8B 2ROQA 4PWVB 3EJDA 1OR5A 2JU1A 2N50A 1ACPA 2AFEA 5HVCA 2LIWA 2N5IA 3NY7B 2AVAA 2AF8A 2L4BA 2GDWA 2FAEA 2KR5A 2L22A 2EHTA 2MY5A 2FQ1A 4DG9A 2KORA 2KOSA 2L9FA 2LIUA 2KOPA 5HV8A 1NQ4A 2PNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2W C;  2FAD A;  2K92 A;  2FVA A;  4MRT C;  2LKI A;  1X3O A;  2QNW A;  2LPK A;  2LML A;  1L0I A;  2FHS C;  2KGE A;  2KOQ A;  2LOL A;  4BPH A;  1HY8 A;  2XZ0 D;  2LTE A;  1L0H A;  2FVF A;  4H2Y C;  2FVE A;  1KLP A;  2AFD A;  5KP6 B;  2KGA A;  2KGC A;  2MD9 A;  2K94 A;  5CZD B;  1HQB A;  2FQ0 A;  2KOO A;  5KP7 B;  2VSQ A;  2K93 A;  1DNY A;  2M5R A;  2N5H A;  3EJE A;  4CA3 A;  2FQ2 A;  2FAC A;  4H2X C;  2K0X A;  3CE7 A;  2JGP A;  2K2Q A;  2L0Q A;  4HKG A;  4IZ6 A;  1VKU A;  2K0Y A;  2DNW A;  2GDY A;  2KWL A;  5EJD A;  3GZM A;  4R0M A;  4NEO A;  2KG9 A;  2XZ1 C;  1F80 D;  2CNR A;  2CQ8 A;  2MVU A;  2KG8 A;  3LMO A;  2JU2 A;  4BPG A;  1DV5 A;  2JQ4 A;  2KGD A;  2N6Z A;  2GDX A;  2N6Y A;  4BPF A;  2CGQ A;  2MF4 A;  2MVV A;  3RG2 A;  2X2B A;  2KG6 A;  2LL8 A;  2MR7 A;  3GZL A;  2MR8 A;  2EHS A;  2CG5 B;  2KW2 A;  1AF8 A;  3EJB A;  1T8K A;  4PXH B;  2N98 A;  5KP8 B;  2ROQ A;  4PWV B;  3EJD A;  1OR5 A;  2JU1 A;  2N50 A;  1ACP A;  2AFE A;  5HVC A;  2LIW A;  2N5I A;  3NY7 B;  2AVA A;  2AF8 A;  2L4B A;  2GDW A;  2FAE A;  2KR5 A;  2L22 A;  2EHT A;  2MY5 A;  2FQ1 A;  4DG9 A;  2KOR A;  2KOS A;  2L9F A;  2LIU A;  2KOP A;  5HV8 A;  1NQ4 A;  2PNG A; 
#chains in the Genus database with same CATH topology
 4H2W C;  5HGN A;  4M0I A;  3CCL P;  5DCK A;  3CCS P;  3E2D A;  1X3O A;  5I4T G;  4GR2 A;  2KGE A;  1YJN P;  2QA4 P;  4U0E A;  1VQK P;  4BPH A;  2XXM A;  2XZ0 D;  1Q81 Q;  3I55 P;  2OAR A;  1KLP A;  2AFD A;  1UJZ A;  2KGA A;  1QVG O;  2K94 A;  1HQB A;  1N8R Q;  5KP7 B;  3U43 A;  2VSQ A;  2M5R A;  3EJE A;  3P05 A;  2JB0 A;  3CCE P;  3HZQ A;  3CCQ P;  5EJD A;  4R0M A;  5HGL A;  3B4Q A;  1Z6M A;  4BPG A;  3I56 P;  1DV5 A;  3Q20 A;  1VQM P;  1KQS O;  2N6Y A;  2MVV A;  1BXI A;  2LL8 A;  1Q7Y Q;  1Q82 Q;  1MZ8 A;  1NJI Q;  3CCR P;  5F2K A;  3EJB A;  1T8K A;  2N98 A;  2ROQ A;  1OR5 A;  3DPH A;  1YI2 P;  3VRL C;  2AFE A;  2LIW A;  1VQ8 P;  2N5I A;  3NY7 B;  2AF8 A;  2L4B A;  4QKO A;  4U0A A;  2FQ1 A;  2KOS A;  2L9F A;  2LIU A;  2VLP A;  2GZJ A;  1NQ4 A;  4COC A;  1K73 Q;  1RO2 A;  4MRT C;  4COP A;  2LKI A;  1AYI A;  1FR2 A;  5HGO A;  2LML A;  1L0I A;  1VQO P;  2M8L A;  2PEO A;  2VLN A;  2LTE A;  2GZG A;  3G1G A;  3DS5 A;  4H2Y C;  2ONT A;  5KP6 B;  2KGC A;  2MD9 A;  5CZD B;  2FQ0 A;  2PEN A;  2K93 A;  4PH1 A;  1S72 P;  4CA3 A;  2FAC A;  2BUO A;  2K0X A;  2OTJ P;  3CPW O;  2E1M A;  2L0Q A;  4HKG A;  4IZ6 A;  2CWO A;  3RG6 C;  3GKL C;  3CCM P;  3GZM A;  1AUM A;  2KG9 A;  1Q86 Q;  1F80 D;  4XFY A;  1VQP P;  2KOD A;  2MVU A;  2JQ4 A;  5JPA A;  3G29 A;  3H4E A;  2PEK A;  1YIJ P;  2MF4 A;  3DTJ A;  1VQL P;  3RG2 A;  2X2B A;  2XV6 A;  2MR7 A;  2MR8 A;  4PH0 A;  4WYM A;  2KW2 A;  5KP8 B;  1K8A Q;  3CC7 P;  2XT1 A;  4PWV B;  1IMQ A;  2EG5 A;  1M6E X;  1RNI A;  2GZI A;  2AVA A;  2PEQ A;  3H47 A;  5BS2 A;  2KR5 A;  2L22 A;  1K9M Q;  4DG9 A;  2EIA A;  2GZE A;  7CEI A;  3CC4 P;  3DS4 A;  3CC2 P;  2PEJ A;  1IUQ A;  2EFJ A;  2JYL A;  2QEX P;  1CEI A;  2KOQ A;  1ZMB A;  1GPJ A;  1L0H A;  3NTE A;  1GXG A;  3M1M A;  3CME P;  1VHN A;  2NO8 A;  2PEM A;  1W2B O;  1DNY A;  2N5H A;  3WBH A;  4GR6 A;  4XFX A;  1EOQ A;  4XFZ A;  1QRJ A;  3G1I A;  2OTL P;  4H2X C;  1YJW P;  3CE7 A;  3DS2 A;  1ZNV A;  2DGY A;  2JGP A;  2K2Q A;  2Z44 A;  1YIT P;  2K0Y A;  2DNW A;  2GDY A;  5HGM A;  2Z46 A;  3HYB A;  3G4S P;  2JYG A;  2CNR A;  2KG8 A;  3DS3 A;  4U0F A;  3CMA P;  4QNB A;  2KGD A;  3CCU P;  1VQ4 P;  2CGQ A;  2WPT A;  1YJ9 P;  1A8O A;  2LF4 A;  1YHQ P;  2JAZ A;  2KG6 A;  3GZL A;  2EHS A;  1JJ2 O;  1M90 Q;  1EMV A;  2VLO A;  3CD6 P;  2K0D X;  3DS1 A;  2VLQ A;  1VQ9 P;  2N50 A;  1BAJ A;  2GDW A;  2FAE A;  2EHT A;  1EIA A;  3G0V A;  5F2N A;  1IMP A;  2L6E A;  4F37 A;  4U0D A;  2KOP A;  5HV8 A;  3B5I A;  2PNG A;  2JBG A;  3G28 A;  2FAD A;  4IPY A;  3G71 P;  3LRY A;  4UHP B;  2K92 A;  2BHV A;  2FVA A;  1KC8 Q;  2Z45 A;  2QNW A;  2LPK A;  2FHS C;  1M74 A;  2GYK A;  2LOL A;  1UNK A;  1HY8 A;  2PY8 A;  2FVF A;  1VQN P;  2FVE A;  2KOO A;  1A43 A;  1QVF O;  1VQ5 P;  2P9X A;  3G26 A;  2FQ2 A;  1K30 A;  4XRQ A;  1VKU A;  2KWL A;  2M8P A;  3DS0 A;  4NEO A;  2XZ1 C;  3CCJ P;  5EW5 E;  5BS1 A;  2CQ8 A;  2K5X A;  3LMO A;  2JU2 A;  3MGE A;  3CXC O;  2M8N A;  2PEI A;  1KD1 Q;  2N6Z A;  2GDX A;  3GJN A;  1GXH A;  4BPF A;  3G21 A;  3OW2 O;  2CG5 B;  1AF8 A;  3G6E P;  2ERH A;  4PXH B;  1RO0 A;  1M6N A;  1E0H A;  3EJD A;  2GZF A;  2JO0 A;  2JU1 A;  1ACP A;  5HVC A;  1M1K Q;  1E6J P;  4U0C A;  2MY5 A;  3CCV P;  5F2O A;  1VQ6 P;  1D1D A;  2KOR A;  1VQ7 P;  4U0B A;  3H0D A;  4XRO A; 
#chains in the Genus database with same CATH homology
 4H2W C;  2FAD A;  2K92 A;  2FVA A;  4MRT C;  2LKI A;  1X3O A;  2QNW A;  2LPK A;  2LML A;  1L0I A;  2FHS C;  2KGE A;  2KOQ A;  2LOL A;  4BPH A;  1HY8 A;  2XZ0 D;  2LTE A;  1L0H A;  2FVF A;  4H2Y C;  2FVE A;  1KLP A;  2AFD A;  5KP6 B;  2KGA A;  2KGC A;  2MD9 A;  2K94 A;  5CZD B;  1HQB A;  2FQ0 A;  2KOO A;  5KP7 B;  2VSQ A;  2K93 A;  1DNY A;  2M5R A;  2N5H A;  3EJE A;  4CA3 A;  2FQ2 A;  2FAC A;  4H2X C;  2K0X A;  3CE7 A;  2JGP A;  2K2Q A;  2L0Q A;  4HKG A;  4IZ6 A;  1VKU A;  2K0Y A;  2DNW A;  2GDY A;  2KWL A;  5EJD A;  3GZM A;  4R0M A;  4NEO A;  2KG9 A;  2XZ1 C;  1F80 D;  2CNR A;  2CQ8 A;  2MVU A;  2KG8 A;  3LMO A;  2JU2 A;  4BPG A;  1DV5 A;  2JQ4 A;  2KGD A;  2N6Z A;  2GDX A;  2N6Y A;  4BPF A;  2CGQ A;  2MF4 A;  2MVV A;  3RG2 A;  2X2B A;  2KG6 A;  2LL8 A;  2MR7 A;  3GZL A;  2MR8 A;  2EHS A;  2CG5 B;  2KW2 A;  1AF8 A;  3EJB A;  1T8K A;  4PXH B;  2N98 A;  5KP8 B;  2ROQ A;  4PWV B;  3EJD A;  1OR5 A;  2JU1 A;  2N50 A;  1ACP A;  2AFE A;  5HVC A;  2LIW A;  2N5I A;  3NY7 B;  2AVA A;  2AF8 A;  2L4B A;  2GDW A;  2FAE A;  2KR5 A;  2L22 A;  2EHT A;  2MY5 A;  2FQ1 A;  4DG9 A;  2KOR A;  2KOS A;  2L9F A;  2LIU A;  2KOP A;  5HV8 A;  1NQ4 A;  2PNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...