2LMLA

Solution nmr structure of holo acyl carrier protein from geobacter metallireducens refined with nh rdcs, northeast structural genomics consortium target gmr141
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
87
Chain Sequence
MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acyl carrier protein
publication title Solution structure of 4'-phosphopantetheine - GmACP3 from Geobacter metallireducens: a specialized acyl carrier protein with atypical structural features and a putative role in lipopolysaccharide biosynthesis.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Transport protein
total genus 26
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lmlA00
2MF4A 3RG2A 2KOQA 3NY7B 4CA3A 2FACA 2MR7A 2KGAA 2MY5A 2CGQA 2KOSA 2LOLA 2AFEA 1HQBA 2N98A 2LPKA 2MVVA 4NEOA 4BPFA 2X2BA 2MVUA 2LMLA 5CZDB 2KWLA 2N6ZA 1KLPA 2KGDA 2VSQA 1VKUA 5EJDA 2CQ8A 5KP6B 2DNWA 1ACPA 2L9FA 4H2WC 2FQ0A 2KW2A 1L0HA 2GDYA 2K0XA 2JQ4A 2MD9A 2QNWA 2L4BA 3EJBA 3LMOA 1T8KA 2FQ1A 2FVEA 2AF8A 2L0QA 2M5RA 1AF8A 3GZLA 2JGPA 1F80D 4MRTC 2KG8A 1OR5A 2AVAA 2N50A 1DV5A 2N5HA 3CE7A 2FHSC 2LIWA 2L22A 4IZ6A 2FVFA 1X3OA 2XZ0D 5HVCA 2FQ2A 2K94A 2XZ1C 2CG5B 2EHTA 4H2YC 5KP8B 4DG9A 2FVAA 2K2QA 2N6YA 2KG6A 4PXHB 2PNGA 2CNRA 2MR8A 3EJEA 4BPHA 3GZMA 2JU2A 2ROQA 2FAEA 2JU1A 2FADA 4R0MA 2AFDA 2N5IA 2KGCA 2GDWA 1HY8A 2KOOA 2KR5A 5KP7B 3EJDA 4PWVB 2KORA 2K92A 2K93A 2LL8A 4H2XC 2LTEA 1L0IA 2LKIA 4HKGA 4BPGA 1NQ4A 2GDXA 2KGEA 2KOPA 2LIUA 2KG9A 5HV8A 1DNYA 2EHSA 2K0YA
chains in the Genus database with same CATH superfamily
3RG2A 2VLNA 1AUMA 3B5IA 4CA3A 1W2BO 1M1KQ 2MR7A 1VQ4P 1BXIA 2LOLA 2AFEA 3GKLC 3MGEA 1HQBA 2LPKA 1S72P 3DS0A 3G21A 3DTJA 3CCUP 5HGOA 2GZGA 5EJDA 2VSQA 2NO8A 4U0AA 1KC8Q 1M90Q 2JQ4A 2Z45A 4U0FA 3DS3A 2M5RA 1BAJA 3U43A 1F80D 2AVAA 2N50A 2N5HA 2GZFA 2L22A 3WBHA 2JYLA 1YI2P 1X3OA 2P9XA 3DPHA 2FQ2A 2EHSA 2K94A 2Z46A 2XZ1C 4H2YC 2OTJP 2QA4P 4DG9A 4U0BA 1VQMP 1N8RQ 2JAZA 4PXHB 1YJWP 2MR8A 3DS1A 3EJEA 4BPHA 3GZMA 1QVGO 2M8NA 2ROQA 2M8LA 2FAEA 1QVFO 2N5IA 2KODA 2KGCA 7CEIA 4U0EA 2PENA 2KORA 3CC4P 1VQOP 2BHVA 2K92A 2LL8A 4XFXA 1L0IA 2XXMA 4F37A 1EMVA 2EFJA 2KG9A 5HV8A 2QEXP 1VQ5P 3HYBA 3LRYA 1VQ7P 3G1IA 4NEOA 1Q81Q 2E1MA 2M8PA 2N6ZA 4XFZA 2KGDA 1VKUA 1AYIA 3RG6C 5KP6B 3P05A 1ACPA 3G0VA 4PH0A 5F2KA 3CCLP 2L4BA 3LMOA 1T8KA 3Q20A 2FQ1A 5I4TG 2FVEA 2PEIA 1Q86Q 2PEJA 4PH1A 1AF8A 3CCVP 2KG8A 1DV5A 1YJ9P 5EW5E 2FHSC 1IMPA 1UJZA 2FVFA 5HVCA 2ONTA 1K8AQ 3NTEA 2CG5B 2EHTA 2JO0A 2K2QA 3CMAP 2K5XA 2N6YA 3M1MA 3CCJP 2XV6A 1RO0A 4GR2A 2JU1A 4R0MA 1K73Q 1M6NA 5KP7B 3EJDA 2VLOA 4PWVB 3G6EP 4QKOA 2GZJA 1D1DA 5HGMA 2OTLP 4H2XC 2LTEA 2LKIA 4HKGA 1Q7YQ 2KGEA 1DNYA 1M74A 2MF4A 2KOQA 4M0IA 1ZMBA 5DCKA 1YJNP 1VQPP 2MY5A 2CGQA 3DS5A 2K0DX 1FR2A 2N98A 1Q82Q 4U0DA 3CC2P 2PEQA 2X2BA 2VLPA 3VRLC 2MVUA 5HGLA 2LMLA 1NJIQ 1KLPA 1VQ6P 3H47A 2CQ8A 2JBGA 3G4SP 2DNWA 3CCEP 2KW2A 3DS4A 2MD9A 2JYGA 2QNWA 3EJBA 2PEMA 1IMQA 3CCQP 5HGNA 5BS1A 5BS2A 4IZ6A 2GZEA 1EIAA 2L6EA 1RNIA 1E0HA 3H4EA 4XFYA 1CEIA 2CNRA 3G29A 2JU2A 2JB0A 3E2DA 4IPYA 1GXHA 4QNBA 3CCRP 3G28A 2KOOA 5JPAA 1K30A 2Z44A 4GR6A 1RO2A 4XROA 2K93A 3B4QA 4XRQA 1VQ9P 4UHPB 4BPGA 1NQ4A 2GDXA 2CWOA 5F2OA 1YIJP 2ERHA 1HY8A 2K0YA 2EIAA 3NY7B 1IUQA 1M6EX 2FACA 1A8OA 2KGAA 4COPA 2KOSA 3G1GA 1VQ8P 3G71P 1GXGA 2MVVA 1VQNP 2XT1A 2WPTA 4BPFA 1E6JP 3HZQA 5CZDB 2KWLA 1VQLP 3I56P 4WYMA 2DGYA 2L9FA 4H2WC 2FQ0A 2GYKA 3CXCO 1L0HA 2GDYA 2K0XA 1A43A 3CD6P 1UNKA 2AF8A 1VHNA 2OARA 2L0QA 4COCA 2LF4A 3G26A 1Z6MA 3GZLA 1QRJA 2JGPA 4MRTC 1OR5A 3GJNA 1MZ8A 3CE7A 2LIWA 2GZIA 3CPWO 3I55P 2XZ0D 1KQSO 1YHQP 2VLQA 3CC7P 5KP8B 1GPJA 2FVAA 2PEKA 1K9MQ 1KD1Q 5F2NA 3CCSP 2KG6A 2PNGA 3H0DA 3CCMP 3OW2O 1YITP 3DS2A 2FADA 2AFDA 2GDWA 2KR5A 3CMEP 4U0CA 2EG5A 2PEOA 1EOQA 1JJ2O 2KOPA 2LIUA 2PY8A 1ZNVA 2BUOA 1VQKP
chains in the Genus database with same CATH topology
2MF4A 3RG2A 2KOQA 3NY7B 4CA3A 2FACA 2MR7A 2KGAA 2MY5A 2CGQA 2KOSA 2LOLA 2AFEA 1HQBA 2N98A 2LPKA 2MVVA 4NEOA 4BPFA 2X2BA 2MVUA 2LMLA 5CZDB 2KWLA 2N6ZA 1KLPA 2KGDA 2VSQA 1VKUA 5EJDA 2CQ8A 5KP6B 2DNWA 1ACPA 2L9FA 4H2WC 2FQ0A 2KW2A 1L0HA 2GDYA 2K0XA 2JQ4A 2MD9A 2QNWA 2L4BA 3EJBA 3LMOA 1T8KA 2FQ1A 2FVEA 2AF8A 2L0QA 2M5RA 1AF8A 3GZLA 2JGPA 1F80D 4MRTC 2KG8A 1OR5A 2AVAA 2N50A 1DV5A 2N5HA 3CE7A 2FHSC 2LIWA 2L22A 4IZ6A 2FVFA 1X3OA 2XZ0D 5HVCA 2FQ2A 2K94A 2XZ1C 2CG5B 2EHTA 4H2YC 5KP8B 4DG9A 2FVAA 2K2QA 2N6YA 2KG6A 4PXHB 2PNGA 2CNRA 2MR8A 3EJEA 4BPHA 3GZMA 2JU2A 2ROQA 2FAEA 2JU1A 2FADA 4R0MA 2AFDA 2N5IA 2KGCA 2GDWA 1HY8A 2KOOA 2KR5A 5KP7B 3EJDA 4PWVB 2KORA 2K92A 2K93A 2LL8A 4H2XC 2LTEA 1L0IA 2LKIA 4HKGA 4BPGA 1NQ4A 2GDXA 2KGEA 2KOPA 2LIUA 2KG9A 5HV8A 1DNYA 2EHSA 2K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF4 A;  3RG2 A;  2KOQ A;  3NY7 B;  4CA3 A;  2FAC A;  2MR7 A;  2KGA A;  2MY5 A;  2CGQ A;  2KOS A;  2LOL A;  2AFE A;  1HQB A;  2N98 A;  2LPK A;  2MVV A;  4NEO A;  4BPF A;  2X2B A;  2MVU A;  2LML A;  5CZD B;  2KWL A;  2N6Z A;  1KLP A;  2KGD A;  2VSQ A;  1VKU A;  5EJD A;  2CQ8 A;  5KP6 B;  2DNW A;  1ACP A;  2L9F A;  4H2W C;  2FQ0 A;  2KW2 A;  1L0H A;  2GDY A;  2K0X A;  2JQ4 A;  2MD9 A;  2QNW A;  2L4B A;  3EJB A;  3LMO A;  1T8K A;  2FQ1 A;  2FVE A;  2AF8 A;  2L0Q A;  2M5R A;  1AF8 A;  3GZL A;  2JGP A;  1F80 D;  4MRT C;  2KG8 A;  1OR5 A;  2AVA A;  2N50 A;  1DV5 A;  2N5H A;  3CE7 A;  2FHS C;  2LIW A;  2L22 A;  4IZ6 A;  2FVF A;  1X3O A;  2XZ0 D;  5HVC A;  2FQ2 A;  2K94 A;  2XZ1 C;  2CG5 B;  2EHT A;  4H2Y C;  5KP8 B;  4DG9 A;  2FVA A;  2K2Q A;  2N6Y A;  2KG6 A;  4PXH B;  2PNG A;  2CNR A;  2MR8 A;  3EJE A;  4BPH A;  3GZM A;  2JU2 A;  2ROQ A;  2FAE A;  2JU1 A;  2FAD A;  4R0M A;  2AFD A;  2N5I A;  2KGC A;  2GDW A;  1HY8 A;  2KOO A;  2KR5 A;  5KP7 B;  3EJD A;  4PWV B;  2KOR A;  2K92 A;  2K93 A;  2LL8 A;  4H2X C;  2LTE A;  1L0I A;  2LKI A;  4HKG A;  4BPG A;  1NQ4 A;  2GDX A;  2KGE A;  2KOP A;  2LIU A;  2KG9 A;  5HV8 A;  1DNY A;  2EHS A;  2K0Y A; 
#chains in the Genus database with same CATH topology
 3RG2 A;  2VLN A;  1AUM A;  3B5I A;  4CA3 A;  1W2B O;  1M1K Q;  2MR7 A;  1VQ4 P;  1BXI A;  2LOL A;  2AFE A;  3GKL C;  3MGE A;  1HQB A;  2LPK A;  1S72 P;  3DS0 A;  3G21 A;  3DTJ A;  3CCU P;  5HGO A;  2GZG A;  5EJD A;  2VSQ A;  2NO8 A;  4U0A A;  1KC8 Q;  1M90 Q;  2JQ4 A;  2Z45 A;  4U0F A;  3DS3 A;  2M5R A;  1BAJ A;  3U43 A;  1F80 D;  2AVA A;  2N50 A;  2N5H A;  2GZF A;  2L22 A;  3WBH A;  2JYL A;  1YI2 P;  1X3O A;  2P9X A;  3DPH A;  2FQ2 A;  2EHS A;  2K94 A;  2Z46 A;  2XZ1 C;  4H2Y C;  2OTJ P;  2QA4 P;  4DG9 A;  4U0B A;  1VQM P;  1N8R Q;  2JAZ A;  4PXH B;  1YJW P;  2MR8 A;  3DS1 A;  3EJE A;  4BPH A;  3GZM A;  1QVG O;  2M8N A;  2ROQ A;  2M8L A;  2FAE A;  1QVF O;  2N5I A;  2KOD A;  2KGC A;  7CEI A;  4U0E A;  2PEN A;  2KOR A;  3CC4 P;  1VQO P;  2BHV A;  2K92 A;  2LL8 A;  4XFX A;  1L0I A;  2XXM A;  4F37 A;  1EMV A;  2EFJ A;  2KG9 A;  5HV8 A;  2QEX P;  1VQ5 P;  3HYB A;  3LRY A;  1VQ7 P;  3G1I A;  4NEO A;  1Q81 Q;  2E1M A;  2M8P A;  2N6Z A;  4XFZ A;  2KGD A;  1VKU A;  1AYI A;  3RG6 C;  5KP6 B;  3P05 A;  1ACP A;  3G0V A;  4PH0 A;  5F2K A;  3CCL P;  2L4B A;  3LMO A;  1T8K A;  3Q20 A;  2FQ1 A;  5I4T G;  2FVE A;  2PEI A;  1Q86 Q;  2PEJ A;  4PH1 A;  1AF8 A;  3CCV P;  2KG8 A;  1DV5 A;  1YJ9 P;  5EW5 E;  2FHS C;  1IMP A;  1UJZ A;  2FVF A;  5HVC A;  2ONT A;  1K8A Q;  3NTE A;  2CG5 B;  2EHT A;  2JO0 A;  2K2Q A;  3CMA P;  2K5X A;  2N6Y A;  3M1M A;  3CCJ P;  2XV6 A;  1RO0 A;  4GR2 A;  2JU1 A;  4R0M A;  1K73 Q;  1M6N A;  5KP7 B;  3EJD A;  2VLO A;  4PWV B;  3G6E P;  4QKO A;  2GZJ A;  1D1D A;  5HGM A;  2OTL P;  4H2X C;  2LTE A;  2LKI A;  4HKG A;  1Q7Y Q;  2KGE A;  1DNY A;  1M74 A;  2MF4 A;  2KOQ A;  4M0I A;  1ZMB A;  5DCK A;  1YJN P;  1VQP P;  2MY5 A;  2CGQ A;  3DS5 A;  2K0D X;  1FR2 A;  2N98 A;  1Q82 Q;  4U0D A;  3CC2 P;  2PEQ A;  2X2B A;  2VLP A;  3VRL C;  2MVU A;  5HGL A;  2LML A;  1NJI Q;  1KLP A;  1VQ6 P;  3H47 A;  2CQ8 A;  2JBG A;  3G4S P;  2DNW A;  3CCE P;  2KW2 A;  3DS4 A;  2MD9 A;  2JYG A;  2QNW A;  3EJB A;  2PEM A;  1IMQ A;  3CCQ P;  5HGN A;  5BS1 A;  5BS2 A;  4IZ6 A;  2GZE A;  1EIA A;  2L6E A;  1RNI A;  1E0H A;  3H4E A;  4XFY A;  1CEI A;  2CNR A;  3G29 A;  2JU2 A;  2JB0 A;  3E2D A;  4IPY A;  1GXH A;  4QNB A;  3CCR P;  3G28 A;  2KOO A;  5JPA A;  1K30 A;  2Z44 A;  4GR6 A;  1RO2 A;  4XRO A;  2K93 A;  3B4Q A;  4XRQ A;  1VQ9 P;  4UHP B;  4BPG A;  1NQ4 A;  2GDX A;  2CWO A;  5F2O A;  1YIJ P;  2ERH A;  1HY8 A;  2K0Y A;  2EIA A;  3NY7 B;  1IUQ A;  1M6E X;  2FAC A;  1A8O A;  2KGA A;  4COP A;  2KOS A;  3G1G A;  1VQ8 P;  3G71 P;  1GXG A;  2MVV A;  1VQN P;  2XT1 A;  2WPT A;  4BPF A;  1E6J P;  3HZQ A;  5CZD B;  2KWL A;  1VQL P;  3I56 P;  4WYM A;  2DGY A;  2L9F A;  4H2W C;  2FQ0 A;  2GYK A;  3CXC O;  1L0H A;  2GDY A;  2K0X A;  1A43 A;  3CD6 P;  1UNK A;  2AF8 A;  1VHN A;  2OAR A;  2L0Q A;  4COC A;  2LF4 A;  3G26 A;  1Z6M A;  3GZL A;  1QRJ A;  2JGP A;  4MRT C;  1OR5 A;  3GJN A;  1MZ8 A;  3CE7 A;  2LIW A;  2GZI A;  3CPW O;  3I55 P;  2XZ0 D;  1KQS O;  1YHQ P;  2VLQ A;  3CC7 P;  5KP8 B;  1GPJ A;  2FVA A;  2PEK A;  1K9M Q;  1KD1 Q;  5F2N A;  3CCS P;  2KG6 A;  2PNG A;  3H0D A;  3CCM P;  3OW2 O;  1YIT P;  3DS2 A;  2FAD A;  2AFD A;  2GDW A;  2KR5 A;  3CME P;  4U0C A;  2EG5 A;  2PEO A;  1EOQ A;  1JJ2 O;  2KOP A;  2LIU A;  2PY8 A;  1ZNV A;  2BUO A;  1VQK P; 
#chains in the Genus database with same CATH homology
 2MF4 A;  3RG2 A;  2KOQ A;  3NY7 B;  4CA3 A;  2FAC A;  2MR7 A;  2KGA A;  2MY5 A;  2CGQ A;  2KOS A;  2LOL A;  2AFE A;  1HQB A;  2N98 A;  2LPK A;  2MVV A;  4NEO A;  4BPF A;  2X2B A;  2MVU A;  2LML A;  5CZD B;  2KWL A;  2N6Z A;  1KLP A;  2KGD A;  2VSQ A;  1VKU A;  5EJD A;  2CQ8 A;  5KP6 B;  2DNW A;  1ACP A;  2L9F A;  4H2W C;  2FQ0 A;  2KW2 A;  1L0H A;  2GDY A;  2K0X A;  2JQ4 A;  2MD9 A;  2QNW A;  2L4B A;  3EJB A;  3LMO A;  1T8K A;  2FQ1 A;  2FVE A;  2AF8 A;  2L0Q A;  2M5R A;  1AF8 A;  3GZL A;  2JGP A;  1F80 D;  4MRT C;  2KG8 A;  1OR5 A;  2AVA A;  2N50 A;  1DV5 A;  2N5H A;  3CE7 A;  2FHS C;  2LIW A;  2L22 A;  4IZ6 A;  2FVF A;  1X3O A;  2XZ0 D;  5HVC A;  2FQ2 A;  2K94 A;  2XZ1 C;  2CG5 B;  2EHT A;  4H2Y C;  5KP8 B;  4DG9 A;  2FVA A;  2K2Q A;  2N6Y A;  2KG6 A;  4PXH B;  2PNG A;  2CNR A;  2MR8 A;  3EJE A;  4BPH A;  3GZM A;  2JU2 A;  2ROQ A;  2FAE A;  2JU1 A;  2FAD A;  4R0M A;  2AFD A;  2N5I A;  2KGC A;  2GDW A;  1HY8 A;  2KOO A;  2KR5 A;  5KP7 B;  3EJD A;  4PWV B;  2KOR A;  2K92 A;  2K93 A;  2LL8 A;  4H2X C;  2LTE A;  1L0I A;  2LKI A;  4HKG A;  4BPG A;  1NQ4 A;  2GDX A;  2KGE A;  2KOP A;  2LIU A;  2KG9 A;  5HV8 A;  1DNY A;  2EHS A;  2K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...