2LNHC

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
b'LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural Wiskott-Aldrich syndrome protein
publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.830 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lnhC00
2LNHC
chains in the Genus database with same CATH superfamily
4OVZB 4FWGA 3VDUA 3CF0A 2ZTCA 4L8RC 1N78A 3D8BA 3J2PB 4GC9A 3VLFB 3JAMS 1HT2E 3B9PA 4LGMA 1GABA 1J7KA 2P5TA 2CV0A 4JI6M 4L4UA 5ITXA 1OFIA 5FTMA 3PXGA 1AUAA 4DR6M 4IBGA 2K6BA 1R6BX 2K47A 3KDSE 3GLHA 4L16A 3C3EA 4DV4M 3GLFA 1R2YA 2BWEA 3C58A 4JXJA 4DR7M 3SARA 4MGKE 2I7NA 3WHLA 4AKGA 2H1RA 3GRVA 4B3MM 3GLGE 3SMSA 2CP8A 2VIIA 4GC5A 4G4NA 2DAMA 4FCTA 3U6EA 1L2DA 1YLAA 4JI3M 3AOGA 1XXHB 3GRYA 3KXEC 3NBXX 4ZPXA 1IFYA 2APLA 4LF9M 3ZC7B 4FWDA 5KQ8A 4QNMA 3DZDA 1QAMA 1L1TA 3FYDA 2OOAA 2CRUA 2LHGA 3PFIA 2LHCA 4S12A 2R65A 2LNHC 4NRWA 2QPAA 1IY2A 5EP2A 3KOZE 1WHCA 1TH4A 2O25A 5FTJA 4LJ4A 2DWZB 2UUAM 4X65M 1AIPC 1PJSA 4WURA 1ZMWA 2NQ8C 2ZBKB 5DYIA 1L1ZA 3KP0E 1OTRA 2R4EA 4NC6A 4G4RA 2CV1A 4GRIA 4FCVA 4PDIA 4DV6M 1A5TA 2DAIA 1GJSA 3FTFA 2KXEA 1E9SA 2MJ5B 2DWNA 3HX3A 3AL0C 2UXBM 4QNRA 2G3QA 2XZFA 1GJTA 1Q3CA 1OKSA 3KVWA 4MGIE 4FCWA 1QZEA 2V1CA 3A42A 3GRRA 2F4VM 4CJ6A 2HL7A 4RNAA 3KSJA 3MK6A 4M9SA 3Q8GA 4REZA 2YFQA 4AG5A 4NSRA 5C18A 3GO8A 1S3SA 2QENA 5DFLA 3THGA 1K82A 2XLJA 1UM8A 4X62M 2Z7JA 2L2DA 4KLNA 2VDBB 4G3OA 4IBKA 3SHGB 5LMUM 1DV0A 3F92A 1VDDA 3CF6E 1I94M 1N33M 3EIHA 1T43A 4G6ZA 5ITXE 1TGUA 4L6V6 3BBZA 1RU3A 1EFUB 3GLIE 2J7NA 1R4GA 4MGHA 4JYAM 3GLHE 4MGZE 1L2CA 4WW0A 1PJQA 2X4AA 1QQWA 3FUVA 3GLFE 1G71A 2X8AA 4LFCM 4FW9A 3FTDA 5ITRA 2LVAA 4TUWA 1OAOC 1G3IA 3GRUA 3KOYE 3CGWA 4CHTB 4FVMA 4IBFA 2DI0A 5EXTA 3M0EA 3VK8A 3U5ZB 5KO3A 2Q2EB 3LW5F 4M9XA 3SATA 5FSWA 2DAGA 4OVZA 1IXRC 2QHOB 3U6PA 2ZAMA 1IM2A 2QNJA 4RF1A 5H37D 3A46A 2JP7A 5IWAM 2FNAA 3KSXA 3TWLA 4JI4M 1MN3A 2QP9X 3HJQA 4B7HA 3SYKA 3FTCA 4LRSA 4BLCA 2EUCA 5L8RF 3MHVC 1V33A 1LV7A 2LH0A 1TH3A 1XB2B 1W5TA 3HU1A 1N36M 3FUWA 4L78A 4DR5M 4I8OA 3TWKA 1G59A 1OAIA 2OQ4A 2QQ8A 3B74A 1CUKA 3LQRA 3GPXA 1IXSB 1WIVA 3IHPA 1YE9A 2DWLA 1Q39A 1EE8A 1VG5A 2UXDM 2DAKA 1I4WA 3UK6A 1DGHB 4Z8XA 1XXHA 4AKHA 2LVNC 4NXMM 1QAQA 2EA0A 1GLNA 4JI2M 3KS4A 3J81S 4LJ6A 5EQTA 2BWBA 3U6MA 1XMQM 2QZ4A 4KHPM 4B3SM 4MB7A 3U6QA 1NSFA 3U61B 1N77A 3IG5A 3E21A 4B7FA 1HR0M 1GKIA 2CHGA 2RRUA 5JI3E 3SAUA 3J27B 2G5GX 2M5ZA 4NOOB 4XGIA 5EP3A 1J09A 4QHTA 5ITTA 2O5RA 2GNOA 3TE6A 3SBJA 1NJGA 1YUBA 2XGNA 2R6FA 2WSCF 3H4MA 3K92A 4DV5M 3L25A 1Z6TA 3U6OA 1OFHA 1R7RA 2R44A 1NNJA 3LVWA 1JQJC 1E9RA 1PRBA 1VEGA 3CF2A 1NO1A 3DOAA 3FKEA 2KZSA 3LQQA 3QYEA 1N75A 1P3QQ 2JNHA 5GKNA 3TQSA 1IN7A 2CEAA 1ORYB 4PCZA 2VQEM 2D7GA 1YSYA 5FTKA 1OIZA 3RFWA 2L6OA 1NV8A 3FYCA 2LVOC 2QSFX 3C3DA 3U6LA 4PT5A 2C9OA 1QANA 4RF0A 5KPZA 2FS1A 1HQCA 2KEBA 2Y0TA 2OPFA 5IREB 3K1JA 3ZCBB 4CIZA 4DR2M 4CISA 2QBYB 1Z5CA 3I04M 3KP1E 1T6OA 2W82A 1VQ1A 3FUTA 3SC3A 4JI5M 2EJSA 3T15A 2V1UA 3T6PA 1KFVA 3ZH9B 5IZ7D 4LJAA 1ZMVA 4M9ZA 4LF6M 2FOIC 1MX0A 2X49A 4LFAM 4OX9M 4JV5M 1ZMUA 2DHYA 4F1IA 1XWIA 1JR3D 4IJEA 2Y21A 2DWMA 2F5NA 4NRVA 3B89A 3FRHA 3U5ZA 2JA2A 1D0KA 3LCUA 2KNAA 2KRUA 4LF7M 3AFHA 4G4QA 1Q02A 2OO9A 1IN8A 3FUXA 1PM5A 1TF0B 1SXJE 3PNVA 3KFUG 4RKUF 1HNWM 3TWMA 4LCBA 3GPUA 3RGPA 2H5XA 1FJGM 1IBKM 1IY0A 3HHWA 5BPVA 2CUZA 2R18A 3L26A 3K9PA 2LVQD 2JY7A 2DENA 3K8ZA 3A98B 1TR8A 5KPRA 4MH0E 3JR4A 2DHRA 1SG9A 3VKGA 2C5RA 2F5PA 1C1KA 4LF8M 8CATA 1IXSA 3GPYA 5A2QS 4B7GA 1T3TA 1TH2A 4D82A 3GLIB 1DGHA 3A45A 4QHSA 4X64M 2M60A 3EIEA 3HHXA 1PJTA 1XMOM 3GLFB 1NNUC 4IBDA 4LGYA 2D7EA 1ZQ9A 1HNZM 2KNZA 3FE3A 4FWHA 3U60A 7CATA 3SMPA 1X37A 3LMMA 2VF7A 3L27A 1ZV1A 2HKJA 5FTNA 3T1YM 4LZZA 2B3TA 1OIPA 2VF8A 4MM3B 2YR0A 3AKZA 3U61A 1DGFA 4GHLA 3FD9A 1IY1A 1IQPA 3QYBA 3V76A 1R2ZA 3KOWE 4D81A 3AV0A 2XEPA 4GITA 5EJCA 1QVRA 3T38A 4GIPA 1V34A 2JUJA 3NBIA 3QAUA 3K9OA 3C9PA 3T1HM 4IJFA 2XSZD 3RGSA 2ZTDA 1MJGM 3H4JA 4B3RM 4EIWA 3K2LA 5C1BA 3FRIA 1IN4A 3W0LB 4OU7A 2DVWB 1TDHA 3GPPA 4HEOA 2JY8A 2K9DA 4NSOB 5ITYA 1WJ7A 4A3VB 2WSEF 3JR5A 3GP1A 3SAVA 5KQDA 2OOBA 2Y20A 2C96A 1KYIA 1XNQM 3SYLA 1Q3BA 1XHBA 2ERCA 2R45A 1IN5A 1QUSA 2YNMD 3KOXE 2I7PA 1WGNA 1QDTA 1L2BA 1GL7A 2UU9M 1EIJA 2Z3XA 2XZUA 3UMMA 2CWBA 2QBYA 4DV7M 4LJ5A 4D80A 1PJJA 4XBOA 4HLQA 4JI0M 5FTLA 2LXEA 4FD2A 1TDZA 1UFZA 1NV9A 3DA1A 1PGYA 4DUZM 4AZFA 3SFZA 2Z8YM 2GQFA 2KZUA 4NL4H 1OJLA 2UUBM 2F5QA 4M0DA 4GMQA 1GVNA 3CTWB 1E32A 3AJIB 2BJVA 3B7QA 4LRTA 4LY6A 2KNVA 2CFOA 4LF5M 4UN2B 3J7BA 3L29A 2QCUA 4LJ8A 2CHQA 4IBEA 2C98A 4DR4M 1QUTA 3GQ4A 3FUUA 4Q7JA 3GLGB 4W5WA 1SXJD 5IT9S 2C9CA 3MMPA 1DGBA 1ZAEA 1IXZA 2R0IA 4L15A 3PNYA 1FNNA 1QZMA 2RKOA 2Z4SA 4I5SA 5EP4A 3U6DA 1WXQA 3KS8A 3VKHA 1H6UA 1TTEA 1DO0A 2JY5A 2LVPC 3HZJA 3HU3A 4DV0M 1K3WA 2V6ZM 3R8FA 4DUYM 3SHFA 2R4JA 2E5LM 3B7ZA 4PD2A 4JI8M 2DKLA 4AKIA 2O01F 3GLIA 3UJNA 1Z5BA 1JR3A 4CGYB 5BR8M 5E6JA 3E46A 2FFJA 2JWSA 2DAEA 3L2AA 2KA6B 4YHHM 2J7OA 1Y8GA 2L09A 1VEKA 3HGIA 3AOEC 3MJ5A 4GHAA 2XFTA 4F2LA 1W5SA 2BJWA 2XH9A 1QYRA 4YY3M 1J5EM 2YQZA 3WHKA 4LF4M 2DZNB 1XXHE 1HQYE 3UZUA 4BBAA 1D2NA 2CE7A 1SXJB 3HWSA 4R71A 2VQFM 3BOSA 4GKKM 2UUCM 1VEJA 3VK7A 4JI7M 2DZOB 2JZ0A 2WSFF 3HKPA 4WP2A 4JN6A 1NJFA 2BNKA 2K0BX 4G4OA 3I4YA 3SASA 4HL4A 4LZJA 3GQ3A 4AG6A 3I4VA 4NXNM 4K0KM 3U6CA 3M6AA 4LJ7A 3IECA 2G8LA 2JY6B 3AOEA 4ANRA 1GL6A 3IG8A 2HCBA 4ITQA 1LTMA 3HJSA 3W68A 3FTEA 1NHGC 2R62A 2KHHA 2Y0QA 2EKFA 3GLHB 1G8PA 5F3WA 4IBBA 4AQYM 2UXCM 1VDLA 5FLXS 1HT1E 1C7YA 3OTOM 5EXPA 4XK8F 2JXNA 3RE8A 4DR3M 4B3TM 1IN6A 3SAWA 1N32M 4I81A 4IIWA 5E26A 3HHZA 4LFBM 4P17A 4GH9A 1R5LA 2EKKA 1Z5AA 2R46A 2D7HA 2DNAA 4Z6YA 2L7IA 4LG2A 1NVMA 1D0LA 3I51A 5EP1A 3U6SA 1JB0F 3Q8XA 3I01M 4I4LA 4QOSA 5EXSA 1KSFX 4LJ9A 3HHYA 4PDGA 5KPTA 2XSZA 4II7A 3DFZA 1GO5A 2KRKA 1G41A 4JI1M 3J7AS 1JR3E 5JI2E 2MROB 2CHVA 5ITQA 2L4FA 2KDLA 4R7GA 4GEWA 3LVVA 1BVSA 1DGGA 1OQYA 2HWJA 1MU5A 1L8QA 5DYGA 3R9XB 4DV3M 3M7GA 3BXWA 3HJ8A 4R3DA 1Z59A 1XC8A 5DNYA 1IBMM 1WGLA 1QDRA 3NWLA 3W0FA 3GLGA 2HHHM 2FE8A 4IBJA 3L28A 1N34M 1HJPA 2WZJA 1SXJC 4AW4A 1NY6A 3LCVB 4BB9A 2MH8A 2ZANA 5EXXA 3HY5A 4QOZC 3B7NA 4GKJM 4IBIA 1XNRM 1NY5A 2F5SA 2KW0A 2ZAOA 4DV1M 4DBGB 2DZLA 2Z4RA 3D8LA 4KT0F 3HU2A 2N35A 3ILKA 2RGHA 1E94E 1HNXM 4Y28F 1D0MA 1DO2A 2LBCA 2EO2A 2XF3A 3E4RA 1IBLM 2HAKA 4DR1M 4AI6A 2DXIA 1G4AE 3KW6A 2AHMA 2A5YB 5ITUA 2L4EA 1NHWC 3GQ5A 2RGOA 2LWXA 3VFDA 3J80S 3VDPA 1PJIA 2L7HA 4KO8A 2ZM6M 4KODA 3TPZA 4B08A 1K3XA 1F4IA 3W67A 3E9SA 2MGWA 1WR1B 3ZQJA 1QAOA 4DV2M 2MR9A 2F5OA 4X66M 1SXJA 3U60B 2LTUA 2J5YA 5LMNM 2XFSA 3UGJA 2C99A 2JZ1A 4P16A 1V92A 3QWLA 2FH0A 3PVSA 4OW0A 2CV2A 4M0WA 3TL4X 4IBCA 4MGYE
chains in the Genus database with same CATH topology
4OVZB 4FWGA 3VDUA 3CF0A 4L8RC 1N78A 3D8BA 3J2PB 4GC9A 3VLFB 3JAMS 1HT2E 3B9PA 4LGMA 1J7KA 2P5TA 2CV0A 4JI6M 4L4UA 5ITXA 1OFIA 5FTMA 3PXGA 4DR6M 4IBGA 1R6BX 2K47A 3KDSE 3GLHA 4L16A 4DV4M 3GLFA 1R2YA 3C58A 4DR7M 3SARA 4MGKE 2I7NA 3WHLA 4AKGA 2H1RA 3GRVA 4B3MM 3SMSA 2VIIA 4GC5A 4G4NA 3U6EA 4FCTA 1L2DA 4JI3M 3AOGA 1XXHB 3GRYA 3KXEC 4ZPXA 4LF9M 3ZC7B 4FWDA 5KQ8A 4QNMA 3DZDA 1QAMA 1L1TA 3FYDA 3PFIA 4S12A 2R65A 2LNHC 4NRWA 2QPAA 1IY2A 5EP2A 3KOZE 1TH4A 5FTJA 4LJ4A 2DWZB 2UUAM 4X65M 4WURA 5DYIA 2ZBKB 2NQ8C 1L1ZA 3KP0E 2R4EA 4G4RA 2CV1A 4GRIA 4FCVA 4PDIA 4DV6M 3FTFA 2KXEA 1E9SA 2UXBM 2DWNA 3AL0C 4QNRA 2XZFA 1Q3CA 3KVWA 4MGIE 4FCWA 2V1CA 3A42A 3GRRA 2F4VM 2HL7A 4RNAA 3KSJA 3MK6A 4M9SA 4REZA 4AG5A 2YFQA 4NSRA 5C18A 3GO8A 1S3SA 2QENA 3THGA 1K82A 2XLJA 1UM8A 4X62M 2Z7JA 4KLNA 3SHGB 4IBKA 5LMUM 1VDDA 3CF6E 1I94M 1N33M 3EIHA 4G6ZA 5ITXE 1TGUA 2J7NA 4MGHA 4JYAM 4MGZE 1L2CA 4WW0A 3FUVA 2X4AA 1QQWA 4LFCM 2X8AA 4FW9A 3FTDA 5ITRA 4TUWA 1G3IA 3GRUA 3KOYE 4CHTB 4FVMA 4IBFA 5EXTA 3M0EA 3VK8A 3U5ZB 5KO3A 2Q2EB 4M9XA 3SATA 5FSWA 4OVZA 1IXRC 3U6PA 2ZAMA 1IM2A 4RF1A 5H37D 3A46A 5IWAM 2FNAA 3KSXA 3TWLA 4JI4M 2QP9X 3HJQA 4B7HA 3SYKA 3FTCA 4LRSA 4BLCA 2EUCA 3MHVC 1LV7A 2LH0A 1TH3A 1W5TA 3HU1A 1N36M 3FUWA 4L78A 4DR5M 4I8OA 3TWKA 1G59A 2OQ4A 3LQRA 3GPXA 1IXSB 1YE9A 2DWLA 1Q39A 1EE8A 2UXDM 1I4WA 3UK6A 1DGHB 4Z8XA 1XXHA 4AKHA 4NXMM 1QAQA 2EA0A 1GLNA 4JI2M 3KS4A 3J81S 4LJ6A 5EQTA 3U6MA 1XMQM 4KHPM 2QZ4A 4B3SM 4MB7A 3U6QA 1NSFA 3U61B 1N77A 3IG5A 4B7FA 1HR0M 1GKIA 2CHGA 5JI3E 3SAUA 3J27B 2G5GX 2M5ZA 4NOOB 4XGIA 5EP3A 1J09A 4QHTA 5ITTA 2O5RA 3TE6A 3SBJA 1NJGA 1YUBA 2XGNA 3H4MA 3K92A 4DV5M 3L25A 1Z6TA 3U6OA 1OFHA 1R7RA 1NNJA 3LVWA 1JQJC 1E9RA 3DOAA 3CF2A 3LQQA 4JXJA 3FKEA 3OTOM 2KZSA 2OPFA 3TQSA 1N75A 5GKNA 4PCZA 3SAWA 1IN7A 2CEAA 1ORYB 2VQEM 2D7GA 1YSYA 5FTKA 3RFWA 2L6OA 3FYCA 3U6LA 4PT5A 2C9OA 1QANA 4RF0A 5KPZA 2KEBA 1HQCA 2Y0TA 5IREB 3K1JA 3ZCBB 4DR2M 4CISA 2QBYB 1Z5CA 3KP1E 2W82A 3FUTA 3SC3A 4JI5M 3T15A 2V1UA 1KFVA 3ZH9B 5IZ7D 4LJAA 4M9ZA 4LF6M 2FOIC 1MX0A 2X49A 4LFAM 4OX9M 4JV5M 1XWIA 1JR3D 4IJEA 2Y21A 2DWMA 2F5NA 4NRVA 3U5ZA 2JA2A 2KRUA 4LF7M 3AFHA 4G4QA 1IN8A 3FUXA 1PM5A 1SXJE 3PNVA 3KFUG 1HNWM 3TWMA 4LCBA 3GPUA 3RGPA 1FJGM 1IBKM 1IY0A 3HHWA 5BPVA 2CUZA 2R18A 3L26A 3K8ZA 3A98B 5KPRA 4MH0E 3JR4A 2DHRA 3VKGA 2C5RA 2F5PA 1C1KA 4LF8M 8CATA 3GPYA 5A2QS 4B7GA 1T3TA 1TH2A 4D82A 3GLIB 1DGHA 3A45A 4QHSA 4X64M 2M60A 3EIEA 3HHXA 1XMOM 3GLFB 1NNUC 4IBDA 4LGYA 2D7EA 1ZQ9A 1HNZM 4FWHA 3U60A 7CATA 3SMPA 1X37A 3LMMA 3L27A 2HKJA 5FTNA 3T1YM 4LZZA 3U61A 4MM3B 2YR0A 3AKZA 1DGFA 4GHLA 3FD9A 1IY1A 1IQPA 1R2ZA 3KOWE 4D81A 3AV0A 2XEPA 4GITA 5EJCA 1QVRA 3T38A 4GIPA 3NBIA 3QAUA 3T1HM 4IJFA 2XSZD 3RGSA 4B3RM 4EIWA 3K2LA 5C1BA 1IN4A 3W0LB 4OU7A 2DVWB 1TDHA 3GPPA 4NSOB 5ITYA 4A3VB 3JR5A 3GP1A 3SAVA 5KQDA 2Y20A 2C96A 1KYIA 1XNQM 3SYLA 1Q3BA 1XHBA 2ERCA 2R45A 1IN5A 3KOXE 2YNMD 2I7PA 2UU9M 1L2BA 1GL7A 2Z3XA 2XZUA 3UMMA 2QBYA 4DV7M 4LJ5A 4D80A 1PJJA 4XBOA 4HLQA 4JI0M 5FTLA 2LXEA 4FD2A 1TDZA 3DA1A 4DUZM 4AZFA 3SFZA 2KZUA 4NL4H 1OJLA 2UUBM 2F5QA 4M0DA 4GMQA 1GVNA 3CTWB 1E32A 3AJIB 2BJVA 4LRTA 4LY6A 4LF5M 2CFOA 3J7BA 3L29A 2QCUA 4LJ8A 2CHQA 4IBEA 2C98A 4DR4M 3GQ4A 3FUUA 3GLGB 4W5WA 1SXJD 5IT9S 2C9CA 1DGBA 1ZAEA 1IXZA 4L15A 3PNYA 1FNNA 1QZMA 2RKOA 2Z4SA 4I5SA 5EP4A 3U6DA 1WXQA 3KS8A 3VKHA 1H6UA 1DO0A 3HU3A 4DV0M 1K3WA 2V6ZM 3R8FA 4DUYM 3SHFA 2R4JA 2E5LM 4PD2A 4AKIA 4JI8M 3GLIA 3UJNA 1Z5BA 1JR3A 4CGYB 5BR8M 5E6JA 2FFJA 3L2AA 2KA6B 4YHHM 2J7OA 2L09A 3HGIA 3AOEC 3MJ5A 4GHAA 2XFTA 1W5SA 2BJWA 2XH9A 1QYRA 4YY3M 1J5EM 2YQZA 3WHKA 4LF4M 2DZNB 4BBAA 1HQYE 3UZUA 1D2NA 2CE7A 1SXJB 3HWSA 2VQFM 3BOSA 4GKKM 2UUCM 3VK7A 4JI7M 2DZOB 3HKPA 4JN6A 1NJFA 2BNKA 4G4OA 3SASA 3I4YA 4HL4A 4LZJA 3GQ3A 4AG6A 3I4VA 4NXNM 4K0KM 3U6CA 3M6AA 4LJ7A 2G8LA 3AOEA 1GL6A 3IG8A 2HCBA 4ITQA 3HJSA 3FTEA 1NHGC 2R62A 2Y0QA 3GLHB 1G8PA 5F3WA 4IBBA 4AQYM 2UXCM 5FLXS 1HT1E 5EXPA 4B3TM 4DR3M 3RE8A 1IN6A 1N32M 4I81A 4IIWA 5E26A 3HHZA 4LFBM 4GH9A 1Z5AA 2R46A 2D7HA 4Z6YA 2L7IA 4LG2A 1NVMA 3I51A 5EP1A 3U6SA 3Q8XA 4QOSA 4I4LA 5EXSA 3HHYA 1KSFX 4LJ9A 4PDGA 5KPTA 2XSZA 4II7A 3DFZA 2KRKA 1G41A 4JI1M 3J7AS 5JI2E 2CHVA 5ITQA 4R7GA 3LVVA 1DGGA 5DYGA 1MU5A 1L8QA 3R9XB 4DV3M 3M7GA 4R3DA 3HJ8A 1XC8A 1Z59A 1IBMM 5DNYA 3W0FA 3NWLA 3GLGA 2HHHM 2FE8A 4IBJA 3L28A 1N34M 4AW4A 1SXJC 1NY6A 4BB9A 2ZANA 5EXXA 4QOZC 4GKJM 4IBIA 1XNRM 1NY5A 2F5SA 2KW0A 2ZAOA 4DV1M 2Z4RA 3D8LA 3HU2A 3ILKA 2RGHA 1E94E 1HNXM 1DO2A 2EO2A 2XF3A 3E4RA 1IBLM 4DR1M 4AI6A 2DXIA 1G4AE 3KW6A 2AHMA 2A5YB 5ITUA 1NHWC 3GQ5A 2RGOA 2LWXA 3VFDA 3J80S 3VDPA 1PJIA 2L7HA 4KO8A 2ZM6M 4KODA 3TPZA 4B08A 1K3XA 3E9SA 1QAOA 4DV2M 2F5OA 4X66M 1SXJA 3U60B 5LMNM 2XFSA 3UGJA 2C99A 4P16A 3QWLA 3PVSA 4OW0A 2CV2A 4M0WA 3TL4X 4IBCA 4MGYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH C; 
#chains in the Genus database with same CATH topology
 4OVZ B;  4FWG A;  3VDU A;  3CF0 A;  2ZTC A;  4L8R C;  1N78 A;  3D8B A;  3J2P B;  4GC9 A;  3VLF B;  3JAM S;  1HT2 E;  3B9P A;  4LGM A;  1GAB A;  1J7K A;  2P5T A;  2CV0 A;  4JI6 M;  4L4U A;  5ITX A;  1OFI A;  5FTM A;  3PXG A;  1AUA A;  4DR6 M;  4IBG A;  2K6B A;  1R6B X;  2K47 A;  3KDS E;  3GLH A;  4L16 A;  3C3E A;  4DV4 M;  3GLF A;  1R2Y A;  2BWE A;  3C58 A;  4JXJ A;  4DR7 M;  3SAR A;  4MGK E;  2I7N A;  3WHL A;  4AKG A;  2H1R A;  3GRV A;  4B3M M;  3GLG E;  3SMS A;  2CP8 A;  2VII A;  4GC5 A;  4G4N A;  2DAM A;  4FCT A;  3U6E A;  1L2D A;  1YLA A;  4JI3 M;  3AOG A;  1XXH B;  3GRY A;  3KXE C;  3NBX X;  4ZPX A;  1IFY A;  2APL A;  4LF9 M;  3ZC7 B;  4FWD A;  5KQ8 A;  4QNM A;  3DZD A;  1QAM A;  1L1T A;  3FYD A;  2OOA A;  2CRU A;  2LHG A;  3PFI A;  2LHC A;  4S12 A;  2R65 A;  2LNH C;  4NRW A;  2QPA A;  1IY2 A;  5EP2 A;  3KOZ E;  1WHC A;  1TH4 A;  2O25 A;  5FTJ A;  4LJ4 A;  2DWZ B;  2UUA M;  4X65 M;  1AIP C;  1PJS A;  4WUR A;  1ZMW A;  2NQ8 C;  2ZBK B;  5DYI A;  1L1Z A;  3KP0 E;  1OTR A;  2R4E A;  4NC6 A;  4G4R A;  2CV1 A;  4GRI A;  4FCV A;  4PDI A;  4DV6 M;  1A5T A;  2DAI A;  1GJS A;  3FTF A;  2KXE A;  1E9S A;  2MJ5 B;  2DWN A;  3HX3 A;  3AL0 C;  2UXB M;  4QNR A;  2G3Q A;  2XZF A;  1GJT A;  1Q3C A;  1OKS A;  3KVW A;  4MGI E;  4FCW A;  1QZE A;  2V1C A;  3A42 A;  3GRR A;  2F4V M;  4CJ6 A;  2HL7 A;  4RNA A;  3KSJ A;  3MK6 A;  4M9S A;  3Q8G A;  4REZ A;  2YFQ A;  4AG5 A;  4NSR A;  5C18 A;  3GO8 A;  1S3S A;  2QEN A;  5DFL A;  3THG A;  1K82 A;  2XLJ A;  1UM8 A;  4X62 M;  2Z7J A;  2L2D A;  4KLN A;  2VDB B;  4G3O A;  4IBK A;  3SHG B;  5LMU M;  1DV0 A;  3F92 A;  1VDD A;  3CF6 E;  1I94 M;  1N33 M;  3EIH A;  1T43 A;  4G6Z A;  5ITX E;  1TGU A;  4L6V 6;  3BBZ A;  1RU3 A;  1EFU B;  3GLI E;  2J7N A;  1R4G A;  4MGH A;  4JYA M;  3GLH E;  4MGZ E;  1L2C A;  4WW0 A;  1PJQ A;  2X4A A;  1QQW A;  3FUV A;  3GLF E;  1G71 A;  2X8A A;  4LFC M;  4FW9 A;  3FTD A;  5ITR A;  2LVA A;  4TUW A;  1OAO C;  1G3I A;  3GRU A;  3KOY E;  3CGW A;  4CHT B;  4FVM A;  4IBF A;  2DI0 A;  5EXT A;  3M0E A;  3VK8 A;  3U5Z B;  5KO3 A;  2Q2E B;  3LW5 F;  4M9X A;  3SAT A;  5FSW A;  2DAG A;  4OVZ A;  1IXR C;  2QHO B;  3U6P A;  2ZAM A;  1IM2 A;  2QNJ A;  4RF1 A;  5H37 D;  3A46 A;  2JP7 A;  5IWA M;  2FNA A;  3KSX A;  3TWL A;  4JI4 M;  1MN3 A;  2QP9 X;  3HJQ A;  4B7H A;  3SYK A;  3FTC A;  4LRS A;  4BLC A;  2EUC A;  5L8R F;  3MHV C;  1V33 A;  1LV7 A;  2LH0 A;  1TH3 A;  1XB2 B;  1W5T A;  3HU1 A;  1N36 M;  3FUW A;  4L78 A;  4DR5 M;  4I8O A;  3TWK A;  1G59 A;  1OAI A;  2OQ4 A;  2QQ8 A;  3B74 A;  1CUK A;  3LQR A;  3GPX A;  1IXS B;  1WIV A;  3IHP A;  1YE9 A;  2DWL A;  1Q39 A;  1EE8 A;  1VG5 A;  2UXD M;  2DAK A;  1I4W A;  3UK6 A;  1DGH B;  4Z8X A;  1XXH A;  4AKH A;  2LVN C;  4NXM M;  1QAQ A;  2EA0 A;  1GLN A;  4JI2 M;  3KS4 A;  3J81 S;  4LJ6 A;  5EQT A;  2BWB A;  3U6M A;  1XMQ M;  2QZ4 A;  4KHP M;  4B3S M;  4MB7 A;  3U6Q A;  1NSF A;  3U61 B;  1N77 A;  3IG5 A;  3E21 A;  4B7F A;  1HR0 M;  1GKI A;  2CHG A;  2RRU A;  5JI3 E;  3SAU A;  3J27 B;  2G5G X;  2M5Z A;  4NOO B;  4XGI A;  5EP3 A;  1J09 A;  4QHT A;  5ITT A;  2O5R A;  2GNO A;  3TE6 A;  3SBJ A;  1NJG A;  1YUB A;  2XGN A;  2R6F A;  2WSC F;  3H4M A;  3K92 A;  4DV5 M;  3L25 A;  1Z6T A;  3U6O A;  1OFH A;  1R7R A;  2R44 A;  1NNJ A;  3LVW A;  1JQJ C;  1E9R A;  1PRB A;  1VEG A;  3CF2 A;  1NO1 A;  3DOA A;  3FKE A;  2KZS A;  3LQQ A;  3QYE A;  1N75 A;  1P3Q Q;  2JNH A;  5GKN A;  3TQS A;  1IN7 A;  2CEA A;  1ORY B;  4PCZ A;  2VQE M;  2D7G A;  1YSY A;  5FTK A;  1OIZ A;  3RFW A;  2L6O A;  1NV8 A;  3FYC A;  2LVO C;  2QSF X;  3C3D A;  3U6L A;  4PT5 A;  2C9O A;  1QAN A;  4RF0 A;  5KPZ A;  2FS1 A;  1HQC A;  2KEB A;  2Y0T A;  2OPF A;  5IRE B;  3K1J A;  3ZCB B;  4CIZ A;  4DR2 M;  4CIS A;  2QBY B;  1Z5C A;  3I04 M;  3KP1 E;  1T6O A;  2W82 A;  1VQ1 A;  3FUT A;  3SC3 A;  4JI5 M;  2EJS A;  3T15 A;  2V1U A;  3T6P A;  1KFV A;  3ZH9 B;  5IZ7 D;  4LJA A;  1ZMV A;  4M9Z A;  4LF6 M;  2FOI C;  1MX0 A;  2X49 A;  4LFA M;  4OX9 M;  4JV5 M;  1ZMU A;  2DHY A;  4F1I A;  1XWI A;  1JR3 D;  4IJE A;  2Y21 A;  2DWM A;  2F5N A;  4NRV A;  3B89 A;  3FRH A;  3U5Z A;  2JA2 A;  1D0K A;  3LCU A;  2KNA A;  2KRU A;  4LF7 M;  3AFH A;  4G4Q A;  1Q02 A;  2OO9 A;  1IN8 A;  3FUX A;  1PM5 A;  1TF0 B;  1SXJ E;  3PNV A;  3KFU G;  4RKU F;  1HNW M;  3TWM A;  4LCB A;  3GPU A;  3RGP A;  2H5X A;  1FJG M;  1IBK M;  1IY0 A;  3HHW A;  5BPV A;  2CUZ A;  2R18 A;  3L26 A;  3K9P A;  2LVQ D;  2JY7 A;  2DEN A;  3K8Z A;  3A98 B;  1TR8 A;  5KPR A;  4MH0 E;  3JR4 A;  2DHR A;  1SG9 A;  3VKG A;  2C5R A;  2F5P A;  1C1K A;  4LF8 M;  8CAT A;  1IXS A;  3GPY A;  5A2Q S;  4B7G A;  1T3T A;  1TH2 A;  4D82 A;  3GLI B;  1DGH A;  3A45 A;  4QHS A;  4X64 M;  2M60 A;  3EIE A;  3HHX A;  1PJT A;  1XMO M;  3GLF B;  1NNU C;  4IBD A;  4LGY A;  2D7E A;  1ZQ9 A;  1HNZ M;  2KNZ A;  3FE3 A;  4FWH A;  3U60 A;  7CAT A;  3SMP A;  1X37 A;  3LMM A;  2VF7 A;  3L27 A;  1ZV1 A;  2HKJ A;  5FTN A;  3T1Y M;  4LZZ A;  2B3T A;  1OIP A;  2VF8 A;  4MM3 B;  2YR0 A;  3AKZ A;  3U61 A;  1DGF A;  4GHL A;  3FD9 A;  1IY1 A;  1IQP A;  3QYB A;  3V76 A;  1R2Z A;  3KOW E;  4D81 A;  3AV0 A;  2XEP A;  4GIT A;  5EJC A;  1QVR A;  3T38 A;  4GIP A;  1V34 A;  2JUJ A;  3NBI A;  3QAU A;  3K9O A;  3C9P A;  3T1H M;  4IJF A;  2XSZ D;  3RGS A;  2ZTD A;  1MJG M;  3H4J A;  4B3R M;  4EIW A;  3K2L A;  5C1B A;  3FRI A;  1IN4 A;  3W0L B;  4OU7 A;  2DVW B;  1TDH A;  3GPP A;  4HEO A;  2JY8 A;  2K9D A;  4NSO B;  5ITY A;  1WJ7 A;  4A3V B;  2WSE F;  3JR5 A;  3GP1 A;  3SAV A;  5KQD A;  2OOB A;  2Y20 A;  2C96 A;  1KYI A;  1XNQ M;  3SYL A;  1Q3B A;  1XHB A;  2ERC A;  2R45 A;  1IN5 A;  1QUS A;  2YNM D;  3KOX E;  2I7P A;  1WGN A;  1QDT A;  1L2B A;  1GL7 A;  2UU9 M;  1EIJ A;  2Z3X A;  2XZU A;  3UMM A;  2CWB A;  2QBY A;  4DV7 M;  4LJ5 A;  4D80 A;  1PJJ A;  4XBO A;  4HLQ A;  4JI0 M;  5FTL A;  2LXE A;  4FD2 A;  1TDZ A;  1UFZ A;  1NV9 A;  3DA1 A;  1PGY A;  4DUZ M;  4AZF A;  3SFZ A;  2Z8Y M;  2GQF A;  2KZU A;  4NL4 H;  1OJL A;  2UUB M;  2F5Q A;  4M0D A;  4GMQ A;  1GVN A;  3CTW B;  1E32 A;  3AJI B;  2BJV A;  3B7Q A;  4LRT A;  4LY6 A;  2KNV A;  2CFO A;  4LF5 M;  4UN2 B;  3J7B A;  3L29 A;  2QCU A;  4LJ8 A;  2CHQ A;  4IBE A;  2C98 A;  4DR4 M;  1QUT A;  3GQ4 A;  3FUU A;  4Q7J A;  3GLG B;  4W5W A;  1SXJ D;  5IT9 S;  2C9C A;  3MMP A;  1DGB A;  1ZAE A;  1IXZ A;  2R0I A;  4L15 A;  3PNY A;  1FNN A;  1QZM A;  2RKO A;  2Z4S A;  4I5S A;  5EP4 A;  3U6D A;  1WXQ A;  3KS8 A;  3VKH A;  1H6U A;  1TTE A;  1DO0 A;  2JY5 A;  2LVP C;  3HZJ A;  3HU3 A;  4DV0 M;  1K3W A;  2V6Z M;  3R8F A;  4DUY M;  3SHF A;  2R4J A;  2E5L M;  3B7Z A;  4PD2 A;  4JI8 M;  2DKL A;  4AKI A;  2O01 F;  3GLI A;  3UJN A;  1Z5B A;  1JR3 A;  4CGY B;  5BR8 M;  5E6J A;  3E46 A;  2FFJ A;  2JWS A;  2DAE A;  3L2A A;  2KA6 B;  4YHH M;  2J7O A;  1Y8G A;  2L09 A;  1VEK A;  3HGI A;  3AOE C;  3MJ5 A;  4GHA A;  2XFT A;  4F2L A;  1W5S A;  2BJW A;  2XH9 A;  1QYR A;  4YY3 M;  1J5E M;  2YQZ A;  3WHK A;  4LF4 M;  2DZN B;  1XXH E;  1HQY E;  3UZU A;  4BBA A;  1D2N A;  2CE7 A;  1SXJ B;  3HWS A;  4R71 A;  2VQF M;  3BOS A;  4GKK M;  2UUC M;  1VEJ A;  3VK7 A;  4JI7 M;  2DZO B;  2JZ0 A;  2WSF F;  3HKP A;  4WP2 A;  4JN6 A;  1NJF A;  2BNK A;  2K0B X;  4G4O A;  3I4Y A;  3SAS A;  4HL4 A;  4LZJ A;  3GQ3 A;  4AG6 A;  3I4V A;  4NXN M;  4K0K M;  3U6C A;  3M6A A;  4LJ7 A;  3IEC A;  2G8L A;  2JY6 B;  3AOE A;  4ANR A;  1GL6 A;  3IG8 A;  2HCB A;  4ITQ A;  1LTM A;  3HJS A;  3W68 A;  3FTE A;  1NHG C;  2R62 A;  2KHH A;  2Y0Q A;  2EKF A;  3GLH B;  1G8P A;  5F3W A;  4IBB A;  4AQY M;  2UXC M;  1VDL A;  5FLX S;  1HT1 E;  1C7Y A;  3OTO M;  5EXP A;  4XK8 F;  2JXN A;  3RE8 A;  4DR3 M;  4B3T M;  1IN6 A;  3SAW A;  1N32 M;  4I81 A;  4IIW A;  5E26 A;  3HHZ A;  4LFB M;  4P17 A;  4GH9 A;  1R5L A;  2EKK A;  1Z5A A;  2R46 A;  2D7H A;  2DNA A;  4Z6Y A;  2L7I A;  4LG2 A;  1NVM A;  1D0L A;  3I51 A;  5EP1 A;  3U6S A;  1JB0 F;  3Q8X A;  3I01 M;  4I4L A;  4QOS A;  5EXS A;  1KSF X;  4LJ9 A;  3HHY A;  4PDG A;  5KPT A;  2XSZ A;  4II7 A;  3DFZ A;  1GO5 A;  2KRK A;  1G41 A;  4JI1 M;  3J7A S;  1JR3 E;  5JI2 E;  2MRO B;  2CHV A;  5ITQ A;  2L4F A;  2KDL A;  4R7G A;  4GEW A;  3LVV A;  1BVS A;  1DGG A;  1OQY A;  2HWJ A;  1MU5 A;  1L8Q A;  5DYG A;  3R9X B;  4DV3 M;  3M7G A;  3BXW A;  3HJ8 A;  4R3D A;  1Z59 A;  1XC8 A;  5DNY A;  1IBM M;  1WGL A;  1QDR A;  3NWL A;  3W0F A;  3GLG A;  2HHH M;  2FE8 A;  4IBJ A;  3L28 A;  1N34 M;  1HJP A;  2WZJ A;  1SXJ C;  4AW4 A;  1NY6 A;  3LCV B;  4BB9 A;  2MH8 A;  2ZAN A;  5EXX A;  3HY5 A;  4QOZ C;  3B7N A;  4GKJ M;  4IBI A;  1XNR M;  1NY5 A;  2F5S A;  2KW0 A;  2ZAO A;  4DV1 M;  4DBG B;  2DZL A;  2Z4R A;  3D8L A;  4KT0 F;  3HU2 A;  2N35 A;  3ILK A;  2RGH A;  1E94 E;  1HNX M;  4Y28 F;  1D0M A;  1DO2 A;  2LBC A;  2EO2 A;  2XF3 A;  3E4R A;  1IBL M;  2HAK A;  4DR1 M;  4AI6 A;  2DXI A;  1G4A E;  3KW6 A;  2AHM A;  2A5Y B;  5ITU A;  2L4E A;  1NHW C;  3GQ5 A;  2RGO A;  2LWX A;  3VFD A;  3J80 S;  3VDP A;  1PJI A;  2L7H A;  4KO8 A;  2ZM6 M;  4KOD A;  3TPZ A;  4B08 A;  1K3X A;  1F4I A;  3W67 A;  3E9S A;  2MGW A;  1WR1 B;  3ZQJ A;  1QAO A;  4DV2 M;  2MR9 A;  2F5O A;  4X66 M;  1SXJ A;  3U60 B;  2LTU A;  2J5Y A;  5LMN M;  2XFS A;  3UGJ A;  2C99 A;  2JZ1 A;  4P16 A;  1V92 A;  3QWL A;  2FH0 A;  3PVS A;  4OW0 A;  2CV2 A;  4M0W A;  3TL4 X;  4IBC A;  4MGY E; 
#chains in the Genus database with same CATH homology
 4OVZ B;  4FWG A;  3VDU A;  3CF0 A;  4L8R C;  1N78 A;  3D8B A;  3J2P B;  4GC9 A;  3VLF B;  3JAM S;  1HT2 E;  3B9P A;  4LGM A;  1J7K A;  2P5T A;  2CV0 A;  4JI6 M;  4L4U A;  5ITX A;  1OFI A;  5FTM A;  3PXG A;  4DR6 M;  4IBG A;  1R6B X;  2K47 A;  3KDS E;  3GLH A;  4L16 A;  4DV4 M;  3GLF A;  1R2Y A;  3C58 A;  4DR7 M;  3SAR A;  4MGK E;  2I7N A;  3WHL A;  4AKG A;  2H1R A;  3GRV A;  4B3M M;  3SMS A;  2VII A;  4GC5 A;  4G4N A;  3U6E A;  4FCT A;  1L2D A;  4JI3 M;  3AOG A;  1XXH B;  3GRY A;  3KXE C;  4ZPX A;  4LF9 M;  3ZC7 B;  4FWD A;  5KQ8 A;  4QNM A;  3DZD A;  1QAM A;  1L1T A;  3FYD A;  3PFI A;  4S12 A;  2R65 A;  2LNH C;  4NRW A;  2QPA A;  1IY2 A;  5EP2 A;  3KOZ E;  1TH4 A;  5FTJ A;  4LJ4 A;  2DWZ B;  2UUA M;  4X65 M;  4WUR A;  5DYI A;  2ZBK B;  2NQ8 C;  1L1Z A;  3KP0 E;  2R4E A;  4G4R A;  2CV1 A;  4GRI A;  4FCV A;  4PDI A;  4DV6 M;  3FTF A;  2KXE A;  1E9S A;  2UXB M;  2DWN A;  3AL0 C;  4QNR A;  2XZF A;  1Q3C A;  3KVW A;  4MGI E;  4FCW A;  2V1C A;  3A42 A;  3GRR A;  2F4V M;  2HL7 A;  4RNA A;  3KSJ A;  3MK6 A;  4M9S A;  4REZ A;  4AG5 A;  2YFQ A;  4NSR A;  5C18 A;  3GO8 A;  1S3S A;  2QEN A;  3THG A;  1K82 A;  2XLJ A;  1UM8 A;  4X62 M;  2Z7J A;  4KLN A;  3SHG B;  4IBK A;  5LMU M;  1VDD A;  3CF6 E;  1I94 M;  1N33 M;  3EIH A;  4G6Z A;  5ITX E;  1TGU A;  2J7N A;  4MGH A;  4JYA M;  4MGZ E;  1L2C A;  4WW0 A;  3FUV A;  2X4A A;  1QQW A;  4LFC M;  2X8A A;  4FW9 A;  3FTD A;  5ITR A;  4TUW A;  1G3I A;  3GRU A;  3KOY E;  4CHT B;  4FVM A;  4IBF A;  5EXT A;  3M0E A;  3VK8 A;  3U5Z B;  5KO3 A;  2Q2E B;  4M9X A;  3SAT A;  5FSW A;  4OVZ A;  1IXR C;  3U6P A;  2ZAM A;  1IM2 A;  4RF1 A;  5H37 D;  3A46 A;  5IWA M;  2FNA A;  3KSX A;  3TWL A;  4JI4 M;  2QP9 X;  3HJQ A;  4B7H A;  3SYK A;  3FTC A;  4LRS A;  4BLC A;  2EUC A;  3MHV C;  1LV7 A;  2LH0 A;  1TH3 A;  1W5T A;  3HU1 A;  1N36 M;  3FUW A;  4L78 A;  4DR5 M;  4I8O A;  3TWK A;  1G59 A;  2OQ4 A;  3LQR A;  3GPX A;  1IXS B;  1YE9 A;  2DWL A;  1Q39 A;  1EE8 A;  2UXD M;  1I4W A;  3UK6 A;  1DGH B;  4Z8X A;  1XXH A;  4AKH A;  4NXM M;  1QAQ A;  2EA0 A;  1GLN A;  4JI2 M;  3KS4 A;  3J81 S;  4LJ6 A;  5EQT A;  3U6M A;  1XMQ M;  4KHP M;  2QZ4 A;  4B3S M;  4MB7 A;  3U6Q A;  1NSF A;  3U61 B;  1N77 A;  3IG5 A;  4B7F A;  1HR0 M;  1GKI A;  2CHG A;  5JI3 E;  3SAU A;  3J27 B;  2G5G X;  2M5Z A;  4NOO B;  4XGI A;  5EP3 A;  1J09 A;  4QHT A;  5ITT A;  2O5R A;  3TE6 A;  3SBJ A;  1NJG A;  1YUB A;  2XGN A;  3H4M A;  3K92 A;  4DV5 M;  3L25 A;  1Z6T A;  3U6O A;  1OFH A;  1R7R A;  1NNJ A;  3LVW A;  1JQJ C;  1E9R A;  3DOA A;  3CF2 A;  3LQQ A;  4JXJ A;  3FKE A;  3OTO M;  2KZS A;  2OPF A;  3TQS A;  1N75 A;  5GKN A;  4PCZ A;  3SAW A;  1IN7 A;  2CEA A;  1ORY B;  2VQE M;  2D7G A;  1YSY A;  5FTK A;  3RFW A;  2L6O A;  3FYC A;  3U6L A;  4PT5 A;  2C9O A;  1QAN A;  4RF0 A;  5KPZ A;  2KEB A;  1HQC A;  2Y0T A;  5IRE B;  3K1J A;  3ZCB B;  4DR2 M;  4CIS A;  2QBY B;  1Z5C A;  3KP1 E;  2W82 A;  3FUT A;  3SC3 A;  4JI5 M;  3T15 A;  2V1U A;  1KFV A;  3ZH9 B;  5IZ7 D;  4LJA A;  4M9Z A;  4LF6 M;  2FOI C;  1MX0 A;  2X49 A;  4LFA M;  4OX9 M;  4JV5 M;  1XWI A;  1JR3 D;  4IJE A;  2Y21 A;  2DWM A;  2F5N A;  4NRV A;  3U5Z A;  2JA2 A;  2KRU A;  4LF7 M;  3AFH A;  4G4Q A;  1IN8 A;  3FUX A;  1PM5 A;  1SXJ E;  3PNV A;  3KFU G;  1HNW M;  3TWM A;  4LCB A;  3GPU A;  3RGP A;  1FJG M;  1IBK M;  1IY0 A;  3HHW A;  5BPV A;  2CUZ A;  2R18 A;  3L26 A;  3K8Z A;  3A98 B;  5KPR A;  4MH0 E;  3JR4 A;  2DHR A;  3VKG A;  2C5R A;  2F5P A;  1C1K A;  4LF8 M;  8CAT A;  3GPY A;  5A2Q S;  4B7G A;  1T3T A;  1TH2 A;  4D82 A;  3GLI B;  1DGH A;  3A45 A;  4QHS A;  4X64 M;  2M60 A;  3EIE A;  3HHX A;  1XMO M;  3GLF B;  1NNU C;  4IBD A;  4LGY A;  2D7E A;  1ZQ9 A;  1HNZ M;  4FWH A;  3U60 A;  7CAT A;  3SMP A;  1X37 A;  3LMM A;  3L27 A;  2HKJ A;  5FTN A;  3T1Y M;  4LZZ A;  3U61 A;  4MM3 B;  2YR0 A;  3AKZ A;  1DGF A;  4GHL A;  3FD9 A;  1IY1 A;  1IQP A;  1R2Z A;  3KOW E;  4D81 A;  3AV0 A;  2XEP A;  4GIT A;  5EJC A;  1QVR A;  3T38 A;  4GIP A;  3NBI A;  3QAU A;  3T1H M;  4IJF A;  2XSZ D;  3RGS A;  4B3R M;  4EIW A;  3K2L A;  5C1B A;  1IN4 A;  3W0L B;  4OU7 A;  2DVW B;  1TDH A;  3GPP A;  4NSO B;  5ITY A;  4A3V B;  3JR5 A;  3GP1 A;  3SAV A;  5KQD A;  2Y20 A;  2C96 A;  1KYI A;  1XNQ M;  3SYL A;  1Q3B A;  1XHB A;  2ERC A;  2R45 A;  1IN5 A;  3KOX E;  2YNM D;  2I7P A;  2UU9 M;  1L2B A;  1GL7 A;  2Z3X A;  2XZU A;  3UMM A;  2QBY A;  4DV7 M;  4LJ5 A;  4D80 A;  1PJJ A;  4XBO A;  4HLQ A;  4JI0 M;  5FTL A;  2LXE A;  4FD2 A;  1TDZ A;  3DA1 A;  4DUZ M;  4AZF A;  3SFZ A;  2KZU A;  4NL4 H;  1OJL A;  2UUB M;  2F5Q A;  4M0D A;  4GMQ A;  1GVN A;  3CTW B;  1E32 A;  3AJI B;  2BJV A;  4LRT A;  4LY6 A;  4LF5 M;  2CFO A;  3J7B A;  3L29 A;  2QCU A;  4LJ8 A;  2CHQ A;  4IBE A;  2C98 A;  4DR4 M;  3GQ4 A;  3FUU A;  3GLG B;  4W5W A;  1SXJ D;  5IT9 S;  2C9C A;  1DGB A;  1ZAE A;  1IXZ A;  4L15 A;  3PNY A;  1FNN A;  1QZM A;  2RKO A;  2Z4S A;  4I5S A;  5EP4 A;  3U6D A;  1WXQ A;  3KS8 A;  3VKH A;  1H6U A;  1DO0 A;  3HU3 A;  4DV0 M;  1K3W A;  2V6Z M;  3R8F A;  4DUY M;  3SHF A;  2R4J A;  2E5L M;  4PD2 A;  4AKI A;  4JI8 M;  3GLI A;  3UJN A;  1Z5B A;  1JR3 A;  4CGY B;  5BR8 M;  5E6J A;  2FFJ A;  3L2A A;  2KA6 B;  4YHH M;  2J7O A;  2L09 A;  3HGI A;  3AOE C;  3MJ5 A;  4GHA A;  2XFT A;  1W5S A;  2BJW A;  2XH9 A;  1QYR A;  4YY3 M;  1J5E M;  2YQZ A;  3WHK A;  4LF4 M;  2DZN B;  4BBA A;  1HQY E;  3UZU A;  1D2N A;  2CE7 A;  1SXJ B;  3HWS A;  2VQF M;  3BOS A;  4GKK M;  2UUC M;  3VK7 A;  4JI7 M;  2DZO B;  3HKP A;  4JN6 A;  1NJF A;  2BNK A;  4G4O A;  3SAS A;  3I4Y A;  4HL4 A;  4LZJ A;  3GQ3 A;  4AG6 A;  3I4V A;  4NXN M;  4K0K M;  3U6C A;  3M6A A;  4LJ7 A;  2G8L A;  3AOE A;  1GL6 A;  3IG8 A;  2HCB A;  4ITQ A;  3HJS A;  3FTE A;  1NHG C;  2R62 A;  2Y0Q A;  3GLH B;  1G8P A;  5F3W A;  4IBB A;  4AQY M;  2UXC M;  5FLX S;  1HT1 E;  5EXP A;  4B3T M;  4DR3 M;  3RE8 A;  1IN6 A;  1N32 M;  4I81 A;  4IIW A;  5E26 A;  3HHZ A;  4LFB M;  4GH9 A;  1Z5A A;  2R46 A;  2D7H A;  4Z6Y A;  2L7I A;  4LG2 A;  1NVM A;  3I51 A;  5EP1 A;  3U6S A;  3Q8X A;  4QOS A;  4I4L A;  5EXS A;  3HHY A;  1KSF X;  4LJ9 A;  4PDG A;  5KPT A;  2XSZ A;  4II7 A;  3DFZ A;  2KRK A;  1G41 A;  4JI1 M;  3J7A S;  5JI2 E;  2CHV A;  5ITQ A;  4R7G A;  3LVV A;  1DGG A;  5DYG A;  1MU5 A;  1L8Q A;  3R9X B;  4DV3 M;  3M7G A;  4R3D A;  3HJ8 A;  1XC8 A;  1Z59 A;  1IBM M;  5DNY A;  3W0F A;  3NWL A;  3GLG A;  2HHH M;  2FE8 A;  4IBJ A;  3L28 A;  1N34 M;  4AW4 A;  1SXJ C;  1NY6 A;  4BB9 A;  2ZAN A;  5EXX A;  4QOZ C;  4GKJ M;  4IBI A;  1XNR M;  1NY5 A;  2F5S A;  2KW0 A;  2ZAO A;  4DV1 M;  2Z4R A;  3D8L A;  3HU2 A;  3ILK A;  2RGH A;  1E94 E;  1HNX M;  1DO2 A;  2EO2 A;  2XF3 A;  3E4R A;  1IBL M;  4DR1 M;  4AI6 A;  2DXI A;  1G4A E;  3KW6 A;  2AHM A;  2A5Y B;  5ITU A;  1NHW C;  3GQ5 A;  2RGO A;  2LWX A;  3VFD A;  3J80 S;  3VDP A;  1PJI A;  2L7H A;  4KO8 A;  2ZM6 M;  4KOD A;  3TPZ A;  4B08 A;  1K3X A;  3E9S A;  1QAO A;  4DV2 M;  2F5O A;  4X66 M;  1SXJ A;  3U60 B;  5LMN M;  2XFS A;  3UGJ A;  2C99 A;  4P16 A;  3QWL A;  3PVS A;  4OW0 A;  2CV2 A;  4M0W A;  3TL4 X;  4IBC A;  4MGY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...