2LNHC

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural Wiskott-Aldrich syndrome protein
publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.830 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lnhC00
2LNHC
chains in the Genus database with same CATH superfamily
1QZMA 2VQEM 1DV0A 2MJ5B 2XZUA 4LJ6A 3B7NA 4I5SA 1Q3BA 2XFTA 2WSEF 4R7GA 2DXIA 4PDGA 2WSCF 2XEPA 4KT0F 2LVOC 2QHOB 1QANA 2JZ1A 2L4FA 2L6OA 4L16A 3FYCA 4JYAM 1DGHB 4LF4M 2CE7A 4LF9M 2R62A 3FUXA 3KOYE 3SC3A 1DGHA 1XNQM 1N77A 3HJSA 3AKZA 1OAOC 1MX0A 2L09A 3RGPA 4JI8M 3GLGB 5EJCA 4FW9A 1K3WA 1E9RA 3HU1A 1AUAA 3KP0E 4LGMA 3LQQA 3GLGA 3C3DA 3PNVA 3U60B 4IBEA 4MM3B 2EO2A 4JI3M 3C3EA 4W5WA 2APLA 3U60A 1I94M 4JN6A 4FWHA 4DR4M 2VIIA 4LF7M 1Y8GA 3D8BA 4M0DA 3U6CA 3VDUA 3MMPA 3LMMA 4GHLA 2JY5A 3CF6E 1A5TA 3FTCA 5ITUA 3TQSA 1PJSA 2ZBKB 2CWBA 3PVSA 1R2ZA 3R9XB 2QENA 4FWDA 1QVRA 1UM8A 4OVZB 4MB7A 1NO1A 3MK6A 4M9ZA 3M0EA 1N34M 4PT5A 2XH9A 4OVZA 3VKGA 1R6BX 1W5TA 1NHWC 4L4UA 5KQDA 3B9PA 3KW6A 5DYIA 3U5ZA 1LTMA 1V92A 2C9OA 2XSZA 1FNNA 3H4MA 1WGLA 3KXEC 4LZJA 2BWBA 3E9SA 2I7NA 1D0LA 1VG5A 4GC5A 4X66M 4JI5M 1P3QQ 3NBIA 3IG5A 3HKPA 2CV1A 3M6AA 1IN8A 3T38A 2JNHA 1NY6A 1GKIA 3L25A 1N75A 2MGWA 2ZM6M 1VEKA 2HL7A 3HHYA 1OAIA 1DO2A 2K47A 4G4QA 2JUJA 1JR3E 2C5RA 1JR3D 3QYEA 1T3TA 2JXNA 4NRVA 1SXJE 3SHGB 2F5PA 1SXJD 1S3SA 4I4LA 3U6EA 3U6LA 2ERCA 4IBJA 4AKHA 3UK6A 1NNUC 2P5TA 3RGSA 4QNMA 3TWMA 5ITXA 3KSXA 1GVNA 4D81A 4IBIA 1VQ1A 5FTNA 1WXQA 1MN3A 1HT2E 4EIWA 1NV9A 1R2YA 1MU5A 3GLHB 4GEWA 4WW0A 4RF0A 2EA0A 5C1BA 2EJSA 3UGJA 2D7EA 3E21A 3GLHA 2DENA 3HHXA 1IN5A 1TH4A 1TH2A 2DHYA 3CTWB 3KS4A 4AZFA 4FD2A 4LCBA 3J81S 2D7HA 1HT1E 2QBYB 1VEJA 3KOXE 5E26A 2LVAA 2QCUA 2KXEA 3FUWA 4G4RA 2QBYA 2XFSA 2FS1A 2K6BA 3KOWE 2C99A 1EIJA 3LQRA 4M0WA 4CIZA 4IBFA 3FTDA 1GL7A 1QQWA 2L4EA 3NBXX 1F4IA 4AKIA 1NY5A 2JY7A 1KYIA 2O5RA 1X37A 4XK8F 3A45A 2RGHA 1MJGM 4DR5M 1TF0B 4AKGA 1GJSA 5FTMA 4NXMM 4ANRA 3OTOM 4Z8XA 4GC9A 4XGIA 4LF6M 2QPAA 4D80A 1GL6A 4MH0E 1NHGC 2CV2A 4MGYE 2J5YA 2CV0A 2KW0A 2C96A 2X4AA 1OQYA 3J2PB 4M9SA 3T15A 4B08A 3HX3A 4LJ9A 1IBMM 2DWMA 2UUCM 1ORYB 2BWEA 3DFZA 1JQJC 2LNHC 1V34A 2LHGA 5FLXS 1Z59A 1R7RA 1IXRC 5IZ7D 2HWJA 2V1UA 4GKKM 3ILKA 3IG8A 3K9OA 3D8LA 1SG9A 3GRUA 4OU7A 4M9XA 2QQ8A 4X65M 2DVWB 3HHWA 2FNAA 1QYRA 2M5ZA 3Q8XA 4G6ZA 2VDBB 3HY5A 1IQPA 4TUWA 3U6SA 2CFOA 2DAKA 5BR8M 1CUKA 4LJ7A 4X62M 3VK7A 2Y0TA 5EXPA 4CHTB 2DWNA 4WURA 3KOZE 5DYGA 1HQCA 2HHHM 1NNJA 4JV5M 1J7KA 2FOIC 1QDRA 1AIPC 5JI2E 3U6OA 4NXNM 2OOBA 3K1JA 2K0BX 1D2NA 3JR5A 1G4AE 3TWKA 2WZJA 1N78A 4RNAA 4CISA 2HCBA 4IBKA 3FYDA 1NJFA 1PJTA 4Q7JA 2DWZB 3VDPA 2ZANA 2XZFA 4XBOA 1C1KA 1E94E 3CF2A 1YLAA 2KZUA 3I4YA 2G3QA 4F2LA 2F5SA 2R18A 3I04M 1OTRA 3GPUA 3LVWA 3GQ5A 5A2QS 1D0MA 1PRBA 2XSZD 5C18A 2KZSA 5L8RF 2A5YB 3CF0A 2UU9M 4LF5M 3SHFA 3GLIE 2X49A 3UMMA 3FRHA 4JXJA 3T6PA 3TL4X 1EE8A 3UJNA 3U6PA 1HNZM 1R4GA 2R6FA 3K92A 4DV5M 2LWXA 3FUVA 3U6QA 5IREB 2V6ZM 1XNRM 3HU2A 1KFVA 3GQ4A 1ZAEA 1GABA 1Q39A 2EUCA 3E46A 3SMSA 2KNZA 3U5ZB 2CEAA 3RFWA 2QNJA 2Y20A 4AG6A 3SYLA 4NC6A 2ZAOA 2W82A 2ZTCA 1Z6TA 4DV0M 1I4WA 1XHBA 1G59A 1IY1A 1HQYE 2J7NA 4L6V6 4CGYB 4PD2A 3GRRA 4DR2M 1ZQ9A 2L7HA 4NRWA 3VLFB 1XC8A 2DAMA 2C98A 2RKOA 1XWIA 2LVPC 3I01M 3GLFE 3PXGA 2DKLA 5EP3A 4Z6YA 1HNXM 1HJPA 1YUBA 4GH9A 4MGZE 2DWLA 1OKSA 3LCVB 2CHQA 2EKKA 4Y28F 1Z5BA 3A98B 3KP1E 1OJLA 1TTEA 1VEGA 3GLHE 2FFJA 4LY6A 2R46A 4KLNA 4GITA 1TH3A 2UXDM 1PJJA 2CHGA 3KVWA 3DA1A 2MH8A 2YQZA 4L15A 1XXHB 1NVMA 1ZMWA 3W0LB 1L2CA 2UUAM 1QAMA 3B7ZA 2JY8A 4G3OA 1KSFX 4GIPA 3J7BA 4GMQA 3FUUA 1XXHA 3VFDA 1K3XA 1Z5CA 4KO8A 3W68A 4AG5A 1L1TA 3K9PA 5ITQA 3GQ3A 3QYBA 2G8LA 3W0FA 2DZOB 1PJIA 2JWSA 2LVQD 2NQ8C 4ZPXA 1PM5A 2DZLA 4BBAA 2UUBM 4LFAM 3GP1A 2FE8A 3U6MA 1E32A 2JZ0A 5FTKA 4G4OA 1XMOM 4IBBA 4NSRA 2O01F 1QUSA 4IBCA 3ZQJA 4DV6M 4PDIA 1L1ZA 5KPTA 3AOEA 4QNRA 3AV0A 3CGWA 3UZUA 3VKHA 5KPRA 3KSJA 2DI0A 3SMPA 2JP7A 1IXSB 4B3MM 5ITRA 1N36M 3KDSE 5IT9S 1H6UA 3RE8A 2KNAA 3WHKA 1IXSA 4DBGB 1OFHA 2DAIA 3T1HM 4CJ6A 2UXBM 5FTLA 1R5LA 3QWLA 4I81A 2ZTDA 2ZAMA 2DHRA 2WSFF 1WR1B 3GRVA 5KPZA 4DR6M 2Y21A 2Z8YM 3HJQA 3ZH9B 4R71A 1DGBA 5LMUM 4DUZM 1JR3A 3T1YM 1IFYA 3HGIA 7CATA 3ZCBB 3GRYA 2JY6B 3K2LA 4MGIE 1L2BA 1VDLA 2DNAA 2JA2A 2KRUA 2YFQA 3AOGA 3TPZA 1IN4A 4YHHM 1T43A 3J80S 3KFUG 2QSFX 2UXCM 4BLCA 3A46A 2L7IA 4QHSA 4LGYA 3GLGE 4LRTA 3FTEA 1XMQM 1WGNA 3F92A 4S12A 2Y0QA 4B7GA 3SARA 1PGYA 3U6DA 3DZDA 1GLNA 3JAMS 2CP8A 5FTJA 4QOSA 4PCZA 1YSYA 1IBLM 3LCUA 2DAGA 3HJ8A 1N32M 4B7HA 3TWLA 2X8AA 4JI4M 4II7A 3BOSA 3H4JA 2OPFA 1WJ7A 2LHCA 5FSWA 3HZJA 4OW0A 4F1IA 4KHPM 1G41A 3GPXA 3B7QA 4UN2B 2G5GX 2LTUA 4P17A 2DZNB 3SAUA 3LVVA 5KQ8A 2Q2EB 4JI1M 2R44A 1NV8A 2KNVA 3I4VA 2DAEA 4A3VB 4I8OA 4L78A 5EXTA 2QP9X 3E4RA 3ZC7B 4DV1M 8CATA 4LF8M 4JI7M 2F5NA 1K82A 1FJGM 4DV2M 4FCWA 4LG2A 3K8ZA 2I7PA 1IY2A 1QAQA 3AFHA 4X64M 4DR1M 3FE3A 3A42A 4LFCM 4OX9M 4FWGA 2YR0A 3AJIB 1DGFA 1J09A 5F3WA 2F5OA 4B3SM 3FUTA 3KS8A 2XF3A 5DNYA 3JR4A 4QHTA 3DOAA 4DV3M 3HU3A 2OQ4A 1HNWM 3SFZA 1QAOA 3HWSA 5JI3E 3B74A 4YY3M 1TDZA 2O25A 2YNMD 2B3TA 1GJTA 1ZV1A 1QDTA 2CUZA 1IY0A 1XXHE 2OO9A 5EXXA 4JI0M 4ITQA 1IM2A 1DGGA 3GO8A 4IJEA 4REZA 3C58A 5EXSA 4HEOA 1Q02A 5ITXE 4HL4A 3PFIA 4GRIA 3J7AS 3Q8GA 3THGA 3J27B 3AL0C 2R4EA 3I51A 5DFLA 4QOZC 4RKUF 1VDDA 3WHLA 2K9DA 1BVSA 5KO3A 4DUYM 1OFIA 1EFUB 3FRIA 3L27A 1D0KA 3FTFA 1G8PA 2H1RA 1Q3CA 2LBCA 5ITTA 1JB0F 2F4VM 2D7GA 1OIPA 2LVNC 2CRUA 4NL4H 4P16A 3L26A 1LV7A 2LH0A 4B3TM 4HLQA 4DV7M 3SAVA 3GLIB 1IXZA 2R4JA 2Z4SA 2GNOA 3GLIA 3U61B 5EP2A 3BXWA 3SBJA 2BJWA 1T6OA 2Z4RA 3U61A 1RU3A 2M60A 2LXEA 2OOAA 1YE9A 3QAUA 3NWLA 3L28A 4LJ8A 3L2AA 2XLJA 3FKEA 2XGNA 4R3DA 2RGOA 4DR3M 1TDHA 4FCVA 3GPPA 4MGHA 4AW4A 5E6JA 3TE6A 4AQYM 4WP2A 3GPYA 2FH0A 1ZMVA 3IHPA 2R0IA 4KODA 2AHMA 1Z5AA 3MHVC 5IWAM 1N33M 5EP1A 3GLFB 3HHZA 2VQFM 2F5QA 1W5SA 4K0KM 4NOOB 2R45A 3EIEA 4LFBM 2VF8A 2BJVA 4RF1A 3GLFA 2KDLA 1G3IA 1G71A 3EIHA 3V76A 1TR8A 2C9CA 2HAKA 2VF7A 4FCTA 1E9SA 1IN7A 4FVMA 4IJFA 2MR9A 5H37D 4IIWA 1WHCA 1L8QA 1NSFA 2BNKA 3M7GA 3AOEC 2E5LM 1SXJB 2KHHA 2Z3XA 2KA6B 2Z7JA 4AI6A 3R8FA 1C7YA 1SXJA 2N35A 2KRKA 1ZMUA 4D82A 4JI2M 3BBZA 4LJ5A 3LW5F 5EQTA 1XB2B 2R65A 4IBGA 1IN6A 3B89A 3IECA 1HR0M 4JI6M 2EKFA 2L2DA 4IBDA 1V33A 3SYKA 4LJAA 3SASA 4LZZA 3FD9A 4LJ4A 1IBKM 1UFZA 2J7OA 5BPVA 3SAWA 4BB9A 4GHAA 3MJ5A 4L8RC 1QUTA 5GKNA 4LRSA 3VK8A 2H5XA 2CHVA 2GQFA 1SXJC 4DV4M 2QZ4A 4G4NA 4GKJM 5EP4A 3L29A 3PNYA 2HKJA 1QZEA 2V1CA 1DO0A 1TGUA 1GO5A 1OIZA 1PJQA 4DR7M 1J5EM 2MROB 4B7FA 4MGKE 3SATA 1L2DA 3C9PA 3W67A 4NSOB 4B3RM 2RRUA 5LMNM 1NJGA 1WIVA 2KEBA 5ITYA
chains in the Genus database with same CATH topology
1QZMA 2VQEM 2XZUA 4LJ6A 4I5SA 1Q3BA 2XFTA 4R7GA 2DXIA 4PDGA 2XEPA 1QANA 2L6OA 4L16A 3FYCA 4JYAM 1DGHB 4LF4M 2CE7A 4LF9M 2R62A 3FUXA 3KOYE 3SC3A 1DGHA 1XNQM 1N77A 3HJSA 3AKZA 2L09A 1MX0A 3RGPA 4JI8M 3GLGB 5EJCA 4FW9A 1K3WA 1E9RA 3HU1A 3KP0E 4LGMA 3LQQA 3GLGA 3PNVA 3U60B 4IBEA 4MM3B 2EO2A 4JI3M 4W5WA 3U60A 1I94M 4JN6A 4FWHA 4DR4M 2VIIA 4LF7M 4M0DA 3D8BA 3U6CA 3VDUA 3LMMA 4GHLA 3CF6E 3FTCA 5ITUA 3TQSA 2ZBKB 3PVSA 1R2ZA 3R9XB 2QENA 4FWDA 1QVRA 1UM8A 4OVZB 4MB7A 3MK6A 4M9ZA 3M0EA 1N34M 4PT5A 2XH9A 4OVZA 3VKGA 1R6BX 1W5TA 1NHWC 4L4UA 5KQDA 3B9PA 3KW6A 5DYIA 3U5ZA 2C9OA 2XSZA 3H4MA 1FNNA 3KXEC 4LZJA 3E9SA 2I7NA 4X66M 4GC5A 4JI5M 3NBIA 3IG5A 3HKPA 2CV1A 3M6AA 1IN8A 3T38A 1NY6A 1GKIA 3L25A 1N75A 2ZM6M 2HL7A 3HHYA 1DO2A 2K47A 4G4QA 2C5RA 1JR3D 4NRVA 1T3TA 1SXJE 3SHGB 2F5PA 1SXJD 1S3SA 4I4LA 3U6EA 3U6LA 2ERCA 4IBJA 4AKHA 3UK6A 1NNUC 2P5TA 3RGSA 4QNMA 3TWMA 5ITXA 3KSXA 1GVNA 4D81A 4IBIA 5FTNA 1WXQA 4EIWA 1HT2E 1R2YA 1MU5A 3GLHB 4WW0A 4RF0A 2EA0A 5C1BA 3UGJA 2D7EA 3GLHA 3HHXA 1IN5A 3KS4A 1TH4A 1TH2A 3CTWB 4AZFA 4FD2A 4LCBA 3J81S 2D7HA 1HT1E 2QBYB 3KOXE 5E26A 2QCUA 2KXEA 3FUWA 4G4RA 2QBYA 2XFSA 3KOWE 2C99A 3LQRA 4M0WA 4IBFA 3FTDA 1GL7A 1QQWA 4AKIA 1NY5A 1KYIA 2O5RA 1X37A 3A45A 2RGHA 4DR5M 4AKGA 5FTMA 4NXMM 3OTOM 4Z8XA 4GC9A 4XGIA 4LF6M 2QPAA 4D80A 1GL6A 4MH0E 1NHGC 2CV2A 4MGYE 2CV0A 2KW0A 2C96A 2X4AA 3J2PB 4M9SA 3T15A 4B08A 4LJ9A 1IBMM 2DWMA 2UUCM 1ORYB 3DFZA 1JQJC 2LNHC 5FLXS 1Z59A 1R7RA 1IXRC 5IZ7D 2V1UA 4GKKM 3ILKA 3IG8A 3D8LA 3GRUA 4OU7A 4M9XA 4X65M 2DVWB 3HHWA 2FNAA 1QYRA 2M5ZA 3Q8XA 4G6ZA 4TUWA 1IQPA 3U6SA 2CFOA 5BR8M 4LJ7A 4X62M 3VK7A 2Y0TA 5EXPA 4CHTB 2DWNA 4WURA 3KOZE 5DYGA 1HQCA 2HHHM 1NNJA 4JV5M 1J7KA 2FOIC 5JI2E 3U6OA 4NXNM 3K1JA 3JR5A 1D2NA 1G4AE 3TWKA 1N78A 4RNAA 4CISA 2HCBA 4IBKA 3FYDA 1NJFA 2DWZB 3VDPA 2ZANA 2XZFA 4XBOA 1C1KA 1E94E 3CF2A 2KZUA 3I4YA 2F5SA 2R18A 3GPUA 3GQ5A 3LVWA 5A2QS 5C18A 2XSZD 2KZSA 2A5YB 3CF0A 2UU9M 4LF5M 3SHFA 2X49A 3UMMA 4JXJA 3TL4X 1EE8A 3UJNA 3U6PA 1HNZM 3K92A 4DV5M 2LWXA 3FUVA 3U6QA 5IREB 2V6ZM 1XNRM 3HU2A 1KFVA 3GQ4A 1ZAEA 1Q39A 2EUCA 3SMSA 3U5ZB 2CEAA 3RFWA 2Y20A 4AG6A 3SYLA 4DV0M 2ZAOA 2W82A 1Z6TA 1I4WA 1XHBA 1G59A 1IY1A 1HQYE 2J7NA 4CGYB 4PD2A 4DR2M 3GRRA 1ZQ9A 2L7HA 4NRWA 3VLFB 1XC8A 2C98A 2RKOA 1XWIA 3PXGA 1HNXM 5EP3A 4Z6YA 2DWLA 1YUBA 4GH9A 4MGZE 2CHQA 1Z5BA 3A98B 3KP1E 1OJLA 2FFJA 4LY6A 2R46A 4KLNA 4GITA 1TH3A 2UXDM 1PJJA 2CHGA 3KVWA 3DA1A 2YQZA 4L15A 3W0LB 1XXHB 1NVMA 1L2CA 2UUAM 1QAMA 4GIPA 4GMQA 1KSFX 3J7BA 3FUUA 1XXHA 3VFDA 1K3XA 1Z5CA 4KO8A 4AG5A 1L1TA 5ITQA 3GQ3A 2G8LA 3W0FA 2DZOB 1PJIA 2NQ8C 4ZPXA 1PM5A 4BBAA 2UUBM 4LFAM 3GP1A 2FE8A 3U6MA 1E32A 4G4OA 5FTKA 1XMOM 4IBBA 4NSRA 4DV6M 4IBCA 4PDIA 1L1ZA 5KPTA 3AOEA 4QNRA 3AV0A 3UZUA 3VKHA 5KPRA 3KSJA 3SMPA 1IXSB 4B3MM 5ITRA 1N36M 3KDSE 5IT9S 1H6UA 3RE8A 3WHKA 3T1HM 1OFHA 2UXBM 5FTLA 3QWLA 4I81A 2ZAMA 2DHRA 3GRVA 5KPZA 4DR6M 2Y21A 3HJQA 3ZH9B 5LMUM 4DUZM 1DGBA 1JR3A 3T1YM 3HGIA 7CATA 3ZCBB 3GRYA 3K2LA 1L2BA 4MGIE 2JA2A 2KRUA 2YFQA 3AOGA 3TPZA 1IN4A 4YHHM 3J80S 3KFUG 2UXCM 4BLCA 3A46A 2L7IA 4QHSA 4LGYA 4LRTA 3FTEA 1XMQM 4S12A 2Y0QA 4B7GA 3SARA 3U6DA 3DZDA 1GLNA 3JAMS 4PCZA 5FTJA 4QOSA 1IBLM 1YSYA 1N32M 3HJ8A 4B7HA 3TWLA 2X8AA 4JI4M 4II7A 3BOSA 2OPFA 5FSWA 4OW0A 4KHPM 1G41A 3GPXA 2G5GX 2DZNB 3SAUA 3LVVA 5KQ8A 2Q2EB 4JI1M 3I4VA 4A3VB 4I8OA 4L78A 5EXTA 2QP9X 3E4RA 3ZC7B 4DV1M 8CATA 4LF8M 4JI7M 2F5NA 1K82A 1FJGM 4DV2M 4FCWA 4LG2A 3K8ZA 2I7PA 1IY2A 1QAQA 3AFHA 4X64M 4DR1M 3A42A 4LFCM 4OX9M 4FWGA 2YR0A 3AJIB 1DGFA 1J09A 5F3WA 2F5OA 4B3SM 3FUTA 3KS8A 2XF3A 5DNYA 3JR4A 4QHTA 3DOAA 4DV3M 3HU3A 2OQ4A 1HNWM 3SFZA 1QAOA 3HWSA 5JI3E 4YY3M 1TDZA 2YNMD 2CUZA 1IY0A 4JI0M 5EXXA 4ITQA 1IM2A 1DGGA 3GO8A 4IJEA 4REZA 3C58A 5EXSA 5ITXE 4HL4A 3PFIA 4GRIA 3J7AS 3THGA 3J27B 3AL0C 2R4EA 3I51A 4QOZC 1VDDA 3WHLA 5KO3A 4DUYM 1OFIA 3L27A 3FTFA 1G8PA 2H1RA 1Q3CA 5ITTA 2F4VM 2D7GA 4NL4H 4P16A 3L26A 1LV7A 2LH0A 4B3TM 4HLQA 4DV7M 3SAVA 3GLIB 1IXZA 2R4JA 2Z4SA 3GLIA 3U61B 5EP2A 3SBJA 2BJWA 2Z4RA 3U61A 2M60A 2LXEA 1YE9A 3QAUA 3NWLA 3L28A 4LJ8A 3L2AA 2XLJA 3FKEA 2XGNA 4R3DA 2RGOA 4DR3M 1TDHA 4FCVA 3GPPA 4MGHA 4AW4A 5E6JA 3TE6A 4AQYM 3GPYA 4KODA 2AHMA 1Z5AA 3MHVC 5IWAM 1N33M 5EP1A 3GLFB 3HHZA 2VQFM 2F5QA 1W5SA 4K0KM 4NOOB 2R45A 3EIEA 4LFBM 2BJVA 4RF1A 3GLFA 1G3IA 3EIHA 2C9CA 4FVMA 4FCTA 1E9SA 1IN7A 4IJFA 5H37D 4IIWA 1L8QA 1NSFA 2BNKA 3M7GA 3AOEC 2E5LM 1SXJB 2Z3XA 2KA6B 2Z7JA 4AI6A 3R8FA 1SXJA 2KRKA 4D82A 4JI2M 4LJ5A 5EQTA 2R65A 4IBGA 1IN6A 1HR0M 4JI6M 4IBDA 3SYKA 4LJAA 3SASA 4LZZA 3FD9A 4LJ4A 1IBKM 2J7OA 4GHAA 5BPVA 3SAWA 4BB9A 3MJ5A 4L8RC 5GKNA 4LRSA 3VK8A 4DV4M 2CHVA 1SXJC 4G4NA 2QZ4A 4GKJM 5EP4A 3L29A 3PNYA 2HKJA 2V1CA 1DO0A 1TGUA 4DR7M 1J5EM 4B7FA 4MGKE 3SATA 1L2DA 4NSOB 4B3RM 5LMNM 1NJGA 2KEBA 5ITYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH C; 
#chains in the Genus database with same CATH topology
 1QZM A;  2VQE M;  1DV0 A;  2MJ5 B;  2XZU A;  4LJ6 A;  3B7N A;  4I5S A;  1Q3B A;  2XFT A;  2WSE F;  4R7G A;  2DXI A;  4PDG A;  2WSC F;  2XEP A;  4KT0 F;  2LVO C;  2QHO B;  1QAN A;  2JZ1 A;  2L4F A;  2L6O A;  4L16 A;  3FYC A;  4JYA M;  1DGH B;  4LF4 M;  2CE7 A;  4LF9 M;  2R62 A;  3FUX A;  3KOY E;  3SC3 A;  1DGH A;  1XNQ M;  1N77 A;  3HJS A;  3AKZ A;  1OAO C;  1MX0 A;  2L09 A;  3RGP A;  4JI8 M;  3GLG B;  5EJC A;  4FW9 A;  1K3W A;  1E9R A;  3HU1 A;  1AUA A;  3KP0 E;  4LGM A;  3LQQ A;  3GLG A;  3C3D A;  3PNV A;  3U60 B;  4IBE A;  4MM3 B;  2EO2 A;  4JI3 M;  3C3E A;  4W5W A;  2APL A;  3U60 A;  1I94 M;  4JN6 A;  4FWH A;  4DR4 M;  2VII A;  4LF7 M;  1Y8G A;  3D8B A;  4M0D A;  3U6C A;  3VDU A;  3MMP A;  3LMM A;  4GHL A;  2JY5 A;  3CF6 E;  1A5T A;  3FTC A;  5ITU A;  3TQS A;  1PJS A;  2ZBK B;  2CWB A;  3PVS A;  1R2Z A;  3R9X B;  2QEN A;  4FWD A;  1QVR A;  1UM8 A;  4OVZ B;  4MB7 A;  1NO1 A;  3MK6 A;  4M9Z A;  3M0E A;  1N34 M;  4PT5 A;  2XH9 A;  4OVZ A;  3VKG A;  1R6B X;  1W5T A;  1NHW C;  4L4U A;  5KQD A;  3B9P A;  3KW6 A;  5DYI A;  3U5Z A;  1LTM A;  1V92 A;  2C9O A;  2XSZ A;  1FNN A;  3H4M A;  1WGL A;  3KXE C;  4LZJ A;  2BWB A;  3E9S A;  2I7N A;  1D0L A;  1VG5 A;  4GC5 A;  4X66 M;  4JI5 M;  1P3Q Q;  3NBI A;  3IG5 A;  3HKP A;  2CV1 A;  3M6A A;  1IN8 A;  3T38 A;  2JNH A;  1NY6 A;  1GKI A;  3L25 A;  1N75 A;  2MGW A;  2ZM6 M;  1VEK A;  2HL7 A;  3HHY A;  1OAI A;  1DO2 A;  2K47 A;  4G4Q A;  2JUJ A;  1JR3 E;  2C5R A;  1JR3 D;  3QYE A;  1T3T A;  2JXN A;  4NRV A;  1SXJ E;  3SHG B;  2F5P A;  1SXJ D;  1S3S A;  4I4L A;  3U6E A;  3U6L A;  2ERC A;  4IBJ A;  4AKH A;  3UK6 A;  1NNU C;  2P5T A;  3RGS A;  4QNM A;  3TWM A;  5ITX A;  3KSX A;  1GVN A;  4D81 A;  4IBI A;  1VQ1 A;  5FTN A;  1WXQ A;  1MN3 A;  1HT2 E;  4EIW A;  1NV9 A;  1R2Y A;  1MU5 A;  3GLH B;  4GEW A;  4WW0 A;  4RF0 A;  2EA0 A;  5C1B A;  2EJS A;  3UGJ A;  2D7E A;  3E21 A;  3GLH A;  2DEN A;  3HHX A;  1IN5 A;  1TH4 A;  1TH2 A;  2DHY A;  3CTW B;  3KS4 A;  4AZF A;  4FD2 A;  4LCB A;  3J81 S;  2D7H A;  1HT1 E;  2QBY B;  1VEJ A;  3KOX E;  5E26 A;  2LVA A;  2QCU A;  2KXE A;  3FUW A;  4G4R A;  2QBY A;  2XFS A;  2FS1 A;  2K6B A;  3KOW E;  2C99 A;  1EIJ A;  3LQR A;  4M0W A;  4CIZ A;  4IBF A;  3FTD A;  1GL7 A;  1QQW A;  2L4E A;  3NBX X;  1F4I A;  4AKI A;  1NY5 A;  2JY7 A;  1KYI A;  2O5R A;  1X37 A;  4XK8 F;  3A45 A;  2RGH A;  1MJG M;  4DR5 M;  1TF0 B;  4AKG A;  1GJS A;  5FTM A;  4NXM M;  4ANR A;  3OTO M;  4Z8X A;  4GC9 A;  4XGI A;  4LF6 M;  2QPA A;  4D80 A;  1GL6 A;  4MH0 E;  1NHG C;  2CV2 A;  4MGY E;  2J5Y A;  2CV0 A;  2KW0 A;  2C96 A;  2X4A A;  1OQY A;  3J2P B;  4M9S A;  3T15 A;  4B08 A;  3HX3 A;  4LJ9 A;  1IBM M;  2DWM A;  2UUC M;  1ORY B;  2BWE A;  3DFZ A;  1JQJ C;  2LNH C;  1V34 A;  2LHG A;  5FLX S;  1Z59 A;  1R7R A;  1IXR C;  5IZ7 D;  2HWJ A;  2V1U A;  4GKK M;  3ILK A;  3IG8 A;  3K9O A;  3D8L A;  1SG9 A;  3GRU A;  4OU7 A;  4M9X A;  2QQ8 A;  4X65 M;  2DVW B;  3HHW A;  2FNA A;  1QYR A;  2M5Z A;  3Q8X A;  4G6Z A;  2VDB B;  3HY5 A;  1IQP A;  4TUW A;  3U6S A;  2CFO A;  2DAK A;  5BR8 M;  1CUK A;  4LJ7 A;  4X62 M;  3VK7 A;  2Y0T A;  5EXP A;  4CHT B;  2DWN A;  4WUR A;  3KOZ E;  5DYG A;  1HQC A;  2HHH M;  1NNJ A;  4JV5 M;  1J7K A;  2FOI C;  1QDR A;  1AIP C;  5JI2 E;  3U6O A;  4NXN M;  2OOB A;  3K1J A;  2K0B X;  1D2N A;  3JR5 A;  1G4A E;  3TWK A;  2WZJ A;  1N78 A;  4RNA A;  4CIS A;  2HCB A;  4IBK A;  3FYD A;  1NJF A;  1PJT A;  4Q7J A;  2DWZ B;  3VDP A;  2ZAN A;  2XZF A;  4XBO A;  1C1K A;  1E94 E;  3CF2 A;  1YLA A;  2KZU A;  3I4Y A;  2G3Q A;  4F2L A;  2F5S A;  2R18 A;  3I04 M;  1OTR A;  3GPU A;  3LVW A;  3GQ5 A;  5A2Q S;  1D0M A;  1PRB A;  2XSZ D;  5C18 A;  2KZS A;  5L8R F;  2A5Y B;  3CF0 A;  2UU9 M;  4LF5 M;  3SHF A;  3GLI E;  2X49 A;  3UMM A;  3FRH A;  4JXJ A;  3T6P A;  3TL4 X;  1EE8 A;  3UJN A;  3U6P A;  1HNZ M;  1R4G A;  2R6F A;  3K92 A;  4DV5 M;  2LWX A;  3FUV A;  3U6Q A;  5IRE B;  2V6Z M;  1XNR M;  3HU2 A;  1KFV A;  3GQ4 A;  1ZAE A;  1GAB A;  1Q39 A;  2EUC A;  3E46 A;  3SMS A;  2KNZ A;  3U5Z B;  2CEA A;  3RFW A;  2QNJ A;  2Y20 A;  4AG6 A;  3SYL A;  4NC6 A;  2ZAO A;  2W82 A;  2ZTC A;  1Z6T A;  4DV0 M;  1I4W A;  1XHB A;  1G59 A;  1IY1 A;  1HQY E;  2J7N A;  4L6V 6;  4CGY B;  4PD2 A;  3GRR A;  4DR2 M;  1ZQ9 A;  2L7H A;  4NRW A;  3VLF B;  1XC8 A;  2DAM A;  2C98 A;  2RKO A;  1XWI A;  2LVP C;  3I01 M;  3GLF E;  3PXG A;  2DKL A;  5EP3 A;  4Z6Y A;  1HNX M;  1HJP A;  1YUB A;  4GH9 A;  4MGZ E;  2DWL A;  1OKS A;  3LCV B;  2CHQ A;  2EKK A;  4Y28 F;  1Z5B A;  3A98 B;  3KP1 E;  1OJL A;  1TTE A;  1VEG A;  3GLH E;  2FFJ A;  4LY6 A;  2R46 A;  4KLN A;  4GIT A;  1TH3 A;  2UXD M;  1PJJ A;  2CHG A;  3KVW A;  3DA1 A;  2MH8 A;  2YQZ A;  4L15 A;  1XXH B;  1NVM A;  1ZMW A;  3W0L B;  1L2C A;  2UUA M;  1QAM A;  3B7Z A;  2JY8 A;  4G3O A;  1KSF X;  4GIP A;  3J7B A;  4GMQ A;  3FUU A;  1XXH A;  3VFD A;  1K3X A;  1Z5C A;  4KO8 A;  3W68 A;  4AG5 A;  1L1T A;  3K9P A;  5ITQ A;  3GQ3 A;  3QYB A;  2G8L A;  3W0F A;  2DZO B;  1PJI A;  2JWS A;  2LVQ D;  2NQ8 C;  4ZPX A;  1PM5 A;  2DZL A;  4BBA A;  2UUB M;  4LFA M;  3GP1 A;  2FE8 A;  3U6M A;  1E32 A;  2JZ0 A;  5FTK A;  4G4O A;  1XMO M;  4IBB A;  4NSR A;  2O01 F;  1QUS A;  4IBC A;  3ZQJ A;  4DV6 M;  4PDI A;  1L1Z A;  5KPT A;  3AOE A;  4QNR A;  3AV0 A;  3CGW A;  3UZU A;  3VKH A;  5KPR A;  3KSJ A;  2DI0 A;  3SMP A;  2JP7 A;  1IXS B;  4B3M M;  5ITR A;  1N36 M;  3KDS E;  5IT9 S;  1H6U A;  3RE8 A;  2KNA A;  3WHK A;  1IXS A;  4DBG B;  1OFH A;  2DAI A;  3T1H M;  4CJ6 A;  2UXB M;  5FTL A;  1R5L A;  3QWL A;  4I81 A;  2ZTD A;  2ZAM A;  2DHR A;  2WSF F;  1WR1 B;  3GRV A;  5KPZ A;  4DR6 M;  2Y21 A;  2Z8Y M;  3HJQ A;  3ZH9 B;  4R71 A;  1DGB A;  5LMU M;  4DUZ M;  1JR3 A;  3T1Y M;  1IFY A;  3HGI A;  7CAT A;  3ZCB B;  3GRY A;  2JY6 B;  3K2L A;  4MGI E;  1L2B A;  1VDL A;  2DNA A;  2JA2 A;  2KRU A;  2YFQ A;  3AOG A;  3TPZ A;  1IN4 A;  4YHH M;  1T43 A;  3J80 S;  3KFU G;  2QSF X;  2UXC M;  4BLC A;  3A46 A;  2L7I A;  4QHS A;  4LGY A;  3GLG E;  4LRT A;  3FTE A;  1XMQ M;  1WGN A;  3F92 A;  4S12 A;  2Y0Q A;  4B7G A;  3SAR A;  1PGY A;  3U6D A;  3DZD A;  1GLN A;  3JAM S;  2CP8 A;  5FTJ A;  4QOS A;  4PCZ A;  1YSY A;  1IBL M;  3LCU A;  2DAG A;  3HJ8 A;  1N32 M;  4B7H A;  3TWL A;  2X8A A;  4JI4 M;  4II7 A;  3BOS A;  3H4J A;  2OPF A;  1WJ7 A;  2LHC A;  5FSW A;  3HZJ A;  4OW0 A;  4F1I A;  4KHP M;  1G41 A;  3GPX A;  3B7Q A;  4UN2 B;  2G5G X;  2LTU A;  4P17 A;  2DZN B;  3SAU A;  3LVV A;  5KQ8 A;  2Q2E B;  4JI1 M;  2R44 A;  1NV8 A;  2KNV A;  3I4V A;  2DAE A;  4A3V B;  4I8O A;  4L78 A;  5EXT A;  2QP9 X;  3E4R A;  3ZC7 B;  4DV1 M;  8CAT A;  4LF8 M;  4JI7 M;  2F5N A;  1K82 A;  1FJG M;  4DV2 M;  4FCW A;  4LG2 A;  3K8Z A;  2I7P A;  1IY2 A;  1QAQ A;  3AFH A;  4X64 M;  4DR1 M;  3FE3 A;  3A42 A;  4LFC M;  4OX9 M;  4FWG A;  2YR0 A;  3AJI B;  1DGF A;  1J09 A;  5F3W A;  2F5O A;  4B3S M;  3FUT A;  3KS8 A;  2XF3 A;  5DNY A;  3JR4 A;  4QHT A;  3DOA A;  4DV3 M;  3HU3 A;  2OQ4 A;  1HNW M;  3SFZ A;  1QAO A;  3HWS A;  5JI3 E;  3B74 A;  4YY3 M;  1TDZ A;  2O25 A;  2YNM D;  2B3T A;  1GJT A;  1ZV1 A;  1QDT A;  2CUZ A;  1IY0 A;  1XXH E;  2OO9 A;  5EXX A;  4JI0 M;  4ITQ A;  1IM2 A;  1DGG A;  3GO8 A;  4IJE A;  4REZ A;  3C58 A;  5EXS A;  4HEO A;  1Q02 A;  5ITX E;  4HL4 A;  3PFI A;  4GRI A;  3J7A S;  3Q8G A;  3THG A;  3J27 B;  3AL0 C;  2R4E A;  3I51 A;  5DFL A;  4QOZ C;  4RKU F;  1VDD A;  3WHL A;  2K9D A;  1BVS A;  5KO3 A;  4DUY M;  1OFI A;  1EFU B;  3FRI A;  3L27 A;  1D0K A;  3FTF A;  1G8P A;  2H1R A;  1Q3C A;  2LBC A;  5ITT A;  1JB0 F;  2F4V M;  2D7G A;  1OIP A;  2LVN C;  2CRU A;  4NL4 H;  4P16 A;  3L26 A;  1LV7 A;  2LH0 A;  4B3T M;  4HLQ A;  4DV7 M;  3SAV A;  3GLI B;  1IXZ A;  2R4J A;  2Z4S A;  2GNO A;  3GLI A;  3U61 B;  5EP2 A;  3BXW A;  3SBJ A;  2BJW A;  1T6O A;  2Z4R A;  3U61 A;  1RU3 A;  2M60 A;  2LXE A;  2OOA A;  1YE9 A;  3QAU A;  3NWL A;  3L28 A;  4LJ8 A;  3L2A A;  2XLJ A;  3FKE A;  2XGN A;  4R3D A;  2RGO A;  4DR3 M;  1TDH A;  4FCV A;  3GPP A;  4MGH A;  4AW4 A;  5E6J A;  3TE6 A;  4AQY M;  4WP2 A;  3GPY A;  2FH0 A;  1ZMV A;  3IHP A;  2R0I A;  4KOD A;  2AHM A;  1Z5A A;  3MHV C;  5IWA M;  1N33 M;  5EP1 A;  3GLF B;  3HHZ A;  2VQF M;  2F5Q A;  1W5S A;  4K0K M;  4NOO B;  2R45 A;  3EIE A;  4LFB M;  2VF8 A;  2BJV A;  4RF1 A;  3GLF A;  2KDL A;  1G3I A;  1G71 A;  3EIH A;  3V76 A;  1TR8 A;  2C9C A;  2HAK A;  2VF7 A;  4FCT A;  1E9S A;  1IN7 A;  4FVM A;  4IJF A;  2MR9 A;  5H37 D;  4IIW A;  1WHC A;  1L8Q A;  1NSF A;  2BNK A;  3M7G A;  3AOE C;  2E5L M;  1SXJ B;  2KHH A;  2Z3X A;  2KA6 B;  2Z7J A;  4AI6 A;  3R8F A;  1C7Y A;  1SXJ A;  2N35 A;  2KRK A;  1ZMU A;  4D82 A;  4JI2 M;  3BBZ A;  4LJ5 A;  3LW5 F;  5EQT A;  1XB2 B;  2R65 A;  4IBG A;  1IN6 A;  3B89 A;  3IEC A;  1HR0 M;  4JI6 M;  2EKF A;  2L2D A;  4IBD A;  1V33 A;  3SYK A;  4LJA A;  3SAS A;  4LZZ A;  3FD9 A;  4LJ4 A;  1IBK M;  1UFZ A;  2J7O A;  5BPV A;  3SAW A;  4BB9 A;  4GHA A;  3MJ5 A;  4L8R C;  1QUT A;  5GKN A;  4LRS A;  3VK8 A;  2H5X A;  2CHV A;  2GQF A;  1SXJ C;  4DV4 M;  2QZ4 A;  4G4N A;  4GKJ M;  5EP4 A;  3L29 A;  3PNY A;  2HKJ A;  1QZE A;  2V1C A;  1DO0 A;  1TGU A;  1GO5 A;  1OIZ A;  1PJQ A;  4DR7 M;  1J5E M;  2MRO B;  4B7F A;  4MGK E;  3SAT A;  1L2D A;  3C9P A;  3W67 A;  4NSO B;  4B3R M;  2RRU A;  5LMN M;  1NJG A;  1WIV A;  2KEB A;  5ITY A; 
#chains in the Genus database with same CATH homology
 1QZM A;  2VQE M;  2XZU A;  4LJ6 A;  4I5S A;  1Q3B A;  2XFT A;  4R7G A;  2DXI A;  4PDG A;  2XEP A;  1QAN A;  2L6O A;  4L16 A;  3FYC A;  4JYA M;  1DGH B;  4LF4 M;  2CE7 A;  4LF9 M;  2R62 A;  3FUX A;  3KOY E;  3SC3 A;  1DGH A;  1XNQ M;  1N77 A;  3HJS A;  3AKZ A;  2L09 A;  1MX0 A;  3RGP A;  4JI8 M;  3GLG B;  5EJC A;  4FW9 A;  1K3W A;  1E9R A;  3HU1 A;  3KP0 E;  4LGM A;  3LQQ A;  3GLG A;  3PNV A;  3U60 B;  4IBE A;  4MM3 B;  2EO2 A;  4JI3 M;  4W5W A;  3U60 A;  1I94 M;  4JN6 A;  4FWH A;  4DR4 M;  2VII A;  4LF7 M;  4M0D A;  3D8B A;  3U6C A;  3VDU A;  3LMM A;  4GHL A;  3CF6 E;  3FTC A;  5ITU A;  3TQS A;  2ZBK B;  3PVS A;  1R2Z A;  3R9X B;  2QEN A;  4FWD A;  1QVR A;  1UM8 A;  4OVZ B;  4MB7 A;  3MK6 A;  4M9Z A;  3M0E A;  1N34 M;  4PT5 A;  2XH9 A;  4OVZ A;  3VKG A;  1R6B X;  1W5T A;  1NHW C;  4L4U A;  5KQD A;  3B9P A;  3KW6 A;  5DYI A;  3U5Z A;  2C9O A;  2XSZ A;  3H4M A;  1FNN A;  3KXE C;  4LZJ A;  3E9S A;  2I7N A;  4X66 M;  4GC5 A;  4JI5 M;  3NBI A;  3IG5 A;  3HKP A;  2CV1 A;  3M6A A;  1IN8 A;  3T38 A;  1NY6 A;  1GKI A;  3L25 A;  1N75 A;  2ZM6 M;  2HL7 A;  3HHY A;  1DO2 A;  2K47 A;  4G4Q A;  2C5R A;  1JR3 D;  4NRV A;  1T3T A;  1SXJ E;  3SHG B;  2F5P A;  1SXJ D;  1S3S A;  4I4L A;  3U6E A;  3U6L A;  2ERC A;  4IBJ A;  4AKH A;  3UK6 A;  1NNU C;  2P5T A;  3RGS A;  4QNM A;  3TWM A;  5ITX A;  3KSX A;  1GVN A;  4D81 A;  4IBI A;  5FTN A;  1WXQ A;  4EIW A;  1HT2 E;  1R2Y A;  1MU5 A;  3GLH B;  4WW0 A;  4RF0 A;  2EA0 A;  5C1B A;  3UGJ A;  2D7E A;  3GLH A;  3HHX A;  1IN5 A;  3KS4 A;  1TH4 A;  1TH2 A;  3CTW B;  4AZF A;  4FD2 A;  4LCB A;  3J81 S;  2D7H A;  1HT1 E;  2QBY B;  3KOX E;  5E26 A;  2QCU A;  2KXE A;  3FUW A;  4G4R A;  2QBY A;  2XFS A;  3KOW E;  2C99 A;  3LQR A;  4M0W A;  4IBF A;  3FTD A;  1GL7 A;  1QQW A;  4AKI A;  1NY5 A;  1KYI A;  2O5R A;  1X37 A;  3A45 A;  2RGH A;  4DR5 M;  4AKG A;  5FTM A;  4NXM M;  3OTO M;  4Z8X A;  4GC9 A;  4XGI A;  4LF6 M;  2QPA A;  4D80 A;  1GL6 A;  4MH0 E;  1NHG C;  2CV2 A;  4MGY E;  2CV0 A;  2KW0 A;  2C96 A;  2X4A A;  3J2P B;  4M9S A;  3T15 A;  4B08 A;  4LJ9 A;  1IBM M;  2DWM A;  2UUC M;  1ORY B;  3DFZ A;  1JQJ C;  2LNH C;  5FLX S;  1Z59 A;  1R7R A;  1IXR C;  5IZ7 D;  2V1U A;  4GKK M;  3ILK A;  3IG8 A;  3D8L A;  3GRU A;  4OU7 A;  4M9X A;  4X65 M;  2DVW B;  3HHW A;  2FNA A;  1QYR A;  2M5Z A;  3Q8X A;  4G6Z A;  4TUW A;  1IQP A;  3U6S A;  2CFO A;  5BR8 M;  4LJ7 A;  4X62 M;  3VK7 A;  2Y0T A;  5EXP A;  4CHT B;  2DWN A;  4WUR A;  3KOZ E;  5DYG A;  1HQC A;  2HHH M;  1NNJ A;  4JV5 M;  1J7K A;  2FOI C;  5JI2 E;  3U6O A;  4NXN M;  3K1J A;  3JR5 A;  1D2N A;  1G4A E;  3TWK A;  1N78 A;  4RNA A;  4CIS A;  2HCB A;  4IBK A;  3FYD A;  1NJF A;  2DWZ B;  3VDP A;  2ZAN A;  2XZF A;  4XBO A;  1C1K A;  1E94 E;  3CF2 A;  2KZU A;  3I4Y A;  2F5S A;  2R18 A;  3GPU A;  3GQ5 A;  3LVW A;  5A2Q S;  5C18 A;  2XSZ D;  2KZS A;  2A5Y B;  3CF0 A;  2UU9 M;  4LF5 M;  3SHF A;  2X49 A;  3UMM A;  4JXJ A;  3TL4 X;  1EE8 A;  3UJN A;  3U6P A;  1HNZ M;  3K92 A;  4DV5 M;  2LWX A;  3FUV A;  3U6Q A;  5IRE B;  2V6Z M;  1XNR M;  3HU2 A;  1KFV A;  3GQ4 A;  1ZAE A;  1Q39 A;  2EUC A;  3SMS A;  3U5Z B;  2CEA A;  3RFW A;  2Y20 A;  4AG6 A;  3SYL A;  4DV0 M;  2ZAO A;  2W82 A;  1Z6T A;  1I4W A;  1XHB A;  1G59 A;  1IY1 A;  1HQY E;  2J7N A;  4CGY B;  4PD2 A;  4DR2 M;  3GRR A;  1ZQ9 A;  2L7H A;  4NRW A;  3VLF B;  1XC8 A;  2C98 A;  2RKO A;  1XWI A;  3PXG A;  1HNX M;  5EP3 A;  4Z6Y A;  2DWL A;  1YUB A;  4GH9 A;  4MGZ E;  2CHQ A;  1Z5B A;  3A98 B;  3KP1 E;  1OJL A;  2FFJ A;  4LY6 A;  2R46 A;  4KLN A;  4GIT A;  1TH3 A;  2UXD M;  1PJJ A;  2CHG A;  3KVW A;  3DA1 A;  2YQZ A;  4L15 A;  3W0L B;  1XXH B;  1NVM A;  1L2C A;  2UUA M;  1QAM A;  4GIP A;  4GMQ A;  1KSF X;  3J7B A;  3FUU A;  1XXH A;  3VFD A;  1K3X A;  1Z5C A;  4KO8 A;  4AG5 A;  1L1T A;  5ITQ A;  3GQ3 A;  2G8L A;  3W0F A;  2DZO B;  1PJI A;  2NQ8 C;  4ZPX A;  1PM5 A;  4BBA A;  2UUB M;  4LFA M;  3GP1 A;  2FE8 A;  3U6M A;  1E32 A;  4G4O A;  5FTK A;  1XMO M;  4IBB A;  4NSR A;  4DV6 M;  4IBC A;  4PDI A;  1L1Z A;  5KPT A;  3AOE A;  4QNR A;  3AV0 A;  3UZU A;  3VKH A;  5KPR A;  3KSJ A;  3SMP A;  1IXS B;  4B3M M;  5ITR A;  1N36 M;  3KDS E;  5IT9 S;  1H6U A;  3RE8 A;  3WHK A;  3T1H M;  1OFH A;  2UXB M;  5FTL A;  3QWL A;  4I81 A;  2ZAM A;  2DHR A;  3GRV A;  5KPZ A;  4DR6 M;  2Y21 A;  3HJQ A;  3ZH9 B;  5LMU M;  4DUZ M;  1DGB A;  1JR3 A;  3T1Y M;  3HGI A;  7CAT A;  3ZCB B;  3GRY A;  3K2L A;  1L2B A;  4MGI E;  2JA2 A;  2KRU A;  2YFQ A;  3AOG A;  3TPZ A;  1IN4 A;  4YHH M;  3J80 S;  3KFU G;  2UXC M;  4BLC A;  3A46 A;  2L7I A;  4QHS A;  4LGY A;  4LRT A;  3FTE A;  1XMQ M;  4S12 A;  2Y0Q A;  4B7G A;  3SAR A;  3U6D A;  3DZD A;  1GLN A;  3JAM S;  4PCZ A;  5FTJ A;  4QOS A;  1IBL M;  1YSY A;  1N32 M;  3HJ8 A;  4B7H A;  3TWL A;  2X8A A;  4JI4 M;  4II7 A;  3BOS A;  2OPF A;  5FSW A;  4OW0 A;  4KHP M;  1G41 A;  3GPX A;  2G5G X;  2DZN B;  3SAU A;  3LVV A;  5KQ8 A;  2Q2E B;  4JI1 M;  3I4V A;  4A3V B;  4I8O A;  4L78 A;  5EXT A;  2QP9 X;  3E4R A;  3ZC7 B;  4DV1 M;  8CAT A;  4LF8 M;  4JI7 M;  2F5N A;  1K82 A;  1FJG M;  4DV2 M;  4FCW A;  4LG2 A;  3K8Z A;  2I7P A;  1IY2 A;  1QAQ A;  3AFH A;  4X64 M;  4DR1 M;  3A42 A;  4LFC M;  4OX9 M;  4FWG A;  2YR0 A;  3AJI B;  1DGF A;  1J09 A;  5F3W A;  2F5O A;  4B3S M;  3FUT A;  3KS8 A;  2XF3 A;  5DNY A;  3JR4 A;  4QHT A;  3DOA A;  4DV3 M;  3HU3 A;  2OQ4 A;  1HNW M;  3SFZ A;  1QAO A;  3HWS A;  5JI3 E;  4YY3 M;  1TDZ A;  2YNM D;  2CUZ A;  1IY0 A;  4JI0 M;  5EXX A;  4ITQ A;  1IM2 A;  1DGG A;  3GO8 A;  4IJE A;  4REZ A;  3C58 A;  5EXS A;  5ITX E;  4HL4 A;  3PFI A;  4GRI A;  3J7A S;  3THG A;  3J27 B;  3AL0 C;  2R4E A;  3I51 A;  4QOZ C;  1VDD A;  3WHL A;  5KO3 A;  4DUY M;  1OFI A;  3L27 A;  3FTF A;  1G8P A;  2H1R A;  1Q3C A;  5ITT A;  2F4V M;  2D7G A;  4NL4 H;  4P16 A;  3L26 A;  1LV7 A;  2LH0 A;  4B3T M;  4HLQ A;  4DV7 M;  3SAV A;  3GLI B;  1IXZ A;  2R4J A;  2Z4S A;  3GLI A;  3U61 B;  5EP2 A;  3SBJ A;  2BJW A;  2Z4R A;  3U61 A;  2M60 A;  2LXE A;  1YE9 A;  3QAU A;  3NWL A;  3L28 A;  4LJ8 A;  3L2A A;  2XLJ A;  3FKE A;  2XGN A;  4R3D A;  2RGO A;  4DR3 M;  1TDH A;  4FCV A;  3GPP A;  4MGH A;  4AW4 A;  5E6J A;  3TE6 A;  4AQY M;  3GPY A;  4KOD A;  2AHM A;  1Z5A A;  3MHV C;  5IWA M;  1N33 M;  5EP1 A;  3GLF B;  3HHZ A;  2VQF M;  2F5Q A;  1W5S A;  4K0K M;  4NOO B;  2R45 A;  3EIE A;  4LFB M;  2BJV A;  4RF1 A;  3GLF A;  1G3I A;  3EIH A;  2C9C A;  4FVM A;  4FCT A;  1E9S A;  1IN7 A;  4IJF A;  5H37 D;  4IIW A;  1L8Q A;  1NSF A;  2BNK A;  3M7G A;  3AOE C;  2E5L M;  1SXJ B;  2Z3X A;  2KA6 B;  2Z7J A;  4AI6 A;  3R8F A;  1SXJ A;  2KRK A;  4D82 A;  4JI2 M;  4LJ5 A;  5EQT A;  2R65 A;  4IBG A;  1IN6 A;  1HR0 M;  4JI6 M;  4IBD A;  3SYK A;  4LJA A;  3SAS A;  4LZZ A;  3FD9 A;  4LJ4 A;  1IBK M;  2J7O A;  4GHA A;  5BPV A;  3SAW A;  4BB9 A;  3MJ5 A;  4L8R C;  5GKN A;  4LRS A;  3VK8 A;  4DV4 M;  2CHV A;  1SXJ C;  4G4N A;  2QZ4 A;  4GKJ M;  5EP4 A;  3L29 A;  3PNY A;  2HKJ A;  2V1C A;  1DO0 A;  1TGU A;  4DR7 M;  1J5E M;  4B7F A;  4MGK E;  3SAT A;  1L2D A;  4NSO B;  4B3R M;  5LMN M;  1NJG A;  2KEB A;  5ITY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...