2LNHC

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
47
structure length
47
Chain Sequence
LPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
molecule keywords Neural Wiskott-Aldrich syndrome protein
total genus 5
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.830 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lnhC00
2LNHC
chains in the Genus database with same CATH superfamily
4XBOA 3T1HM 4DUZM 2DAMA 3CGWA 2OOBA 3GLHE 2KZSA 4CJ6A 3VDPA 1NSFA 4DV4M 3KFUG 4IBFA 4LFCM 3D8BA 3J7BA 1R5LA 3B7QA 4LJ9A 2RRUA 3J80S 4BB9A 3VK7A 2KA6B 2D7GA 3SFZA 5JI2E 2CRUA 1Z6TA 1QUTA 2DI0A 4RKUF 1WJ7A 1GLNA 1G41A 2D7EA 2FE8A 1E32A 2XFTA 3FRHA 4I5SA 1VEKA 3U6PA 1VDDA 2J5YA 2KNZA 4QOZC 2EUCA 3EIHA 2R65A 4I8OA 5ITXA 2JZ0A 1XHBA 3R8FA 1R7RA 2BWEA 4QOSA 4PT5A 4OU7A 3SAVA 1R4GA 5ITQA 1DV0A 3I01M 2LH0A 1QZEA 3FUTA 1N75A 1MU5A 5LMNM 5ITXE 1OIZA 2NQ8C 2DHRA 1IBLM 2F5SA 3SARA 1YE9A 4DV5M 4F2LA 4KT0F 1XB2B 4GH9A 2R4EA 3LVWA 2KDLA 4IBJA 2JZ1A 3PXGA 5IT9S 1DGHA 2YFQA 1QAOA 2L4EA 4GEWA 3J7AS 2LVPC 4B7HA 3U6SA 1JR3A 5ITTA 5KO3A 4TUWA 3FRIA 1DGFA 2I7PA 2JY6B 2ZTCA 3RE8A 2JXNA 2L09A 1DGHB 1YUBA 2LTUA 4LJ5A 1JB0F 3GRYA 1Z5CA 2X49A 4JI4M 3QYEA 2MR9A 2HHHM 4LFAM 5E26A 2Y20A 5EP4A 3U60A 4JI2M 4MH0E 8CATA 3I4VA 2MJ5B 3IHPA 4OX9M 1Q3CA 4CGYB 5BPVA 2JY7A 2M60A 1TH2A 1IQPA 4FD2A 4IIWA 5C18A 3B9PA 2KNAA 4ANRA 3EIEA 4PDGA 1N77A 1QDTA 2LVQD 1TDZA 1HT2E 1TR8A 5EP3A 4HLQA 2F5NA 3B7NA 2HKJA 2BJWA 5KQDA 1F4IA 2RGOA 3T1YM 3VFDA 1L1ZA 2Z4RA 1HQCA 2QHOB 1ZMVA 1JR3D 1PJSA 4L8RC 3JAMS 2VDBB 3K1JA 1T6OA 2KXEA 3HU2A 4JXJA 5BR8M 1PM5A 4LJ6A 3GRUA 2VQEM 2CHQA 3U6EA 2KNVA 3KSJA 5EJCA 2K9DA 3FYCA 2CE7A 3GLGB 1H6UA 2XEPA 4AZFA 4K0KM 1SXJE 2DWLA 4B08A 1IXRC 2B3TA 2AHMA 4JI8M 3FKEA 3GPUA 2N35A 3T6PA 3FTEA 2H1RA 2L7HA 2ZAMA 4D81A 1GJSA 3U61B 3DA1A 1C1KA 4YY3M 5FTKA 4B7FA 4EIWA 2QCUA 3QWLA 1EFUB 1D0KA 1PRBA 1J7KA 2ZTDA 4D80A 1AIPC 3U6OA 2XZFA 4LGYA 2DVWB 3K92A 3TPZA 4LF5M 1FNNA 3GLFA 2VQFM 3WHKA 3BXWA 2XSZD 4HL4A 1OQYA 3HHXA 1OAOC 3VDUA 2E5LM 2QZ4A 2UUCM 2CHGA 2DENA 1N78A 4W5WA 1V33A 3HHYA 3CF0A 3L2AA 3HWSA 3HZJA 2JY5A 1SXJA 1S3SA 2LHCA 4FWGA 3GLIE 2MROB 1W5TA 1KSFX 3CTWB 4LG2A 2APLA 2QPAA 4HEOA 4PD2A 5IWAM 2KW0A 2BJVA 4MGIE 4DR4M 2CEAA 3E4RA 3HKPA 1YSYA 5E6JA 5ITYA 3UGJA 2QBYB 1HNWM 2L2DA 4KO8A 5FLXS 3HU3A 1YLAA 1E9SA 1G71A 3ZCBB 2UUAM 4BBAA 1GABA 4JI5M 1Z59A 1L1TA 1P3QQ 2CWBA 4LZJA 3WHLA 4QNRA 3IECA 3B7ZA 1GKIA 4JV5M 1NY6A 1OFHA 1QUSA 3A98B 1ZMUA 3FD9A 3GLHA 3GPPA 4S12A 2FS1A 2DZOB 1NV9A 5H37D 3PNYA 4JYAM 2Y0QA 3A46A 4Z8XA 2L7IA 2OQ4A 2ZANA 3W67A 3HGIA 1TGUA 4D82A 2KRUA 2Z7JA 4P16A 5FTMA 2F5PA 4QNMA 1LTMA 1SXJC 2QNJA 4DV6M 4DR7M 2ZM6M 2Z8YM 3GLGA 1QQWA 2J7NA 4G4RA 4LF7M 1D0LA 2RGHA 1MX0A 2FOIC 1Q39A 2G3QA 1IN6A 2KEBA 4LZZA 4XK8F 3RFWA 5KPTA 1PJJA 4AKGA 2V1UA 4X64M 1QDRA 3RGSA 4IBGA 2W82A 2YNMD 1HR0M 3HX3A 1E94E 1N32M 1T43A 3GRRA 1WGNA 1KYIA 3GRVA 1NO1A 4Q7JA 2LWXA 4FCTA 1EE8A 1IN4A 4NC6A 3GQ5A 1WHCA 1IN8A 3FUUA 3TL4X 4AG6A 1DO0A 1TDHA 1R6BX 4MGZE 4DBGB 4IJFA 2DWMA 1QAMA 2EKFA 1PGYA 2I7NA 2GQFA 4OVZB 2DWNA 1GO5A 2HL7A 2C96A 4GKKM 4G3OA 4UN2B 2R4JA 3CF6E 3QYBA 2HAKA 4LCBA 4DR5M 3KP1E 3LMMA 3M6AA 3FYDA 1A5TA 3FTFA 3L25A 4KODA 2XH9A 3HJQA 1OIPA 1G8PA 3VK8A 2FNAA 1XXHA 5LMUM 4NXMM 3BOSA 1UM8A 4R71A 3RGPA 5A2QS 4M9ZA 2UXCM 4NSOB 3GLFE 2EJSA 1L8QA 1NHGC 3VKHA 1HT1E 3KS8A 5FSWA 4AI6A 1TH4A 2CP8A 4KLNA 2KRKA 2HWJA 3FTDA 4GRIA 4Z6YA 2XLJA 2EA0A 3HHZA 4AKHA 3FE3A 5DYGA 1IBKM 4RF1A 1T3TA 2R0IA 3B89A 5EP2A 1ORYB 1Z5AA 4LJ7A 1AUAA 1WIVA 3I04M 3L27A 1D2NA 5EQTA 3SATA 2LVOC 2O01F 3GP1A 1ZV1A 3M0EA 5DFLA 1IY2A 4JI3M 3UJNA 4AQYM 3U6LA 4I4LA 1TF0B 4I81A 4IBEA 2JP7A 5EP1A 1OJLA 1J5EM 5FTNA 1XXHB 2QSFX 1X37A 4P17A 4CIZA 1DO2A 3H4MA 2BWBA 3AOGA 4FVMA 4II7A 1I94M 3U60B 2WSCF 4LJ8A 1TH3A 3SASA 1V34A 2V6ZM 2JA2A 4GITA 3AL0C 3MJ5A 2QP9X 3MK6A 3W0LB 2YR0A 4L16A 1IY0A 4REZA 3LVVA 3C3DA 3SYLA 2F5QA 2QQ8A 2V1CA 3CF2A 4GC5A 3R9XB 4YHHM 3W0FA 2CV0A 3KSXA 2JUJA 1NVMA 3C58A 1KFVA 2WSFF 2ZBKB 4DV1M 1VG5A 5IREB 3TWLA 4MM3B 3UMMA 2FFJA 3GLHB 4JI6M 2XGNA 3KXEC 1IN7A 1QVRA 1GL6A 3KDSE 2DAKA 4DR2M 2CV2A 2UU9M 1QAQA 1NY5A 1N36M 4NSRA 1QYRA 3E9SA 2HCBA 4B3TM 1G4AE 4QHSA 4NOOB 4MGHA 1XNRM 5L8RF 4GKJM 2R6FA 3DZDA 2UXDM 4NRWA 4CHTB 4GMQA 4IBCA 3LQRA 3GQ4A 1R2YA 3MHVC 1N33M 1WGLA 3LCVB 5FTJA 2CUZA 1HNXM 4JN6A 4OVZA 5DYIA 3LW5F 1MJGM 3AFHA 3M7GA 4GC9A 4KHPM 4LGMA 2C98A 2MGWA 3GPYA 3SC3A 1EIJA 2JNHA 3AOEA 1DGGA 2DXIA 1NNUC 1XWIA 2X8AA 1IBMM 3SMSA 1SXJB 4L6V6 4WW0A 3JR4A 1IXSA 3MMPA 1XXHE 2K0BX 4Y28F 3U6MA 2ZAOA 5EXPA 2LVAA 2G8LA 1IY1A 2UXBM 1GVNA 3ZC7B 1VEJA 1D0MA 2J7OA 2QBYA 3UZUA 3I4YA 1WR1B 2WZJA 4RNAA 3VLFB 1VQ1A 1L2DA 4LY6A 1RU3A 2GNOA 4FCWA 4MGYE 5DNYA 4B3SM 2EO2A 2MH8A 3GQ3A 3K8ZA 1XC8A 4G6ZA 4FWDA 3C3EA 3KP0E 2DZLA 1UFZA 3PNVA 1OFIA 2G5GX 2LNHC 3E21A 1DGBA 3TQSA 3GPXA 4LF8M 4LFBM 4XGIA 4DR3M 1Q02A 1BVSA 3KOXE 1IM2A 1L2CA 4L78A 2DWZB 3B74A 4X66M 1FJGM 4R7GA 2LVNC 3FUWA 2VF8A 2BNKA 4GHAA 4LF4M 2YQZA 2F5OA 4LJAA 3FUXA 3SMPA 1IXZA 2M5ZA 3NBIA 2C5RA 4LRSA 3GLGE 2K6BA 3ZQJA 2Z3XA 3U5ZB 3FUVA 4M0DA 4DV7M 2C9OA 5ITRA 2O25A 3J81S 1R2ZA 5GKNA 3GLIA 1OTRA 2R62A 4PDIA 1GL7A 3TWKA 4LRTA 1HQYE 3L29A 4FW9A 4DV3M 4G4QA 1NNJA 3DOAA 3IG5A 1K3WA 1OAIA 1QANA 5EXXA 3AV0A 2FH0A 2K47A 1PJIA 2EKKA 4L4UA 1JR3E 1SG9A 4JI0M 1K82A 4GHLA 3THGA 1Y8GA 4R3DA 3U6CA 2Z4SA 2O5RA 1TTEA 2XF3A 5EXTA 4B3MM 3AKZA 2UUBM 2DAGA 1PJTA 3IG8A 3LQQA 4MB7A 3ZH9B 5EXSA 4RF0A 2DNAA 1E9RA 1CUKA 3JR5A 3LCUA 3GLIB 1G59A 1N34M 4IBIA 2H5XA 3J27B 3K9PA 5C1BA 4AKIA 2A5YB 2C99A 3K2LA 3SBJA 5IZ7D 4M9XA 1ZQ9A 1ZAEA 2R45A 3VKGA 3W68A 1XNQM 1HJPA 2R44A 4X62M 1VDLA 1C7YA 3TWMA 4NL4H 2VIIA 4L15A 4AW4A 1J09A 4DR1M 3FTCA 2CV1A 2Y0TA 4FCVA 2DAEA 4PCZA 3A45A 2JY8A 2Y21A 4OW0A 3DFZA 3TE6A 4JI7M 1VEGA 1I4WA 3KVWA 4A3VB 4NXNM 2OPFA 1IFYA 3AJIB 3SYKA 2R18A 3KOYE 5F3WA 1W5SA 4DV0M 3U6QA 3KW6A 2KZUA 4M9SA 3U6DA 2ERCA 2F4VM 4G4NA 4IBKA 2VF7A 3QAUA 1IXSB 3SAWA 3C9PA 3HY5A 4WURA 1NJGA 4DUYM 4F1IA 2CFOA 3BBZA 2CHVA 2LBCA 5ITUA 3T38A 4NRVA 3UK6A 2JWSA 2P5TA 4ITQA 1IN5A 3HJ8A 4B3RM 3U5ZA 3D8LA 4AG5A 2DHYA 4IBBA 3KOWE 5FTLA 3U61A 1G3IA 4CISA 4DR6M 2XZUA 2OO9A 1L2BA 1JQJC 2LHGA 3PVSA 2Q2EB 3T15A 4B7GA 4X65M 4BLCA 3GLFB 4LF6M 2L6OA 3Q8GA 3I51A 4LF9M 1WXQA 4MGKE 3GO8A 3PFIA 5JI3E 4WP2A 5KPRA 4DV2M 2D7HA 2R46A 3Q8XA 1NHWC 4LJ4A 3NWLA 7CATA 1MN3A 1XMOM 1QZMA 2X4AA 5KPZA 3H4JA 2LXEA 4G4OA 4JI1M 4QHTA 2DZNB 1NV8A 3KOZE 3L26A 1PJQA 1HNZM 3SHGB 3AOEC 1Q3BA 3HHWA 4GIPA 1XMQM 2XSZA 1K3XA 2DKLA 4IBDA 1OKSA 4IJEA 1Z5BA 2OOAA 2XFSA 3KS4A 2RKOA 5KQ8A 2KHHA 1SXJD 3E46A 3F92A 3OTOM 2WSEF 1NJFA 3L28A 3HJSA 4M0WA 3ILKA 2L4FA 2C9CA 1GJTA 1ZMWA 3K9OA 3V76A 2DAIA 3HU1A 1V92A 2QENA 4ZPXA 3J2PB 3SHFA 3SAUA 3NBXX 4FWHA 1LV7A 3A42A
chains in the Genus database with same CATH topology
4XBOA 3T1HM 4DUZM 4DV4M 2KZSA 3VDPA 1NSFA 3KFUG 4IBFA 4LFCM 3D8BA 3J7BA 4LJ9A 3J80S 4BB9A 3VK7A 2KA6B 2D7GA 3SFZA 5JI2E 1Z6TA 1GLNA 1G41A 2D7EA 2FE8A 1E32A 2XFTA 4I5SA 3U6PA 1VDDA 4QOZC 2EUCA 3EIHA 2R65A 4I8OA 5ITXA 1XHBA 3R8FA 1R7RA 4QOSA 4PT5A 4OU7A 3SAVA 5ITQA 2LH0A 3FUTA 1N75A 1MU5A 5LMNM 5ITXE 2NQ8C 1IBLM 2DHRA 2F5SA 3SARA 1YE9A 4DV5M 4GH9A 2R4EA 3LVWA 4IBJA 3PXGA 5IT9S 1DGHA 2YFQA 1QAOA 3J7AS 4B7HA 3U6SA 1JR3A 5ITTA 5KO3A 4TUWA 1DGFA 2I7PA 3RE8A 2L09A 1DGHB 1YUBA 4LJ5A 3GRYA 1Z5CA 2X49A 4JI4M 2HHHM 4LFAM 5E26A 2Y20A 5EP4A 3U60A 4MH0E 8CATA 3I4VA 4OX9M 1Q3CA 4CGYB 5BPVA 2M60A 1TH2A 1IQPA 4FD2A 4IIWA 5C18A 3B9PA 3EIEA 4PDGA 1N77A 1TDZA 1HT2E 5EP3A 4HLQA 2F5NA 2HKJA 2BJWA 5KQDA 2RGOA 3T1YM 3VFDA 1L1ZA 2Z4RA 1HQCA 1JR3D 4L8RC 3JAMS 3K1JA 2KXEA 3HU2A 4JXJA 5BR8M 1PM5A 4LJ6A 3GRUA 2VQEM 2CHQA 3U6EA 3KSJA 5EJCA 3FYCA 3GLGB 2CE7A 1H6UA 2XEPA 4AZFA 4K0KM 1SXJE 2DWLA 4B08A 1IXRC 2AHMA 4JI8M 3FKEA 3GPUA 3FTEA 2H1RA 2L7HA 2ZAMA 4D81A 3U61B 3DA1A 1C1KA 4YY3M 5FTKA 4B7FA 4EIWA 2QCUA 3QWLA 1J7KA 4D80A 2XZFA 3U6OA 4LGYA 2DVWB 3K92A 3TPZA 4LF5M 1FNNA 3GLFA 2VQFM 3WHKA 2XSZD 4HL4A 3HHXA 3VDUA 2E5LM 2QZ4A 2UUCM 2CHGA 1N78A 4W5WA 3HHYA 3CF0A 3L2AA 3HWSA 4FWGA 4JI2M 1SXJA 1S3SA 1W5TA 1KSFX 3CTWB 4LG2A 2QPAA 4PD2A 5IWAM 2KW0A 2BJVA 4MGIE 4DR4M 2CEAA 3E4RA 3HKPA 1YSYA 5E6JA 5ITYA 3UGJA 2QBYB 1HNWM 4KO8A 5FLXS 3HU3A 1E9SA 3ZCBB 2UUAM 4BBAA 4JI5M 1Z59A 1L1TA 4LZJA 3WHLA 4QNRA 1GKIA 4JV5M 1NY6A 1OFHA 3A98B 3FD9A 3GLHA 3GPPA 4S12A 2DZOB 5H37D 3PNYA 4JYAM 2Y0QA 3A46A 4Z8XA 2L7IA 2OQ4A 2ZANA 4D82A 3HGIA 1TGUA 2F5PA 2KRUA 2Z7JA 4P16A 5FTMA 4QNMA 1SXJC 4DV6M 4DR7M 2ZM6M 4G4RA 3GLGA 1QQWA 2J7NA 4LF7M 2RGHA 1MX0A 2FOIC 1Q39A 4LZZA 1IN6A 2KEBA 3RFWA 5KPTA 1PJJA 4AKGA 2V1UA 4X64M 3RGSA 4IBGA 2W82A 2YNMD 1HR0M 1E94E 1N32M 3GRRA 1KYIA 3GRVA 2LWXA 4FCTA 1EE8A 1IN4A 3GQ5A 1IN8A 3FUUA 3TL4X 4AG6A 1DO0A 1TDHA 1R6BX 4MGZE 4IJFA 2DWMA 1QAMA 2I7NA 4OVZB 2DWNA 2HL7A 2C96A 4GKKM 4DR5M 2R4JA 3CF6E 4LCBA 3KP1E 3LMMA 3M6AA 3FYDA 3FTFA 3L25A 4KODA 2XH9A 3HJQA 1G8PA 3VK8A 2FNAA 1XXHA 5LMUM 4NXMM 3BOSA 1UM8A 3RGPA 5A2QS 4M9ZA 2UXCM 4NSOB 1L8QA 1NHGC 3VKHA 1HT1E 3KS8A 5FSWA 4AI6A 1TH4A 4KLNA 2KRKA 3FTDA 2XLJA 4GRIA 4Z6YA 2EA0A 3HHZA 4AKHA 5DYGA 1IBKM 4RF1A 1T3TA 5EP2A 1ORYB 1Z5AA 4LJ7A 3L27A 1D2NA 5EQTA 3SATA 3GP1A 3M0EA 4JI3M 1IY2A 3UJNA 4AQYM 3U6LA 4I4LA 4I81A 4IBEA 5EP1A 1OJLA 1J5EM 5FTNA 1XXHB 1X37A 1DO2A 3H4MA 3AOGA 4FVMA 4II7A 1I94M 3U60B 4LJ8A 1TH3A 3SASA 2V6ZM 2JA2A 4GITA 3AL0C 3MJ5A 2QP9X 3MK6A 3W0LB 2YR0A 4L16A 1IY0A 4REZA 3LVVA 3SYLA 2F5QA 2V1CA 3CF2A 4GC5A 3R9XB 4YHHM 3W0FA 2CV0A 3KSXA 1NVMA 3C58A 1KFVA 2ZBKB 4DV1M 5IREB 3TWLA 4MM3B 3UMMA 2FFJA 3GLHB 4JI6M 2XGNA 3KXEC 1IN7A 1QVRA 1GL6A 3KDSE 4DR2M 2CV2A 2UU9M 1QAQA 1NY5A 1N36M 4NSRA 1QYRA 3E9SA 2HCBA 4B3TM 1G4AE 4QHSA 4NOOB 4MGHA 1XNRM 4GKJM 2UXDM 3DZDA 4NRWA 4CHTB 4GMQA 4IBCA 3LQRA 3GQ4A 1R2YA 3MHVC 1N33M 5FTJA 2CUZA 1HNXM 4JN6A 4OVZA 5DYIA 3AFHA 3M7GA 4GC9A 4KHPM 4LGMA 2C98A 3GPYA 3SC3A 3AOEA 1DGGA 2DXIA 1NNUC 1XWIA 2X8AA 1IBMM 3SMSA 1SXJB 4WW0A 3JR4A 3U6MA 2ZAOA 5EXPA 2G8LA 1IY1A 2UXBM 1GVNA 3ZC7B 2J7OA 2QBYA 3UZUA 3I4YA 4RNAA 3VLFB 1L2DA 4LY6A 4MGYE 5DNYA 4FCWA 4B3SM 2EO2A 3GQ3A 3K8ZA 1XC8A 4G6ZA 4FWDA 3KP0E 3PNVA 1OFIA 2G5GX 2LNHC 3GPXA 1DGBA 3TQSA 4LF8M 4LFBM 4XGIA 4DR3M 3KOXE 1IM2A 1L2CA 4L78A 2DWZB 4X66M 1FJGM 4R7GA 3FUWA 2BNKA 4GHAA 4LF4M 2YQZA 2F5OA 4LJAA 3FUXA 3SMPA 1IXZA 2M5ZA 3NBIA 2C5RA 4LRSA 2Z3XA 3U5ZB 3FUVA 4M0DA 4DV7M 2C9OA 5ITRA 3J81S 1R2ZA 5GKNA 3GLIA 2R62A 4PDIA 1GL7A 3TWKA 4LRTA 1HQYE 3L29A 4FW9A 4DV3M 4G4QA 1NNJA 3DOAA 3IG5A 1K3WA 1QANA 5EXXA 3AV0A 2K47A 1PJIA 4L4UA 1K82A 4JI0M 4GHLA 3THGA 4R3DA 3U6CA 2Z4SA 2O5RA 2XF3A 5EXTA 4B3MM 3AKZA 2UUBM 3IG8A 3LQQA 4MB7A 3ZH9B 5EXSA 4RF0A 1E9RA 3JR5A 3GLIB 1G59A 1N34M 4IBIA 3J27B 5C1BA 4AKIA 2A5YB 2C99A 3K2LA 3SBJA 5IZ7D 4M9XA 1ZQ9A 1ZAEA 2R45A 3VKGA 1XNQM 4X62M 3TWMA 4NL4H 2VIIA 4L15A 4AW4A 1J09A 4DR1M 3FTCA 2CV1A 2Y0TA 4FCVA 4PCZA 3A45A 4JI7M 2Y21A 4OW0A 3DFZA 3TE6A 1I4WA 3KVWA 4A3VB 4NXNM 2OPFA 3AJIB 3SYKA 2R18A 3KOYE 5F3WA 1W5SA 4DV0M 3U6QA 3KW6A 2KZUA 4M9SA 3U6DA 2ERCA 2F4VM 4G4NA 4IBKA 3QAUA 1IXSB 3SAWA 4WURA 1NJGA 4DUYM 2CFOA 2CHVA 5ITUA 3T38A 4NRVA 3UK6A 4ITQA 2P5TA 1IN5A 3HJ8A 4B3RM 3U5ZA 3D8LA 4AG5A 5FTLA 4IBBA 3KOWE 3U61A 1G3IA 4CISA 4DR6M 2XZUA 1L2BA 1JQJC 3PVSA 2Q2EB 3T15A 4B7GA 4X65M 4BLCA 3GLFB 4LF6M 2L6OA 3I51A 4LF9M 1WXQA 4MGKE 3GO8A 3PFIA 5JI3E 4DV2M 5KPRA 3Q8XA 2D7HA 2R46A 1NHWC 4LJ4A 3NWLA 7CATA 1XMOM 1QZMA 2X4AA 5KPZA 4JI1M 2LXEA 4G4OA 4QHTA 2DZNB 3KOZE 3L26A 1HNZM 3SHGB 3AOEC 1Q3BA 3HHWA 4GIPA 1XMQM 2XSZA 1K3XA 4IBDA 4IJEA 1Z5BA 2XFSA 3KS4A 2RKOA 5KQ8A 1SXJD 3OTOM 1NJFA 3L28A 3HJSA 4M0WA 3ILKA 2C9CA 4ZPXA 3HU1A 2QENA 3SAUA 3J2PB 3SHFA 4FWHA 1LV7A 3A42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH C; 
#chains in the Genus database with same CATH topology
 4XBO A;  3T1H M;  4DUZ M;  2DAM A;  3CGW A;  2OOB A;  3GLH E;  2KZS A;  4CJ6 A;  3VDP A;  1NSF A;  4DV4 M;  3KFU G;  4IBF A;  4LFC M;  3D8B A;  3J7B A;  1R5L A;  3B7Q A;  4LJ9 A;  2RRU A;  3J80 S;  4BB9 A;  3VK7 A;  2KA6 B;  2D7G A;  3SFZ A;  5JI2 E;  2CRU A;  1Z6T A;  1QUT A;  2DI0 A;  4RKU F;  1WJ7 A;  1GLN A;  1G41 A;  2D7E A;  2FE8 A;  1E32 A;  2XFT A;  3FRH A;  4I5S A;  1VEK A;  3U6P A;  1VDD A;  2J5Y A;  2KNZ A;  4QOZ C;  2EUC A;  3EIH A;  2R65 A;  4I8O A;  5ITX A;  2JZ0 A;  1XHB A;  3R8F A;  1R7R A;  2BWE A;  4QOS A;  4PT5 A;  4OU7 A;  3SAV A;  1R4G A;  5ITQ A;  1DV0 A;  3I01 M;  2LH0 A;  1QZE A;  3FUT A;  1N75 A;  1MU5 A;  5LMN M;  5ITX E;  1OIZ A;  2NQ8 C;  2DHR A;  1IBL M;  2F5S A;  3SAR A;  1YE9 A;  4DV5 M;  4F2L A;  4KT0 F;  1XB2 B;  4GH9 A;  2R4E A;  3LVW A;  2KDL A;  4IBJ A;  2JZ1 A;  3PXG A;  5IT9 S;  1DGH A;  2YFQ A;  1QAO A;  2L4E A;  4GEW A;  3J7A S;  2LVP C;  4B7H A;  3U6S A;  1JR3 A;  5ITT A;  5KO3 A;  4TUW A;  3FRI A;  1DGF A;  2I7P A;  2JY6 B;  2ZTC A;  3RE8 A;  2JXN A;  2L09 A;  1DGH B;  1YUB A;  2LTU A;  4LJ5 A;  1JB0 F;  3GRY A;  1Z5C A;  2X49 A;  4JI4 M;  3QYE A;  2MR9 A;  2HHH M;  4LFA M;  5E26 A;  2Y20 A;  5EP4 A;  3U60 A;  4JI2 M;  4MH0 E;  8CAT A;  3I4V A;  2MJ5 B;  3IHP A;  4OX9 M;  1Q3C A;  4CGY B;  5BPV A;  2JY7 A;  2M60 A;  1TH2 A;  1IQP A;  4FD2 A;  4IIW A;  5C18 A;  3B9P A;  2KNA A;  4ANR A;  3EIE A;  4PDG A;  1N77 A;  1QDT A;  2LVQ D;  1TDZ A;  1HT2 E;  1TR8 A;  5EP3 A;  4HLQ A;  2F5N A;  3B7N A;  2HKJ A;  2BJW A;  5KQD A;  1F4I A;  2RGO A;  3T1Y M;  3VFD A;  1L1Z A;  2Z4R A;  1HQC A;  2QHO B;  1ZMV A;  1JR3 D;  1PJS A;  4L8R C;  3JAM S;  2VDB B;  3K1J A;  1T6O A;  2KXE A;  3HU2 A;  4JXJ A;  5BR8 M;  1PM5 A;  4LJ6 A;  3GRU A;  2VQE M;  2CHQ A;  3U6E A;  2KNV A;  3KSJ A;  5EJC A;  2K9D A;  3FYC A;  2CE7 A;  3GLG B;  1H6U A;  2XEP A;  4AZF A;  4K0K M;  1SXJ E;  2DWL A;  4B08 A;  1IXR C;  2B3T A;  2AHM A;  4JI8 M;  3FKE A;  3GPU A;  2N35 A;  3T6P A;  3FTE A;  2H1R A;  2L7H A;  2ZAM A;  4D81 A;  1GJS A;  3U61 B;  3DA1 A;  1C1K A;  4YY3 M;  5FTK A;  4B7F A;  4EIW A;  2QCU A;  3QWL A;  1EFU B;  1D0K A;  1PRB A;  1J7K A;  2ZTD A;  4D80 A;  1AIP C;  3U6O A;  2XZF A;  4LGY A;  2DVW B;  3K92 A;  3TPZ A;  4LF5 M;  1FNN A;  3GLF A;  2VQF M;  3WHK A;  3BXW A;  2XSZ D;  4HL4 A;  1OQY A;  3HHX A;  1OAO C;  3VDU A;  2E5L M;  2QZ4 A;  2UUC M;  2CHG A;  2DEN A;  1N78 A;  4W5W A;  1V33 A;  3HHY A;  3CF0 A;  3L2A A;  3HWS A;  3HZJ A;  2JY5 A;  1SXJ A;  1S3S A;  2LHC A;  4FWG A;  3GLI E;  2MRO B;  1W5T A;  1KSF X;  3CTW B;  4LG2 A;  2APL A;  2QPA A;  4HEO A;  4PD2 A;  5IWA M;  2KW0 A;  2BJV A;  4MGI E;  4DR4 M;  2CEA A;  3E4R A;  3HKP A;  1YSY A;  5E6J A;  5ITY A;  3UGJ A;  2QBY B;  1HNW M;  2L2D A;  4KO8 A;  5FLX S;  3HU3 A;  1YLA A;  1E9S A;  1G71 A;  3ZCB B;  2UUA M;  4BBA A;  1GAB A;  4JI5 M;  1Z59 A;  1L1T A;  1P3Q Q;  2CWB A;  4LZJ A;  3WHL A;  4QNR A;  3IEC A;  3B7Z A;  1GKI A;  4JV5 M;  1NY6 A;  1OFH A;  1QUS A;  3A98 B;  1ZMU A;  3FD9 A;  3GLH A;  3GPP A;  4S12 A;  2FS1 A;  2DZO B;  1NV9 A;  5H37 D;  3PNY A;  4JYA M;  2Y0Q A;  3A46 A;  4Z8X A;  2L7I A;  2OQ4 A;  2ZAN A;  3W67 A;  3HGI A;  1TGU A;  4D82 A;  2KRU A;  2Z7J A;  4P16 A;  5FTM A;  2F5P A;  4QNM A;  1LTM A;  1SXJ C;  2QNJ A;  4DV6 M;  4DR7 M;  2ZM6 M;  2Z8Y M;  3GLG A;  1QQW A;  2J7N A;  4G4R A;  4LF7 M;  1D0L A;  2RGH A;  1MX0 A;  2FOI C;  1Q39 A;  2G3Q A;  1IN6 A;  2KEB A;  4LZZ A;  4XK8 F;  3RFW A;  5KPT A;  1PJJ A;  4AKG A;  2V1U A;  4X64 M;  1QDR A;  3RGS A;  4IBG A;  2W82 A;  2YNM D;  1HR0 M;  3HX3 A;  1E94 E;  1N32 M;  1T43 A;  3GRR A;  1WGN A;  1KYI A;  3GRV A;  1NO1 A;  4Q7J A;  2LWX A;  4FCT A;  1EE8 A;  1IN4 A;  4NC6 A;  3GQ5 A;  1WHC A;  1IN8 A;  3FUU A;  3TL4 X;  4AG6 A;  1DO0 A;  1TDH A;  1R6B X;  4MGZ E;  4DBG B;  4IJF A;  2DWM A;  1QAM A;  2EKF A;  1PGY A;  2I7N A;  2GQF A;  4OVZ B;  2DWN A;  1GO5 A;  2HL7 A;  2C96 A;  4GKK M;  4G3O A;  4UN2 B;  2R4J A;  3CF6 E;  3QYB A;  2HAK A;  4LCB A;  4DR5 M;  3KP1 E;  3LMM A;  3M6A A;  3FYD A;  1A5T A;  3FTF A;  3L25 A;  4KOD A;  2XH9 A;  3HJQ A;  1OIP A;  1G8P A;  3VK8 A;  2FNA A;  1XXH A;  5LMU M;  4NXM M;  3BOS A;  1UM8 A;  4R71 A;  3RGP A;  5A2Q S;  4M9Z A;  2UXC M;  4NSO B;  3GLF E;  2EJS A;  1L8Q A;  1NHG C;  3VKH A;  1HT1 E;  3KS8 A;  5FSW A;  4AI6 A;  1TH4 A;  2CP8 A;  4KLN A;  2KRK A;  2HWJ A;  3FTD A;  4GRI A;  4Z6Y A;  2XLJ A;  2EA0 A;  3HHZ A;  4AKH A;  3FE3 A;  5DYG A;  1IBK M;  4RF1 A;  1T3T A;  2R0I A;  3B89 A;  5EP2 A;  1ORY B;  1Z5A A;  4LJ7 A;  1AUA A;  1WIV A;  3I04 M;  3L27 A;  1D2N A;  5EQT A;  3SAT A;  2LVO C;  2O01 F;  3GP1 A;  1ZV1 A;  3M0E A;  5DFL A;  1IY2 A;  4JI3 M;  3UJN A;  4AQY M;  3U6L A;  4I4L A;  1TF0 B;  4I81 A;  4IBE A;  2JP7 A;  5EP1 A;  1OJL A;  1J5E M;  5FTN A;  1XXH B;  2QSF X;  1X37 A;  4P17 A;  4CIZ A;  1DO2 A;  3H4M A;  2BWB A;  3AOG A;  4FVM A;  4II7 A;  1I94 M;  3U60 B;  2WSC F;  4LJ8 A;  1TH3 A;  3SAS A;  1V34 A;  2V6Z M;  2JA2 A;  4GIT A;  3AL0 C;  3MJ5 A;  2QP9 X;  3MK6 A;  3W0L B;  2YR0 A;  4L16 A;  1IY0 A;  4REZ A;  3LVV A;  3C3D A;  3SYL A;  2F5Q A;  2QQ8 A;  2V1C A;  3CF2 A;  4GC5 A;  3R9X B;  4YHH M;  3W0F A;  2CV0 A;  3KSX A;  2JUJ A;  1NVM A;  3C58 A;  1KFV A;  2WSF F;  2ZBK B;  4DV1 M;  1VG5 A;  5IRE B;  3TWL A;  4MM3 B;  3UMM A;  2FFJ A;  3GLH B;  4JI6 M;  2XGN A;  3KXE C;  1IN7 A;  1QVR A;  1GL6 A;  3KDS E;  2DAK A;  4DR2 M;  2CV2 A;  2UU9 M;  1QAQ A;  1NY5 A;  1N36 M;  4NSR A;  1QYR A;  3E9S A;  2HCB A;  4B3T M;  1G4A E;  4QHS A;  4NOO B;  4MGH A;  1XNR M;  5L8R F;  4GKJ M;  2R6F A;  3DZD A;  2UXD M;  4NRW A;  4CHT B;  4GMQ A;  4IBC A;  3LQR A;  3GQ4 A;  1R2Y A;  3MHV C;  1N33 M;  1WGL A;  3LCV B;  5FTJ A;  2CUZ A;  1HNX M;  4JN6 A;  4OVZ A;  5DYI A;  3LW5 F;  1MJG M;  3AFH A;  3M7G A;  4GC9 A;  4KHP M;  4LGM A;  2C98 A;  2MGW A;  3GPY A;  3SC3 A;  1EIJ A;  2JNH A;  3AOE A;  1DGG A;  2DXI A;  1NNU C;  1XWI A;  2X8A A;  1IBM M;  3SMS A;  1SXJ B;  4L6V 6;  4WW0 A;  3JR4 A;  1IXS A;  3MMP A;  1XXH E;  2K0B X;  4Y28 F;  3U6M A;  2ZAO A;  5EXP A;  2LVA A;  2G8L A;  1IY1 A;  2UXB M;  1GVN A;  3ZC7 B;  1VEJ A;  1D0M A;  2J7O A;  2QBY A;  3UZU A;  3I4Y A;  1WR1 B;  2WZJ A;  4RNA A;  3VLF B;  1VQ1 A;  1L2D A;  4LY6 A;  1RU3 A;  2GNO A;  4FCW A;  4MGY E;  5DNY A;  4B3S M;  2EO2 A;  2MH8 A;  3GQ3 A;  3K8Z A;  1XC8 A;  4G6Z A;  4FWD A;  3C3E A;  3KP0 E;  2DZL A;  1UFZ A;  3PNV A;  1OFI A;  2G5G X;  2LNH C;  3E21 A;  1DGB A;  3TQS A;  3GPX A;  4LF8 M;  4LFB M;  4XGI A;  4DR3 M;  1Q02 A;  1BVS A;  3KOX E;  1IM2 A;  1L2C A;  4L78 A;  2DWZ B;  3B74 A;  4X66 M;  1FJG M;  4R7G A;  2LVN C;  3FUW A;  2VF8 A;  2BNK A;  4GHA A;  4LF4 M;  2YQZ A;  2F5O A;  4LJA A;  3FUX A;  3SMP A;  1IXZ A;  2M5Z A;  3NBI A;  2C5R A;  4LRS A;  3GLG E;  2K6B A;  3ZQJ A;  2Z3X A;  3U5Z B;  3FUV A;  4M0D A;  4DV7 M;  2C9O A;  5ITR A;  2O25 A;  3J81 S;  1R2Z A;  5GKN A;  3GLI A;  1OTR A;  2R62 A;  4PDI A;  1GL7 A;  3TWK A;  4LRT A;  1HQY E;  3L29 A;  4FW9 A;  4DV3 M;  4G4Q A;  1NNJ A;  3DOA A;  3IG5 A;  1K3W A;  1OAI A;  1QAN A;  5EXX A;  3AV0 A;  2FH0 A;  2K47 A;  1PJI A;  2EKK A;  4L4U A;  1JR3 E;  1SG9 A;  4JI0 M;  1K82 A;  4GHL A;  3THG A;  1Y8G A;  4R3D A;  3U6C A;  2Z4S A;  2O5R A;  1TTE A;  2XF3 A;  5EXT A;  4B3M M;  3AKZ A;  2UUB M;  2DAG A;  1PJT A;  3IG8 A;  3LQQ A;  4MB7 A;  3ZH9 B;  5EXS A;  4RF0 A;  2DNA A;  1E9R A;  1CUK A;  3JR5 A;  3LCU A;  3GLI B;  1G59 A;  1N34 M;  4IBI A;  2H5X A;  3J27 B;  3K9P A;  5C1B A;  4AKI A;  2A5Y B;  2C99 A;  3K2L A;  3SBJ A;  5IZ7 D;  4M9X A;  1ZQ9 A;  1ZAE A;  2R45 A;  3VKG A;  3W68 A;  1XNQ M;  1HJP A;  2R44 A;  4X62 M;  1VDL A;  1C7Y A;  3TWM A;  4NL4 H;  2VII A;  4L15 A;  4AW4 A;  1J09 A;  4DR1 M;  3FTC A;  2CV1 A;  2Y0T A;  4FCV A;  2DAE A;  4PCZ A;  3A45 A;  2JY8 A;  2Y21 A;  4OW0 A;  3DFZ A;  3TE6 A;  4JI7 M;  1VEG A;  1I4W A;  3KVW A;  4A3V B;  4NXN M;  2OPF A;  1IFY A;  3AJI B;  3SYK A;  2R18 A;  3KOY E;  5F3W A;  1W5S A;  4DV0 M;  3U6Q A;  3KW6 A;  2KZU A;  4M9S A;  3U6D A;  2ERC A;  2F4V M;  4G4N A;  4IBK A;  2VF7 A;  3QAU A;  1IXS B;  3SAW A;  3C9P A;  3HY5 A;  4WUR A;  1NJG A;  4DUY M;  4F1I A;  2CFO A;  3BBZ A;  2CHV A;  2LBC A;  5ITU A;  3T38 A;  4NRV A;  3UK6 A;  2JWS A;  2P5T A;  4ITQ A;  1IN5 A;  3HJ8 A;  4B3R M;  3U5Z A;  3D8L A;  4AG5 A;  2DHY A;  4IBB A;  3KOW E;  5FTL A;  3U61 A;  1G3I A;  4CIS A;  4DR6 M;  2XZU A;  2OO9 A;  1L2B A;  1JQJ C;  2LHG A;  3PVS A;  2Q2E B;  3T15 A;  4B7G A;  4X65 M;  4BLC A;  3GLF B;  4LF6 M;  2L6O A;  3Q8G A;  3I51 A;  4LF9 M;  1WXQ A;  4MGK E;  3GO8 A;  3PFI A;  5JI3 E;  4WP2 A;  5KPR A;  4DV2 M;  2D7H A;  2R46 A;  3Q8X A;  1NHW C;  4LJ4 A;  3NWL A;  7CAT A;  1MN3 A;  1XMO M;  1QZM A;  2X4A A;  5KPZ A;  3H4J A;  2LXE A;  4G4O A;  4JI1 M;  4QHT A;  2DZN B;  1NV8 A;  3KOZ E;  3L26 A;  1PJQ A;  1HNZ M;  3SHG B;  3AOE C;  1Q3B A;  3HHW A;  4GIP A;  1XMQ M;  2XSZ A;  1K3X A;  2DKL A;  4IBD A;  1OKS A;  4IJE A;  1Z5B A;  2OOA A;  2XFS A;  3KS4 A;  2RKO A;  5KQ8 A;  2KHH A;  1SXJ D;  3E46 A;  3F92 A;  3OTO M;  2WSE F;  1NJF A;  3L28 A;  3HJS A;  4M0W A;  3ILK A;  2L4F A;  2C9C A;  1GJT A;  1ZMW A;  3K9O A;  3V76 A;  2DAI A;  3HU1 A;  1V92 A;  2QEN A;  4ZPX A;  3J2P B;  3SHF A;  3SAU A;  3NBX X;  4FWH A;  1LV7 A;  3A42 A; 
#chains in the Genus database with same CATH homology
 4XBO A;  3T1H M;  4DUZ M;  4DV4 M;  2KZS A;  3VDP A;  1NSF A;  3KFU G;  4IBF A;  4LFC M;  3D8B A;  3J7B A;  4LJ9 A;  3J80 S;  4BB9 A;  3VK7 A;  2KA6 B;  2D7G A;  3SFZ A;  5JI2 E;  1Z6T A;  1GLN A;  1G41 A;  2D7E A;  2FE8 A;  1E32 A;  2XFT A;  4I5S A;  3U6P A;  1VDD A;  4QOZ C;  2EUC A;  3EIH A;  2R65 A;  4I8O A;  5ITX A;  1XHB A;  3R8F A;  1R7R A;  4QOS A;  4PT5 A;  4OU7 A;  3SAV A;  5ITQ A;  2LH0 A;  3FUT A;  1N75 A;  1MU5 A;  5LMN M;  5ITX E;  2NQ8 C;  1IBL M;  2DHR A;  2F5S A;  3SAR A;  1YE9 A;  4DV5 M;  4GH9 A;  2R4E A;  3LVW A;  4IBJ A;  3PXG A;  5IT9 S;  1DGH A;  2YFQ A;  1QAO A;  3J7A S;  4B7H A;  3U6S A;  1JR3 A;  5ITT A;  5KO3 A;  4TUW A;  1DGF A;  2I7P A;  3RE8 A;  2L09 A;  1DGH B;  1YUB A;  4LJ5 A;  3GRY A;  1Z5C A;  2X49 A;  4JI4 M;  2HHH M;  4LFA M;  5E26 A;  2Y20 A;  5EP4 A;  3U60 A;  4MH0 E;  8CAT A;  3I4V A;  4OX9 M;  1Q3C A;  4CGY B;  5BPV A;  2M60 A;  1TH2 A;  1IQP A;  4FD2 A;  4IIW A;  5C18 A;  3B9P A;  3EIE A;  4PDG A;  1N77 A;  1TDZ A;  1HT2 E;  5EP3 A;  4HLQ A;  2F5N A;  2HKJ A;  2BJW A;  5KQD A;  2RGO A;  3T1Y M;  3VFD A;  1L1Z A;  2Z4R A;  1HQC A;  1JR3 D;  4L8R C;  3JAM S;  3K1J A;  2KXE A;  3HU2 A;  4JXJ A;  5BR8 M;  1PM5 A;  4LJ6 A;  3GRU A;  2VQE M;  2CHQ A;  3U6E A;  3KSJ A;  5EJC A;  3FYC A;  3GLG B;  2CE7 A;  1H6U A;  2XEP A;  4AZF A;  4K0K M;  1SXJ E;  2DWL A;  4B08 A;  1IXR C;  2AHM A;  4JI8 M;  3FKE A;  3GPU A;  3FTE A;  2H1R A;  2L7H A;  2ZAM A;  4D81 A;  3U61 B;  3DA1 A;  1C1K A;  4YY3 M;  5FTK A;  4B7F A;  4EIW A;  2QCU A;  3QWL A;  1J7K A;  4D80 A;  2XZF A;  3U6O A;  4LGY A;  2DVW B;  3K92 A;  3TPZ A;  4LF5 M;  1FNN A;  3GLF A;  2VQF M;  3WHK A;  2XSZ D;  4HL4 A;  3HHX A;  3VDU A;  2E5L M;  2QZ4 A;  2UUC M;  2CHG A;  1N78 A;  4W5W A;  3HHY A;  3CF0 A;  3L2A A;  3HWS A;  4FWG A;  4JI2 M;  1SXJ A;  1S3S A;  1W5T A;  1KSF X;  3CTW B;  4LG2 A;  2QPA A;  4PD2 A;  5IWA M;  2KW0 A;  2BJV A;  4MGI E;  4DR4 M;  2CEA A;  3E4R A;  3HKP A;  1YSY A;  5E6J A;  5ITY A;  3UGJ A;  2QBY B;  1HNW M;  4KO8 A;  5FLX S;  3HU3 A;  1E9S A;  3ZCB B;  2UUA M;  4BBA A;  4JI5 M;  1Z59 A;  1L1T A;  4LZJ A;  3WHL A;  4QNR A;  1GKI A;  4JV5 M;  1NY6 A;  1OFH A;  3A98 B;  3FD9 A;  3GLH A;  3GPP A;  4S12 A;  2DZO B;  5H37 D;  3PNY A;  4JYA M;  2Y0Q A;  3A46 A;  4Z8X A;  2L7I A;  2OQ4 A;  2ZAN A;  4D82 A;  3HGI A;  1TGU A;  2F5P A;  2KRU A;  2Z7J A;  4P16 A;  5FTM A;  4QNM A;  1SXJ C;  4DV6 M;  4DR7 M;  2ZM6 M;  4G4R A;  3GLG A;  1QQW A;  2J7N A;  4LF7 M;  2RGH A;  1MX0 A;  2FOI C;  1Q39 A;  4LZZ A;  1IN6 A;  2KEB A;  3RFW A;  5KPT A;  1PJJ A;  4AKG A;  2V1U A;  4X64 M;  3RGS A;  4IBG A;  2W82 A;  2YNM D;  1HR0 M;  1E94 E;  1N32 M;  3GRR A;  1KYI A;  3GRV A;  2LWX A;  4FCT A;  1EE8 A;  1IN4 A;  3GQ5 A;  1IN8 A;  3FUU A;  3TL4 X;  4AG6 A;  1DO0 A;  1TDH A;  1R6B X;  4MGZ E;  4IJF A;  2DWM A;  1QAM A;  2I7N A;  4OVZ B;  2DWN A;  2HL7 A;  2C96 A;  4GKK M;  4DR5 M;  2R4J A;  3CF6 E;  4LCB A;  3KP1 E;  3LMM A;  3M6A A;  3FYD A;  3FTF A;  3L25 A;  4KOD A;  2XH9 A;  3HJQ A;  1G8P A;  3VK8 A;  2FNA A;  1XXH A;  5LMU M;  4NXM M;  3BOS A;  1UM8 A;  3RGP A;  5A2Q S;  4M9Z A;  2UXC M;  4NSO B;  1L8Q A;  1NHG C;  3VKH A;  1HT1 E;  3KS8 A;  5FSW A;  4AI6 A;  1TH4 A;  4KLN A;  2KRK A;  3FTD A;  2XLJ A;  4GRI A;  4Z6Y A;  2EA0 A;  3HHZ A;  4AKH A;  5DYG A;  1IBK M;  4RF1 A;  1T3T A;  5EP2 A;  1ORY B;  1Z5A A;  4LJ7 A;  3L27 A;  1D2N A;  5EQT A;  3SAT A;  3GP1 A;  3M0E A;  4JI3 M;  1IY2 A;  3UJN A;  4AQY M;  3U6L A;  4I4L A;  4I81 A;  4IBE A;  5EP1 A;  1OJL A;  1J5E M;  5FTN A;  1XXH B;  1X37 A;  1DO2 A;  3H4M A;  3AOG A;  4FVM A;  4II7 A;  1I94 M;  3U60 B;  4LJ8 A;  1TH3 A;  3SAS A;  2V6Z M;  2JA2 A;  4GIT A;  3AL0 C;  3MJ5 A;  2QP9 X;  3MK6 A;  3W0L B;  2YR0 A;  4L16 A;  1IY0 A;  4REZ A;  3LVV A;  3SYL A;  2F5Q A;  2V1C A;  3CF2 A;  4GC5 A;  3R9X B;  4YHH M;  3W0F A;  2CV0 A;  3KSX A;  1NVM A;  3C58 A;  1KFV A;  2ZBK B;  4DV1 M;  5IRE B;  3TWL A;  4MM3 B;  3UMM A;  2FFJ A;  3GLH B;  4JI6 M;  2XGN A;  3KXE C;  1IN7 A;  1QVR A;  1GL6 A;  3KDS E;  4DR2 M;  2CV2 A;  2UU9 M;  1QAQ A;  1NY5 A;  1N36 M;  4NSR A;  1QYR A;  3E9S A;  2HCB A;  4B3T M;  1G4A E;  4QHS A;  4NOO B;  4MGH A;  1XNR M;  4GKJ M;  2UXD M;  3DZD A;  4NRW A;  4CHT B;  4GMQ A;  4IBC A;  3LQR A;  3GQ4 A;  1R2Y A;  3MHV C;  1N33 M;  5FTJ A;  2CUZ A;  1HNX M;  4JN6 A;  4OVZ A;  5DYI A;  3AFH A;  3M7G A;  4GC9 A;  4KHP M;  4LGM A;  2C98 A;  3GPY A;  3SC3 A;  3AOE A;  1DGG A;  2DXI A;  1NNU C;  1XWI A;  2X8A A;  1IBM M;  3SMS A;  1SXJ B;  4WW0 A;  3JR4 A;  3U6M A;  2ZAO A;  5EXP A;  2G8L A;  1IY1 A;  2UXB M;  1GVN A;  3ZC7 B;  2J7O A;  2QBY A;  3UZU A;  3I4Y A;  4RNA A;  3VLF B;  1L2D A;  4LY6 A;  4MGY E;  5DNY A;  4FCW A;  4B3S M;  2EO2 A;  3GQ3 A;  3K8Z A;  1XC8 A;  4G6Z A;  4FWD A;  3KP0 E;  3PNV A;  1OFI A;  2G5G X;  2LNH C;  3GPX A;  1DGB A;  3TQS A;  4LF8 M;  4LFB M;  4XGI A;  4DR3 M;  3KOX E;  1IM2 A;  1L2C A;  4L78 A;  2DWZ B;  4X66 M;  1FJG M;  4R7G A;  3FUW A;  2BNK A;  4GHA A;  4LF4 M;  2YQZ A;  2F5O A;  4LJA A;  3FUX A;  3SMP A;  1IXZ A;  2M5Z A;  3NBI A;  2C5R A;  4LRS A;  2Z3X A;  3U5Z B;  3FUV A;  4M0D A;  4DV7 M;  2C9O A;  5ITR A;  3J81 S;  1R2Z A;  5GKN A;  3GLI A;  2R62 A;  4PDI A;  1GL7 A;  3TWK A;  4LRT A;  1HQY E;  3L29 A;  4FW9 A;  4DV3 M;  4G4Q A;  1NNJ A;  3DOA A;  3IG5 A;  1K3W A;  1QAN A;  5EXX A;  3AV0 A;  2K47 A;  1PJI A;  4L4U A;  1K82 A;  4JI0 M;  4GHL A;  3THG A;  4R3D A;  3U6C A;  2Z4S A;  2O5R A;  2XF3 A;  5EXT A;  4B3M M;  3AKZ A;  2UUB M;  3IG8 A;  3LQQ A;  4MB7 A;  3ZH9 B;  5EXS A;  4RF0 A;  1E9R A;  3JR5 A;  3GLI B;  1G59 A;  1N34 M;  4IBI A;  3J27 B;  5C1B A;  4AKI A;  2A5Y B;  2C99 A;  3K2L A;  3SBJ A;  5IZ7 D;  4M9X A;  1ZQ9 A;  1ZAE A;  2R45 A;  3VKG A;  1XNQ M;  4X62 M;  3TWM A;  4NL4 H;  2VII A;  4L15 A;  4AW4 A;  1J09 A;  4DR1 M;  3FTC A;  2CV1 A;  2Y0T A;  4FCV A;  4PCZ A;  3A45 A;  4JI7 M;  2Y21 A;  4OW0 A;  3DFZ A;  3TE6 A;  1I4W A;  3KVW A;  4A3V B;  4NXN M;  2OPF A;  3AJI B;  3SYK A;  2R18 A;  3KOY E;  5F3W A;  1W5S A;  4DV0 M;  3U6Q A;  3KW6 A;  2KZU A;  4M9S A;  3U6D A;  2ERC A;  2F4V M;  4G4N A;  4IBK A;  3QAU A;  1IXS B;  3SAW A;  4WUR A;  1NJG A;  4DUY M;  2CFO A;  2CHV A;  5ITU A;  3T38 A;  4NRV A;  3UK6 A;  4ITQ A;  2P5T A;  1IN5 A;  3HJ8 A;  4B3R M;  3U5Z A;  3D8L A;  4AG5 A;  5FTL A;  4IBB A;  3KOW E;  3U61 A;  1G3I A;  4CIS A;  4DR6 M;  2XZU A;  1L2B A;  1JQJ C;  3PVS A;  2Q2E B;  3T15 A;  4B7G A;  4X65 M;  4BLC A;  3GLF B;  4LF6 M;  2L6O A;  3I51 A;  4LF9 M;  1WXQ A;  4MGK E;  3GO8 A;  3PFI A;  5JI3 E;  4DV2 M;  5KPR A;  3Q8X A;  2D7H A;  2R46 A;  1NHW C;  4LJ4 A;  3NWL A;  7CAT A;  1XMO M;  1QZM A;  2X4A A;  5KPZ A;  4JI1 M;  2LXE A;  4G4O A;  4QHT A;  2DZN B;  3KOZ E;  3L26 A;  1HNZ M;  3SHG B;  3AOE C;  1Q3B A;  3HHW A;  4GIP A;  1XMQ M;  2XSZ A;  1K3X A;  4IBD A;  4IJE A;  1Z5B A;  2XFS A;  3KS4 A;  2RKO A;  5KQ8 A;  1SXJ D;  3OTO M;  1NJF A;  3L28 A;  3HJS A;  4M0W A;  3ILK A;  2C9C A;  4ZPX A;  3HU1 A;  2QEN A;  3SAU A;  3J2P B;  3SHF A;  4FWH A;  1LV7 A;  3A42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...