2LO1A

Nmr structure of the protein bc008182, a dnaj-like domain from homo sapiens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily A member 1
publication title NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lo1A00
2YUAA 2GUZB 1FPOA 3UCSC 3UO2A 1IURA 1FAFA 2GUZA 2OCHA 3APOA 2CTPA 2CTWA 1N4CA 2KQXA 2N04A 3BVOA 3AG7A 1HDJA 2LO1A 4J80A 2YS8A 1XBLA 2L6LA 2CTRA 1NZ6A 2DMXA 2QWQB 3UO3A 4RWUA 4IT5A 2QWOB 1WJZA 2CUGA 2CTQA 4J7ZA 1BQZA 2EJ7A 3APQA 2PF4E 2DN9A 1GH6A 2QSAA 2QWPB 1BQ0A 2Y4UA 2Y4TA 2QWRB 2LGWA 2QWNB 2N05A 2M6YA
chains in the Genus database with same CATH superfamily
4LFBB 3CRAA 3E86A 3ZMVA 1E1RG 2JDIG 4DYLA 4JGSA 2FKXA 1H8EG 2XNDG 4N21A 1HNWB 2HR3A 5C8YB 4DR1O 4E4EA 2IH1C 2QJ1A 3C90A 1Q8IA 2ODMA 4DV6O 4JI2B 4Q20A 2IJIA 1D5AA 4DK1A 2OWOA 3T4DA 1M57B 4IYIA 4B3RB 4I5SA 5CA0A 2ZDIA 1QU7A 2K1EA 3RBZA 3UQ8A 2P5OA 4O4IB 3LDEA 2F66C 1QNMA 5FNVA 3BEHA 3VQYA 1KUQA 4LC1A 5EBMC 3TK1A 1Y6XA 4W4KA 3CS5A 4XDLA 1XMQO 4J80A 4JI8B 1MSDA 5B3SC 3JASA 2WLLA 4R8CA 1K4CC 1VF6A 3S3XA 4JF3A 2XAGA 4I4TB 3B77A 3CCQV 5AG2A 4LF6O 3OUFA 4QGPA 1YJWV 1YJNV 5KUMA 2Q6AA 5ITZA 2N04A 3L74H 3RGBA 2LGQA 3OGCC 3APQA 3GVMA 4CS4A 4EFBA 2GHYA 4X1KA 5IY5C 1RSOB 5LMUB 4DR6B 2KG7A 3UKMA 5DEDA 4O2AB 2OCCC 1XHXA 2JEUA 4NXMB 1AI6A 3HR0A 4JPRA 4RO2A 3UO3A 4UCSA 1VQMV 4X65O 2IH3C 1PV0A 4O4JA 5KA5A 4RUEA 3T1CA 4LF8B 3SDLA 4G2KA 3ZMTA 3M99B 4YXWG 4CBCA 1L8DA 2UU9B 3AK1A 5EC2C 1R3KC 4LF5B 4B08A 3ML0A 1WA8B 3HKBB 2NR5A 2JK5C 4ZI7A 3ETEA 3HKEB 2IBZH 3A0BZ 1OCRB 5CBGA 4Q6GA 4D6TH 4PI0A 4MVQA 2QM7A 4TOIA 4RAIA 3JAWB 4I9WA 2Q69A 3SJBC 3ABMB 2E76B 4NXNB 4X1IB 1VQ4V 3IAYA 1WP8A 4PA7A 1Y74B 4DR2B 3F5TA 2PGGA 3H1KH 2P4VA 2UUBO 4WF9V 5J2TA 4U3JA 1KB9F 4JZGA 2P67A 3IC7A 4AQYB 3BY6A 4B3MO 4RUFA 3ZRWB 3OTOB 2EZOA 3KKYA 5EYPB 4DV0B 4Z1VA 1P49A 1O9GA 4MVOA 2IU0A 2CE4A 3F7YC 4DV7O 4FLYA 2IW5A 2HHHO 3ABTA 4LFAB 2DOSA 1VQ5V 3K06A 4NKGB 1Y76A 1ZX3A 5KHKA 3ZBHA 2Q0AA 3P32A 2GSMB 1QLNA 3KG2A 2HEPA 1J95A 4TV9B 4ZOLA 4DV6B 1SRYA 4R7CA 4CH4A 3FD9A 1MNGA 1YSCA 3BRCA 1BHBA 1N34O 1GM9A 1Z5WA 1K4DC 3MHHC 1OZ0A 2VWKA 1GN4A 2HP8A 3TJTA 2VQEO 1OHHG 4P9PA 4H0LB 4I0XA 4GKKO 2FL4A 2VQFO 4RQEA 5A9GA 2FMLA 2UXXA 3ZHRA 5CBFA 4NYKA 4X8AA 3E8HA 1IBKB 2BTQB 5J2UB 1ENVA 3OM3B 5EC1C 1OCOB 2R70A 1NS1A 2GUZB 5EIBD 3JSNA 4CZZA 1XNRO 3CJHB 3B8MA 3SYPA 5JJEB 5HFLA 3N2GA 3PJSK 2YICA 2QWQB 4L87A 1GKFA 1NH2D 1AR5A 1BQZA 3K5NA 3BAAA 1H2MA 3SYOA 2ETNA 2ZM6B 4DUZO 1S5HC 1IXBA 5KLVH 4BW9A 4MSWC 1V54B 2LGWA 3AG1C 4DV1B 3JARA 3LDCA 2Q8VA 4CH3A 1AR1B 1M93A 1R73A 1EM1A 3CXHF 1GAXA 4JI3O 4AILC 1XDCA 1VQ9V 5H5NA 3T1YO 4UB6Z 1F4NA 1OJHA 2P4KA 3LNNA 2IJHA 4JI7B 3SJCC 4MVSA 5FNVB 1Q6IA 1KMIZ 1IDSA 1PL0A 5JJJB 3QF7A 4DXWA 4JYYA 2QM8A 5B1NA 2V7QG 4OX9B 4F6RA 1IX9A 2FB5A 5LGTA 2PY5A 2QTSA 3CCSV 2DYSC 4D7SA 2WLLB 3RYHB 3HKDB 3SJQC 3TGUH 4LCUC 3CRRA 4BIOA 3OT7A 2XAFA 5GTIZ 3A0HZ 2BSKA 5CB4A 2F95B 1OCZC 2UXBO 5IYZA 1M4UA 1YJ9V 2E74B 4DV4O 2PI4A 2QKCA 4UVCA 2IJJA 2MK3A 2WLMA 5A2QN 3T4ZA 2Y0PA 4DV3B 1GM8A 1J5EB 3CWBH 4WCEV 3CCUV 3SPJA 2OIEA 2KG7B 3RVZA 3K5OA 3DXRA 1YTFD 4B3MB 1AJNA 4MVMA 1F7YA 5LMNB 4P2ZA 1AI5A 4IIJA 3ZHTA 4GUNA 2OCHA 5LHGA 3G71V 2QKSA 3RYFA 1Q3EA 3JALA 4BIUA 1H38A 4GX5A 1KBHA 1H2KA 3AG3C 4O4JB 1V55B 4AI8A 3JD0A 1K92A 4YIPA 3CEIA 1KP3A 4Z2WA 4O2BA 4DV5B 3L75H 1PM9A 4NTXA 3W7UA 4ZI7B 2E5LB 4GZRB 5JWPA 4DR4B 1N36B 2H94A 5LA6B 4JAUA 4PELA 3SPHA 4B3SO 3SR2C 3M7MX 3ZRXA 1FD9A 2P7TC 3VBBA 5JQGA 1Q81W 4JI6B 1VQNV 2ADQB 4OPAA 3WG7C 1WN7A 4K8ZA 4NR1A 4CH6A 3ABKB 2X6BA 1AROP 2LO1A 4U3JB 1N0JA 5IYBO 1MA1A 4MTGA 4JV5O 1VARA 4LFCO 1WJZA 4XBFA 3A8TA 2H3OA 2V4DA 1M90W 1FKAO 1JR9A 1AB3A 1P7GA 3H01A 4MVRA 4GX0A 1K9MW 5IWAO 4FLWA 2BOCC 5TISZ 4TUYA 1S3JA 3ABLC 3CC4V 4ASUG 1D2DA 3ZRSA 1Y76B 4UCTA 1G4YB 3VQWA 1JMKC 3FAVA 4ZOLB 1I08A 4CC6A 3K3WA 3Q4HA 4FM0A 1FFXA 1SQGA 2HFEC 1IZ3A 1AP6A 1IXMA 5GTHZ 1K5SA 4BWAA 3CCEV 2YIAA 5B1OA 3K9AA 3DTUB 1SA0A 1NKDA 5KA6A 3T1YB 1AP5A 3P3PA 3OMIB 1WPXA 2Z3YA 3E22A 3OMAB 3K08A 4PA4A 1L0NH 1PNLA 5B1AC 5IYDO 1PD3A 4I0XB 1GMGA 5C93A 5CN0A 1O9HA 5EIBC 1AJQA 2KQXA 1FXKA 4K35A 4GT1A 2FYUH 1UFIA 3BA9A 4X88A 4JTDB 1ROPA 5KUKA 1NVPB 3WB0A 4X62B 4UCOA 1GH6A 4EB6A 4NVPA 4GKJB 2QWRB 2Q7HA 4LNUA 4TQFA 1IURA 3DSQA 3OEHG 5CA1A 3ZJZA 2YIBA 2P90A 2P22C 2R72A 1S0VA 3N2GB 2P6JA 3ASNB 4JYBA 2UUAB 1GO3F 2FTKA 3RYCA 1R1BA 2JS3A 5IE9A 2LFRA 4YJ3A 2YXLA 3JARB 1EZVH 5JVDA 3UCSC 1GN2A 2UXNA 4HNAB 3K9SA 1VF7A 2JRIA 4MS2A 3UT5B 1PNKA 5H6RA 4X66O 2WWWA 2WPDG 3WU2Z 2EILC 3ZIAG 1JJ2U 4PDMA 1XUQA 1WNSA 1FXVA 1THZA 2RN9A 3FYIB 1IBLO 4J42A 3TETA 1K34A 3QO8A 4TWKA 2QA4V 4CC5A 1YZBA 4F6RB 2BTOA 2ZKOA 2DW4A 1HDJA 4YY3B 2W6IG 2HVKC 3FFQA 1OCCC 1YXBA 5BR8O 1URFA 4NTYA 1JJOA 2BSKB 2CUGA 4DR5B 2VS0A 2LJ2A 3THOA 3STLC 3ZN0A 3UM7A 4UFZA 1N4CA 1TUEB 2YIDA 4JTAB 3DC5A 5K1XA 4FJCC 5H2FZ 3QO5A 4PD4F 2JVDA 3G80A 3DXRB 3FX7A 5H6QA 2PZSA 2GV9A 2WLIA 5BMVB 5IJ0A 1GN6A 2QSAA 1H2SB 5CMUA 4IIJB 3JD4A 1YI2V 1E79G 3SPCA 3KZIZ 1QLEB 2CTWA 1ZLZA 4P9OA 1IBMB 3RYFB 2O57A 4TSFG 2RJZA 1GTOA 1QR9A 5LXTA 4GX2A 5L3GA 2VRZA 3LUTB 3A2FA 1WP7A 3DC6A 4O2BB 2VWJA 1NTZH 2ZE8A 1I94B 4PHZA 3LSSA 1KYOF 2GDSA 1VF5B 2B1IA 3JAKA 2WLKA 2AW9A 4KFMA 3L71H 1N32B 1CXZB 4I50A 2ZXWB 3JSLA 1BE3H 2RNBA 1GK9A 4MTFA 1JQ0A 3FKSG 4WFGA 4QIWF 1H2GA 3FB6C 3QG5A 4MT8A 3O65A 5LHIA 1SESA 5L3DA 3ZEDA 2F4VB 2YS8A 1MSWD 1P4RA 1XBLA 1Y4MA 3DGEA 4JYCA 1BMFG 3FB5C 5L3CA 3IC9A 2C2AA 5LP6A 4LR3A 1FJGO 4UV9A 4U3FH 1ZUQA 2CAZC 1HP8A 1US6A 1M57C 2CK3G 2N05A 1AR4A 1M56B 2UUCO 2YUAA 1H2LA 1FAFA 4TUYB 4FLXA 3CRMA 4JI5O 4KUMA 3OGIB 4A5UB 3L9DA 4O4HA 1NQTA 1TA8A 4KHPO 1YVWA 1NBMG 1VIBA 3FAVB 4L8JA 4YHHB 3Q4HB 1NTKH 1FFXB 1YCIA 2EZPA 1N33B 3D36A 5KX5A 4X1YA 2HKOA 1P7BA 1YDXA 4CS2A 4JZ2A 3CP1A 1SA0B 1W0JG 2F93B 2OYQA 3JATA 1KU9A 4X66B 2MW2B 3D3IA 3E22B 3ZS8C 4PDLA 3ZHQA 1QCEA 2H8PC 4DR1B 3AEIA 2YDEA 5IJ9A 1IBLB 1VQ8V 2QWPB 1R3JC 2NNUA 5EBLC 3CRCA 2Q0OC 3T1HO 3JAMN 1U96A 1FXKB 4MTXA 3STZC 4UVAA 2Q73A 3E83A 1FYJA 1PL4A 2EINB 1GM7A 3TXQA 1BSMA 1LR1A 5BY1A 5BR8B 4LH7A 5FLXN 1P84F 2ZNJA 4BIZA 3ZMUA 4EB6B 5KHJA 4IYHA 4LNUB 5CBHA 4JYAO 5CA1B 3OUSA 1ZAUA 2JGDB 1Y67A 3CCLV 4DK0A 3EVKA 4DV2O 1QHTA 1OCZB 1JVMA 1UPGA 4JI4O 3RYIA 1XMQB 2G38A 1SZXA 1TUBA 1FXHA 4UB8Z 3RYCB 2YEVA 4LBEC 1G1XB 2GTSA 4LF4O 4X64O 3A0RA 4YJ3B 3CYOA 2X0LA 5JVDB 2D2CB 4LF6B 1OCRC 4J7JA 1HW7A 5H9CA 3CSXA 2Z0AA 4O4LA 4B7KA 4DR7O 3MD0A 4CS3A 3ABMC 4W4LA 4X20A 3ZMSA 4FIPC 1G6UA 1XILA 2CH7A 2WAMA 1ZSPA 2EIJB 5DM6V 3E35A 4DUYO 4BR6A 1SQXH 4HZ3A 3L73H 5CA0B 3K5LA 4JI0O 3K03A 3AG2B 3IGAC 5D5QA 2QE7G 4DRXA 2N74A 2P06A 1I7FA 4X65B 4TQDA 1AI7A 3K59A 3B40A 2ZNIA 3GB7C 3O9OA 4RQFA 3X2QB 2LFSA 2X6CA 1Q5OA 2Y69C 3G4SV 1W59A 4JI1O 3PN1A 3E8BA 3JASB 1B6QA 1KQSU 1BHAA 1FJGB 2ZE6A 2WLIB 5IJ0B 2CDYA 3C3TA 2XAJA 3ASOC 3K0DA 1R3IC 3JD3A 5GW7A 1D5NA 1I5XA 1EN5A 2Q7GA 1JFFA 3B4SA 3VQXA 2WA4A 5ITZB 3T2MA 1K7DA 4GCZA 1K73W 1SQBH 1PP9H 1QR8A 2IM9A 1Q7YW 2ZQMA 1RPOA 2UUBB 3MHSC 3OR7C 2Q7EA 5JCOC 5LXTB 3I56V 1FS0G 3QTCA 4IT5A 4YIOA 4KHPB 4X1KB 4B3TO 2WLNA 1YEWA 2XAQA 3CX5F 3IJ4A 4NB5A 1EBOA 3JAKB 1COWG 1VQLV 3OEEG 4I55A 4DV7B 1N0NA 1H8HG 4I50B 1LUVA 5IYCO 1OCOC 2HHHB 1EN6A 2HLDG 3JD2A 3OAAG 2QEXV 3ETQA 4FZ0A 4LFBO 1KKDA 3T1HB 1NVPD 3M8AA 3D8CA 1SETA 2AGAA 4FLVA 2L6LA 5LP6B 3JYCA 1HNWO 5KMGA 1V54C 1N34B 1NI8A 4BAYA 5FPRA 2JEXA 5DN6G 2IU3A 3SJAC 3D3QA 2M7WA 2VQEB 4AHCA 5L3BA 4JI2O 1VQKV 2W0XA 4DV2B 4GKKB 4B3RO 2VQFB 5B66Z 2EIMB 3U11A 5J2TB 4JI4B 2ZE5A 5E79Z 3RWRD 1EN4A 5LOVA 1W0KG 2IJKA 2V1DA 4WFHA 1Q43A 3CC2V 1NTMH 2ZD9A 1SQPH 4X1YB 5JH7A 4K3AA 3AG4C 3UO2A 3QNEA 2F1MA 1XNRB 2Q67A 4JI8O 4QE7A 1LUWA 4FM2A 2AZ0A 3SYCA 1ZL8A 3JAWA 1SZTA 2CTQA 5IJ9B 4HAMA 1BL8A 5LYJA 4FM1A 1U97A 4FFKA 2ZCEA 1Z2GA 4TV8A 4DUZB 4DUYB 5FPOA 2RDCA 1Y74A 1B04A 3VQVA 5F2VO 1NR1A 3N2KA 3APOA 1SS3A 5K1PA 3CPWU 2JIZG 4FLTA 1T5EA 1VQOV 2AHYA 2K9PA 1XEQA 2NLJC 3WB2A 4JI3B 2ITCC 3OMNB 1KKCA 5LMUO 1RP3B 3CMEV 2DQ3A 5LL6Y 2F43G 3CXCU 3BPZA 2BCCH 2ILMA 2Y0IA 3ZRWA 2M6YA 2LQTA 4KP4A 1V55C 3W7TA 3BVOA 1DLBA 1TUBB 3W7XA 1EZJA 3ZN1A 4FPPA 4JI1B 2YEVB 1S72V 1R6NA 1HWYA 1MZFA 3OTFA 3QVNA 4LF8O 2KKWA 4GX1A 5B3SB 1A32A 1XI1A 2UU9O 1Q6UA 4LF5O 4IGGA 2UXBB 3LNMB 4O4LB 2ZIOA 2GBOA 2HVJC 4GYCB 1S5LZ 4DV4B 2LW1A 3I55V 1Q90D 4DO2A 4WFAV 4X20B 1VQ7V 3K04A 2B9ZA 2LP7A 4U7NA 2KSDA 4WFBV 2CH7B 3OD4A 2DYRC 2EIKC 3MDSA 3K58A 3ABKC 1RM1C 5GONA 3N27A 5IY5B 3P30A 1TGOA 2OCCB 2ZT9B 4DRXB 1ORQC 1Q6HA 1QQCA 3LSUA 5BXZA 5LGNA 3VOUA 1B06A 1S77D 4AQYO 1LNQA 1VQPV 2BTQA 4OXSA 2QKAA 3EXAA 2WLHA 3OTOO 4TT3G 4DV0O 2GUZA 4UUJC 3EHBB 2YXYA 3CJHA 3FYEB 4J9ZB 4HYOA 3AK2A 1YITV 3CC7V 1S5JA 2A9HA 4I9QA 4LFAO 1VMGA 2PUSA 3QO7A 5L3EA 5B1BC 4N23A 3K57A 1SQFA 2NN4A 5CB4B 3ZHUA 3OFNG 1KECA 2ZINA 4B3SB 2YI9A 1JFFB 5IYZB 3JD1A 3CRQA 3U10A 3H1JH 1WLEA 1XNQO 1TVKA 2L35A 1K3EA 3SPIA 4XDJA 4JV5B 2WA3A 4NTWA 4LFCB 4ZIBA 2DWDC 4HBNA 1BS3A 4H13B 4QNHB 2AXTZ 4FVMA 3R65A 5IWAB 1F4MA 3W7WA 4I55B 1SQVH 3CCVV 1WAZA 3JALB 3RT3C 2QWOB 3RYHA 3HKDA 1IBKO 3OE7G 3MAQA 1JPXA 1AILA 1I0HA 5J9PC 1Y66A 2A06H 3ASNC 3H1LH 1MABG 5KHGA 2YC0A 1XL6A 5KMGB 3OW2U 4G28B 2CTRA 4WBNA 1Q86W 3L72H 3ETDA 2YIBD 2A0LA 4J7ZA 2DE0X 2ZM6O 4QPKA 4DV1O 4LF7O 1KD1W 5JQGB 2AHZA 1MMMA 2EX3A 4LWSA 3ZHVA 2PI5A 1K8AW 5LOVB 4LF9O 3BABA 2RCVA 4JI7O 2Q5ZA 5EZYA 4GLXA 5JH7B 3LDDA 3ABUA 1DK1A 2E75B 2JGUA 1BCCH 3LSQA 4WFFA 3ZX6A 4OX9O 2EBOA 4DW1A 1AVMA 4F4LA 3EFFK 4FFBA 2W0FC 4FLUA 1ZL8B 4ZHQA 1ZTEA 1SF9A 2OIGA 1K5QA 2JJ1G 1SERA 5KHHA 4ZBMA 3RVYA 5LYJB 3F7VC 4IHJA 1WPBA 5LA6A 4TV8B 3FB7C 3TXSA 2EJRA 3L70H 4UV8A 5LGUA 3GWOA 2HJDA 3K79A 2OT5A 3KCYA 3N2KB 4J41A 4PDRA 1BZKA 4JAAA 4R6ZA 5FL7G 4DV3O 3AG7A 3AG1B 1J5EO 4MW3A 1HNZO 1DTOA 3SYQA 1JOYA 1GN3A 2EJ7A 3JCUZ 2A79B 2BE3A 1QLEC 2DN9A 4YJ2A 2X6AA 1XREA 2PYLA 5LMNO 2EULA 3NXSA 2HJFC 1Q82W 4DR3O 1JA8A 1V9PA 1F23A 4R50A 1XOUA 4JAVA 5KAFZ 2HG5C 1R6KA 2R9AA 3CHXA 1K33A 2UXDO 3C3SA 2Y69B 4UCVA 5L3FA 4UXNA 5KHIA 1XMOO 2DYSB 1WB7A 2CGOA 4ZKIA 3SGIA 4IL6Z 4DV5O 1HR0O 2ADPA 4P30A 3ASOB 2E5LO 4UVBA 4FK5C 1KP2A 3J7AU 2ZXWC 1XNQB 4DR4O 1N36O 1CP9A 2XTAA 1BT8A 3CD6V 3KCXA 1B3QA 5EK0A 1WB8A 4PI2A 4FLZA 2PF4E 1EFRG 2R9RB 2OTLV 1I5YA 2Y4UA 5GONB 4BW5A 4JI6O 2B1GA 2XHBA 3CCMV 4JASA 2ATKC 4PA6A 1L1FA 5IDJA 1YF2A 3HKCA 1M56C 3G67A 3E8FA 2XOKG 4U7OA 2PYJA 1M5IA 2GTAA 3AG3B 1YHQV 2YI8A 1Z5VA 1JX9A 2W6JG 3JCZA 2ZIMA 3G6EV 4ABMA 5E1AC 4UCRA 4X89A 4FZ1A 1DF4A 1E1QG 4KL1A 3B09A 2Y48A 1OV9A 4K0KO 4LF7B 1PKXA 2OTJV 2UXCO 1NU1H 1X4TA 2Q68A 4MVZA 1TVKB 3ZCCA 2RQ6A 4HNAA 1XHZA 3UT5A 4LF9B 4RWUA 4MVUA 1X59A 2ZE7A 3WG7B 3CCRV 3I5DA 3K0GA 3ZMZA 5C8YA 1DF5A 1FXKC 3B8NA 5HFMA 1FFTB 3P3NA 4X9QA 1K97A 4MTOA 2EINC 3BHPA 1QBZA 1QVFU 2UUCB 2CTPA 4G27B 1S76D 4QJFB 4PV1B 4JI5B 3AG4B 1HNXO 2DMXA 3ETGA 1N8RW 4O4IA 4X62O 4H33A 1M1KW 1MZEA 4D7TA 3ABLB 3AK3A 4GKJO 1QVGU 4FMTA 3FB8C 3E8GA 4K8XA 2BOBC 5D5PA 1PNMA 4WBNB 1XQ8A 3W7SA 2UUAO 3H9VA 1G8MA 4PA3A 4F6EA 1HNZB 4J10A 4PA9A 2JS5A 4I4TA 3WB1A 5BMVA 4ICGA 2B5UA 1BQ0A 3CB2A 1VQ6V 4QPJA 1TAEA 4LWSB 4OGQB 3R66A 4DR3B 4LH6A 5CA3A 5B1AB 1JCHA 2UXDB 1NZ6A 4H37A 2EIJC 2DJVA 5EZYB 5JJNB 3F5WC 3H1IH 2ZR2A 1XMOB 2X7RB 1MOFA 2WLJA 4QE9A 1YIJV 3BFRA 2F23A 1RSOA 1NR7A 1RPRA 2ZDIC 3WFVA 2QWNB 4FFBB 4JYAB 3AG2C 4O2AA 1NH2B 1HR0B 2Q9LA 4ZHQB 4I7ZB 5IT9N 2RMKB 4YY3O 2A7WA 2DQ0A 4O4HB 4JTCB 3RFRA 4IHJB 3BA8A 3U0ZA 4E2LA 1R6TA 4DR5O 4LF4B 4X64B 3X2QC 1GRJA 5LBQA 2LW7A 4PJ0Z 2QM4A 5KX5B 1R3LC 2DYRB 2EIKB 4EEQA 1VF6C 4C7UA 4DR7B 1WA8A 1H2NA 2WSSG 3JATB 1F51A 3HKBA 1RM1B 3HKEA 2D3OW 1DGSA 1IVSA 4YJ2B 2AZ2A 3IFXA 4OPHA 1VP7A 4PDVA 1AJPA 5EBWC 4X1IA 2EILB 2R9IA 3RW0A 1RFYA 3BCCH 3SPGA 1IBMO 1CPYA 4J9YB 2QTOA 2QDOA 3J81N 1M9NA 5BZBA 4JI0B 1KC8W 2ITDC 4KXRA 4MW8A 2QR4A 4EFEA 3HB3B 4DR6O 3G6BA 4K0KB 1OCCB 2Y4TA 3E89A 5B1BB 2KB1A 3K5MA 3B2EE 1I94O 2UXCB 2XAHA 3CE2A 4NXMO 1UJWB 5EYPA 4Z1MG 3RYIB 1YTFB 5LHHA 1VEWA 3CMAV 3HPLC 1PPJH 4WFEA 3TCUA 2ARHA 4DW0A 1N32O 2A3QA 3J80N 2XUMA 1BGYH 1CEZA 2YXHA 3ZRVA 3CCJV 1MG1A 2XASA 5B5EZ 4TV9A 5LP6C 1FPOA 2F4VO 2Q4PA 1AI4A 2PTMA 4XDKA 3HKCB 3GWKC 4CH5A 2DWEC 1HNXB 3S3WA 4J11A 3ICXA 1NT2B 3ZHSA 4UCUA 4B3TB 4NXNO 4B7EA 5JCOA 2EIMC 1SQQH 3SYAA 2JJ2G 3OR6C 4DR2O 2JGDA 4J7KA 2YSUB 1NJIW 3E2EA 1SC5B 3RN4A 2XT9A 1SKVA 4EKWA 2CGNA 3D36C 1ZWIC 1L0LH 5KAIZ 2QGNA 4LP8A 2E3CA 4YHHO 3NR7A 1W2BU 5J2UA 1N33O 4H44B 1XL4A 3H1HH 2Z5UA 2ZR3A 5DECA
chains in the Genus database with same CATH topology
2YUAA 2GUZB 1FPOA 3UCSC 3UO2A 1IURA 1FAFA 2GUZA 2OCHA 3APOA 2CTPA 2CTWA 1N4CA 2KQXA 2N04A 3BVOA 3AG7A 1HDJA 2LO1A 4J80A 2YS8A 1XBLA 2L6LA 2CTRA 1NZ6A 2DMXA 2QWQB 3UO3A 4RWUA 4IT5A 2QWOB 1WJZA 2CUGA 2CTQA 4J7ZA 1BQZA 2EJ7A 3APQA 2PF4E 2DN9A 1GH6A 2QSAA 2QWPB 1BQ0A 2Y4UA 2Y4TA 2QWRB 2LGWA 2QWNB 2N05A 2M6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUA A;  2GUZ B;  1FPO A;  3UCS C;  3UO2 A;  1IUR A;  1FAF A;  2GUZ A;  2OCH A;  3APO A;  2CTP A;  2CTW A;  1N4C A;  2KQX A;  2N04 A;  3BVO A;  3AG7 A;  1HDJ A;  2LO1 A;  4J80 A;  2YS8 A;  1XBL A;  2L6L A;  2CTR A;  1NZ6 A;  2DMX A;  2QWQ B;  3UO3 A;  4RWU A;  4IT5 A;  2QWO B;  1WJZ A;  2CUG A;  2CTQ A;  4J7Z A;  1BQZ A;  2EJ7 A;  3APQ A;  2PF4 E;  2DN9 A;  1GH6 A;  2QSA A;  2QWP B;  1BQ0 A;  2Y4U A;  2Y4T A;  2QWR B;  2LGW A;  2QWN B;  2N05 A;  2M6Y A; 
#chains in the Genus database with same CATH topology
 4LFB B;  3CRA A;  3E86 A;  3ZMV A;  1E1R G;  2JDI G;  4DYL A;  4JGS A;  2FKX A;  1H8E G;  2XND G;  4N21 A;  1HNW B;  2HR3 A;  5C8Y B;  4DR1 O;  4E4E A;  2IH1 C;  2QJ1 A;  3C90 A;  1Q8I A;  2ODM A;  4DV6 O;  4JI2 B;  4Q20 A;  2IJI A;  1D5A A;  4DK1 A;  2OWO A;  3T4D A;  1M57 B;  4IYI A;  4B3R B;  4I5S A;  5CA0 A;  2ZDI A;  1QU7 A;  2K1E A;  3RBZ A;  3UQ8 A;  2P5O A;  4O4I B;  3LDE A;  2F66 C;  1QNM A;  5FNV A;  3BEH A;  3VQY A;  1KUQ A;  4LC1 A;  5EBM C;  3TK1 A;  1Y6X A;  4W4K A;  3CS5 A;  4XDL A;  1XMQ O;  4J80 A;  4JI8 B;  1MSD A;  5B3S C;  3JAS A;  2WLL A;  4R8C A;  1K4C C;  1VF6 A;  3S3X A;  4JF3 A;  2XAG A;  4I4T B;  3B77 A;  3CCQ V;  5AG2 A;  4LF6 O;  3OUF A;  4QGP A;  1YJW V;  1YJN V;  5KUM A;  2Q6A A;  5ITZ A;  2N04 A;  3L74 H;  3RGB A;  2LGQ A;  3OGC C;  3APQ A;  3GVM A;  4CS4 A;  4EFB A;  2GHY A;  4X1K A;  5IY5 C;  1RSO B;  5LMU B;  4DR6 B;  2KG7 A;  3UKM A;  5DED A;  4O2A B;  2OCC C;  1XHX A;  2JEU A;  4NXM B;  1AI6 A;  3HR0 A;  4JPR A;  4RO2 A;  3UO3 A;  4UCS A;  1VQM V;  4X65 O;  2IH3 C;  1PV0 A;  4O4J A;  5KA5 A;  4RUE A;  3T1C A;  4LF8 B;  3SDL A;  4G2K A;  3ZMT A;  3M99 B;  4YXW G;  4CBC A;  1L8D A;  2UU9 B;  3AK1 A;  5EC2 C;  1R3K C;  4LF5 B;  4B08 A;  3ML0 A;  1WA8 B;  3HKB B;  2NR5 A;  2JK5 C;  4ZI7 A;  3ETE A;  3HKE B;  2IBZ H;  3A0B Z;  1OCR B;  5CBG A;  4Q6G A;  4D6T H;  4PI0 A;  4MVQ A;  2QM7 A;  4TOI A;  4RAI A;  3JAW B;  4I9W A;  2Q69 A;  3SJB C;  3ABM B;  2E76 B;  4NXN B;  4X1I B;  1VQ4 V;  3IAY A;  1WP8 A;  4PA7 A;  1Y74 B;  4DR2 B;  3F5T A;  2PGG A;  3H1K H;  2P4V A;  2UUB O;  4WF9 V;  5J2T A;  4U3J A;  1KB9 F;  4JZG A;  2P67 A;  3IC7 A;  4AQY B;  3BY6 A;  4B3M O;  4RUF A;  3ZRW B;  3OTO B;  2EZO A;  3KKY A;  5EYP B;  4DV0 B;  4Z1V A;  1P49 A;  1O9G A;  4MVO A;  2IU0 A;  2CE4 A;  3F7Y C;  4DV7 O;  4FLY A;  2IW5 A;  2HHH O;  3ABT A;  4LFA B;  2DOS A;  1VQ5 V;  3K06 A;  4NKG B;  1Y76 A;  1ZX3 A;  5KHK A;  3ZBH A;  2Q0A A;  3P32 A;  2GSM B;  1QLN A;  3KG2 A;  2HEP A;  1J95 A;  4TV9 B;  4ZOL A;  4DV6 B;  1SRY A;  4R7C A;  4CH4 A;  3FD9 A;  1MNG A;  1YSC A;  3BRC A;  1BHB A;  1N34 O;  1GM9 A;  1Z5W A;  1K4D C;  3MHH C;  1OZ0 A;  2VWK A;  1GN4 A;  2HP8 A;  3TJT A;  2VQE O;  1OHH G;  4P9P A;  4H0L B;  4I0X A;  4GKK O;  2FL4 A;  2VQF O;  4RQE A;  5A9G A;  2FML A;  2UXX A;  3ZHR A;  5CBF A;  4NYK A;  4X8A A;  3E8H A;  1IBK B;  2BTQ B;  5J2U B;  1ENV A;  3OM3 B;  5EC1 C;  1OCO B;  2R70 A;  1NS1 A;  2GUZ B;  5EIB D;  3JSN A;  4CZZ A;  1XNR O;  3CJH B;  3B8M A;  3SYP A;  5JJE B;  5HFL A;  3N2G A;  3PJS K;  2YIC A;  2QWQ B;  4L87 A;  1GKF A;  1NH2 D;  1AR5 A;  1BQZ A;  3K5N A;  3BAA A;  1H2M A;  3SYO A;  2ETN A;  2ZM6 B;  4DUZ O;  1S5H C;  1IXB A;  5KLV H;  4BW9 A;  4MSW C;  1V54 B;  2LGW A;  3AG1 C;  4DV1 B;  3JAR A;  3LDC A;  2Q8V A;  4CH3 A;  1AR1 B;  1M93 A;  1R73 A;  1EM1 A;  3CXH F;  1GAX A;  4JI3 O;  4AIL C;  1XDC A;  1VQ9 V;  5H5N A;  3T1Y O;  4UB6 Z;  1F4N A;  1OJH A;  2P4K A;  3LNN A;  2IJH A;  4JI7 B;  3SJC C;  4MVS A;  5FNV B;  1Q6I A;  1KMI Z;  1IDS A;  1PL0 A;  5JJJ B;  3QF7 A;  4DXW A;  4JYY A;  2QM8 A;  5B1N A;  2V7Q G;  4OX9 B;  4F6R A;  1IX9 A;  2FB5 A;  5LGT A;  2PY5 A;  2QTS A;  3CCS V;  2DYS C;  4D7S A;  2WLL B;  3RYH B;  3HKD B;  3SJQ C;  3TGU H;  4LCU C;  3CRR A;  4BIO A;  3OT7 A;  2XAF A;  5GTI Z;  3A0H Z;  2BSK A;  5CB4 A;  2F95 B;  1OCZ C;  2UXB O;  5IYZ A;  1M4U A;  1YJ9 V;  2E74 B;  4DV4 O;  2PI4 A;  2QKC A;  4UVC A;  2IJJ A;  2MK3 A;  2WLM A;  5A2Q N;  3T4Z A;  2Y0P A;  4DV3 B;  1GM8 A;  1J5E B;  3CWB H;  4WCE V;  3CCU V;  3SPJ A;  2OIE A;  2KG7 B;  3RVZ A;  3K5O A;  3DXR A;  1YTF D;  4B3M B;  1AJN A;  4MVM A;  1F7Y A;  5LMN B;  4P2Z A;  1AI5 A;  4IIJ A;  3ZHT A;  4GUN A;  2OCH A;  5LHG A;  3G71 V;  2QKS A;  3RYF A;  1Q3E A;  3JAL A;  4BIU A;  1H38 A;  4GX5 A;  1KBH A;  1H2K A;  3AG3 C;  4O4J B;  1V55 B;  4AI8 A;  3JD0 A;  1K92 A;  4YIP A;  3CEI A;  1KP3 A;  4Z2W A;  4O2B A;  4DV5 B;  3L75 H;  1PM9 A;  4NTX A;  3W7U A;  4ZI7 B;  2E5L B;  4GZR B;  5JWP A;  4DR4 B;  1N36 B;  2H94 A;  5LA6 B;  4JAU A;  4PEL A;  3SPH A;  4B3S O;  3SR2 C;  3M7M X;  3ZRX A;  1FD9 A;  2P7T C;  3VBB A;  5JQG A;  1Q81 W;  4JI6 B;  1VQN V;  2ADQ B;  4OPA A;  3WG7 C;  1WN7 A;  4K8Z A;  4NR1 A;  4CH6 A;  3ABK B;  2X6B A;  1ARO P;  2LO1 A;  4U3J B;  1N0J A;  5IYB O;  1MA1 A;  4MTG A;  4JV5 O;  1VAR A;  4LFC O;  1WJZ A;  4XBF A;  3A8T A;  2H3O A;  2V4D A;  1M90 W;  1FKA O;  1JR9 A;  1AB3 A;  1P7G A;  3H01 A;  4MVR A;  4GX0 A;  1K9M W;  5IWA O;  4FLW A;  2BOC C;  5TIS Z;  4TUY A;  1S3J A;  3ABL C;  3CC4 V;  4ASU G;  1D2D A;  3ZRS A;  1Y76 B;  4UCT A;  1G4Y B;  3VQW A;  1JMK C;  3FAV A;  4ZOL B;  1I08 A;  4CC6 A;  3K3W A;  3Q4H A;  4FM0 A;  1FFX A;  1SQG A;  2HFE C;  1IZ3 A;  1AP6 A;  1IXM A;  5GTH Z;  1K5S A;  4BWA A;  3CCE V;  2YIA A;  5B1O A;  3K9A A;  3DTU B;  1SA0 A;  1NKD A;  5KA6 A;  3T1Y B;  1AP5 A;  3P3P A;  3OMI B;  1WPX A;  2Z3Y A;  3E22 A;  3OMA B;  3K08 A;  4PA4 A;  1L0N H;  1PNL A;  5B1A C;  5IYD O;  1PD3 A;  4I0X B;  1GMG A;  5C93 A;  5CN0 A;  1O9H A;  5EIB C;  1AJQ A;  2KQX A;  1FXK A;  4K35 A;  4GT1 A;  2FYU H;  1UFI A;  3BA9 A;  4X88 A;  4JTD B;  1ROP A;  5KUK A;  1NVP B;  3WB0 A;  4X62 B;  4UCO A;  1GH6 A;  4EB6 A;  4NVP A;  4GKJ B;  2QWR B;  2Q7H A;  4LNU A;  4TQF A;  1IUR A;  3DSQ A;  3OEH G;  5CA1 A;  3ZJZ A;  2YIB A;  2P90 A;  2P22 C;  2R72 A;  1S0V A;  3N2G B;  2P6J A;  3ASN B;  4JYB A;  2UUA B;  1GO3 F;  2FTK A;  3RYC A;  1R1B A;  2JS3 A;  5IE9 A;  2LFR A;  4YJ3 A;  2YXL A;  3JAR B;  1EZV H;  5JVD A;  3UCS C;  1GN2 A;  2UXN A;  4HNA B;  3K9S A;  1VF7 A;  2JRI A;  4MS2 A;  3UT5 B;  1PNK A;  5H6R A;  4X66 O;  2WWW A;  2WPD G;  3WU2 Z;  2EIL C;  3ZIA G;  1JJ2 U;  4PDM A;  1XUQ A;  1WNS A;  1FXV A;  1THZ A;  2RN9 A;  3FYI B;  1IBL O;  4J42 A;  3TET A;  1K34 A;  3QO8 A;  4TWK A;  2QA4 V;  4CC5 A;  1YZB A;  4F6R B;  2BTO A;  2ZKO A;  2DW4 A;  1HDJ A;  4YY3 B;  2W6I G;  2HVK C;  3FFQ A;  1OCC C;  1YXB A;  5BR8 O;  1URF A;  4NTY A;  1JJO A;  2BSK B;  2CUG A;  4DR5 B;  2VS0 A;  2LJ2 A;  3THO A;  3STL C;  3ZN0 A;  3UM7 A;  4UFZ A;  1N4C A;  1TUE B;  2YID A;  4JTA B;  3DC5 A;  5K1X A;  4FJC C;  5H2F Z;  3QO5 A;  4PD4 F;  2JVD A;  3G80 A;  3DXR B;  3FX7 A;  5H6Q A;  2PZS A;  2GV9 A;  2WLI A;  5BMV B;  5IJ0 A;  1GN6 A;  2QSA A;  1H2S B;  5CMU A;  4IIJ B;  3JD4 A;  1YI2 V;  1E79 G;  3SPC A;  3KZI Z;  1QLE B;  2CTW A;  1ZLZ A;  4P9O A;  1IBM B;  3RYF B;  2O57 A;  4TSF G;  2RJZ A;  1GTO A;  1QR9 A;  5LXT A;  4GX2 A;  5L3G A;  2VRZ A;  3LUT B;  3A2F A;  1WP7 A;  3DC6 A;  4O2B B;  2VWJ A;  1NTZ H;  2ZE8 A;  1I94 B;  4PHZ A;  3LSS A;  1KYO F;  2GDS A;  1VF5 B;  2B1I A;  3JAK A;  2WLK A;  2AW9 A;  4KFM A;  3L71 H;  1N32 B;  1CXZ B;  4I50 A;  2ZXW B;  3JSL A;  1BE3 H;  2RNB A;  1GK9 A;  4MTF A;  1JQ0 A;  3FKS G;  4WFG A;  4QIW F;  1H2G A;  3FB6 C;  3QG5 A;  4MT8 A;  3O65 A;  5LHI A;  1SES A;  5L3D A;  3ZED A;  2F4V B;  2YS8 A;  1MSW D;  1P4R A;  1XBL A;  1Y4M A;  3DGE A;  4JYC A;  1BMF G;  3FB5 C;  5L3C A;  3IC9 A;  2C2A A;  5LP6 A;  4LR3 A;  1FJG O;  4UV9 A;  4U3F H;  1ZUQ A;  2CAZ C;  1HP8 A;  1US6 A;  1M57 C;  2CK3 G;  2N05 A;  1AR4 A;  1M56 B;  2UUC O;  2YUA A;  1H2L A;  1FAF A;  4TUY B;  4FLX A;  3CRM A;  4JI5 O;  4KUM A;  3OGI B;  4A5U B;  3L9D A;  4O4H A;  1NQT A;  1TA8 A;  4KHP O;  1YVW A;  1NBM G;  1VIB A;  3FAV B;  4L8J A;  4YHH B;  3Q4H B;  1NTK H;  1FFX B;  1YCI A;  2EZP A;  1N33 B;  3D36 A;  5KX5 A;  4X1Y A;  2HKO A;  1P7B A;  1YDX A;  4CS2 A;  4JZ2 A;  3CP1 A;  1SA0 B;  1W0J G;  2F93 B;  2OYQ A;  3JAT A;  1KU9 A;  4X66 B;  2MW2 B;  3D3I A;  3E22 B;  3ZS8 C;  4PDL A;  3ZHQ A;  1QCE A;  2H8P C;  4DR1 B;  3AEI A;  2YDE A;  5IJ9 A;  1IBL B;  1VQ8 V;  2QWP B;  1R3J C;  2NNU A;  5EBL C;  3CRC A;  2Q0O C;  3T1H O;  3JAM N;  1U96 A;  1FXK B;  4MTX A;  3STZ C;  4UVA A;  2Q73 A;  3E83 A;  1FYJ A;  1PL4 A;  2EIN B;  1GM7 A;  3TXQ A;  1BSM A;  1LR1 A;  5BY1 A;  5BR8 B;  4LH7 A;  5FLX N;  1P84 F;  2ZNJ A;  4BIZ A;  3ZMU A;  4EB6 B;  5KHJ A;  4IYH A;  4LNU B;  5CBH A;  4JYA O;  5CA1 B;  3OUS A;  1ZAU A;  2JGD B;  1Y67 A;  3CCL V;  4DK0 A;  3EVK A;  4DV2 O;  1QHT A;  1OCZ B;  1JVM A;  1UPG A;  4JI4 O;  3RYI A;  1XMQ B;  2G38 A;  1SZX A;  1TUB A;  1FXH A;  4UB8 Z;  3RYC B;  2YEV A;  4LBE C;  1G1X B;  2GTS A;  4LF4 O;  4X64 O;  3A0R A;  4YJ3 B;  3CYO A;  2X0L A;  5JVD B;  2D2C B;  4LF6 B;  1OCR C;  4J7J A;  1HW7 A;  5H9C A;  3CSX A;  2Z0A A;  4O4L A;  4B7K A;  4DR7 O;  3MD0 A;  4CS3 A;  3ABM C;  4W4L A;  4X20 A;  3ZMS A;  4FIP C;  1G6U A;  1XIL A;  2CH7 A;  2WAM A;  1ZSP A;  2EIJ B;  5DM6 V;  3E35 A;  4DUY O;  4BR6 A;  1SQX H;  4HZ3 A;  3L73 H;  5CA0 B;  3K5L A;  4JI0 O;  3K03 A;  3AG2 B;  3IGA C;  5D5Q A;  2QE7 G;  4DRX A;  2N74 A;  2P06 A;  1I7F A;  4X65 B;  4TQD A;  1AI7 A;  3K59 A;  3B40 A;  2ZNI A;  3GB7 C;  3O9O A;  4RQF A;  3X2Q B;  2LFS A;  2X6C A;  1Q5O A;  2Y69 C;  3G4S V;  1W59 A;  4JI1 O;  3PN1 A;  3E8B A;  3JAS B;  1B6Q A;  1KQS U;  1BHA A;  1FJG B;  2ZE6 A;  2WLI B;  5IJ0 B;  2CDY A;  3C3T A;  2XAJ A;  3ASO C;  3K0D A;  1R3I C;  3JD3 A;  5GW7 A;  1D5N A;  1I5X A;  1EN5 A;  2Q7G A;  1JFF A;  3B4S A;  3VQX A;  2WA4 A;  5ITZ B;  3T2M A;  1K7D A;  4GCZ A;  1K73 W;  1SQB H;  1PP9 H;  1QR8 A;  2IM9 A;  1Q7Y W;  2ZQM A;  1RPO A;  2UUB B;  3MHS C;  3OR7 C;  2Q7E A;  5JCO C;  5LXT B;  3I56 V;  1FS0 G;  3QTC A;  4IT5 A;  4YIO A;  4KHP B;  4X1K B;  4B3T O;  2WLN A;  1YEW A;  2XAQ A;  3CX5 F;  3IJ4 A;  4NB5 A;  1EBO A;  3JAK B;  1COW G;  1VQL V;  3OEE G;  4I55 A;  4DV7 B;  1N0N A;  1H8H G;  4I50 B;  1LUV A;  5IYC O;  1OCO C;  2HHH B;  1EN6 A;  2HLD G;  3JD2 A;  3OAA G;  2QEX V;  3ETQ A;  4FZ0 A;  4LFB O;  1KKD A;  3T1H B;  1NVP D;  3M8A A;  3D8C A;  1SET A;  2AGA A;  4FLV A;  2L6L A;  5LP6 B;  3JYC A;  1HNW O;  5KMG A;  1V54 C;  1N34 B;  1NI8 A;  4BAY A;  5FPR A;  2JEX A;  5DN6 G;  2IU3 A;  3SJA C;  3D3Q A;  2M7W A;  2VQE B;  4AHC A;  5L3B A;  4JI2 O;  1VQK V;  2W0X A;  4DV2 B;  4GKK B;  4B3R O;  2VQF B;  5B66 Z;  2EIM B;  3U11 A;  5J2T B;  4JI4 B;  2ZE5 A;  5E79 Z;  3RWR D;  1EN4 A;  5LOV A;  1W0K G;  2IJK A;  2V1D A;  4WFH A;  1Q43 A;  3CC2 V;  1NTM H;  2ZD9 A;  1SQP H;  4X1Y B;  5JH7 A;  4K3A A;  3AG4 C;  3UO2 A;  3QNE A;  2F1M A;  1XNR B;  2Q67 A;  4JI8 O;  4QE7 A;  1LUW A;  4FM2 A;  2AZ0 A;  3SYC A;  1ZL8 A;  3JAW A;  1SZT A;  2CTQ A;  5IJ9 B;  4HAM A;  1BL8 A;  5LYJ A;  4FM1 A;  1U97 A;  4FFK A;  2ZCE A;  1Z2G A;  4TV8 A;  4DUZ B;  4DUY B;  5FPO A;  2RDC A;  1Y74 A;  1B04 A;  3VQV A;  5F2V O;  1NR1 A;  3N2K A;  3APO A;  1SS3 A;  5K1P A;  3CPW U;  2JIZ G;  4FLT A;  1T5E A;  1VQO V;  2AHY A;  2K9P A;  1XEQ A;  2NLJ C;  3WB2 A;  4JI3 B;  2ITC C;  3OMN B;  1KKC A;  5LMU O;  1RP3 B;  3CME V;  2DQ3 A;  5LL6 Y;  2F43 G;  3CXC U;  3BPZ A;  2BCC H;  2ILM A;  2Y0I A;  3ZRW A;  2M6Y A;  2LQT A;  4KP4 A;  1V55 C;  3W7T A;  3BVO A;  1DLB A;  1TUB B;  3W7X A;  1EZJ A;  3ZN1 A;  4FPP A;  4JI1 B;  2YEV B;  1S72 V;  1R6N A;  1HWY A;  1MZF A;  3OTF A;  3QVN A;  4LF8 O;  2KKW A;  4GX1 A;  5B3S B;  1A32 A;  1XI1 A;  2UU9 O;  1Q6U A;  4LF5 O;  4IGG A;  2UXB B;  3LNM B;  4O4L B;  2ZIO A;  2GBO A;  2HVJ C;  4GYC B;  1S5L Z;  4DV4 B;  2LW1 A;  3I55 V;  1Q90 D;  4DO2 A;  4WFA V;  4X20 B;  1VQ7 V;  3K04 A;  2B9Z A;  2LP7 A;  4U7N A;  2KSD A;  4WFB V;  2CH7 B;  3OD4 A;  2DYR C;  2EIK C;  3MDS A;  3K58 A;  3ABK C;  1RM1 C;  5GON A;  3N27 A;  5IY5 B;  3P30 A;  1TGO A;  2OCC B;  2ZT9 B;  4DRX B;  1ORQ C;  1Q6H A;  1QQC A;  3LSU A;  5BXZ A;  5LGN A;  3VOU A;  1B06 A;  1S77 D;  4AQY O;  1LNQ A;  1VQP V;  2BTQ A;  4OXS A;  2QKA A;  3EXA A;  2WLH A;  3OTO O;  4TT3 G;  4DV0 O;  2GUZ A;  4UUJ C;  3EHB B;  2YXY A;  3CJH A;  3FYE B;  4J9Z B;  4HYO A;  3AK2 A;  1YIT V;  3CC7 V;  1S5J A;  2A9H A;  4I9Q A;  4LFA O;  1VMG A;  2PUS A;  3QO7 A;  5L3E A;  5B1B C;  4N23 A;  3K57 A;  1SQF A;  2NN4 A;  5CB4 B;  3ZHU A;  3OFN G;  1KEC A;  2ZIN A;  4B3S B;  2YI9 A;  1JFF B;  5IYZ B;  3JD1 A;  3CRQ A;  3U10 A;  3H1J H;  1WLE A;  1XNQ O;  1TVK A;  2L35 A;  1K3E A;  3SPI A;  4XDJ A;  4JV5 B;  2WA3 A;  4NTW A;  4LFC B;  4ZIB A;  2DWD C;  4HBN A;  1BS3 A;  4H13 B;  4QNH B;  2AXT Z;  4FVM A;  3R65 A;  5IWA B;  1F4M A;  3W7W A;  4I55 B;  1SQV H;  3CCV V;  1WAZ A;  3JAL B;  3RT3 C;  2QWO B;  3RYH A;  3HKD A;  1IBK O;  3OE7 G;  3MAQ A;  1JPX A;  1AIL A;  1I0H A;  5J9P C;  1Y66 A;  2A06 H;  3ASN C;  3H1L H;  1MAB G;  5KHG A;  2YC0 A;  1XL6 A;  5KMG B;  3OW2 U;  4G28 B;  2CTR A;  4WBN A;  1Q86 W;  3L72 H;  3ETD A;  2YIB D;  2A0L A;  4J7Z A;  2DE0 X;  2ZM6 O;  4QPK A;  4DV1 O;  4LF7 O;  1KD1 W;  5JQG B;  2AHZ A;  1MMM A;  2EX3 A;  4LWS A;  3ZHV A;  2PI5 A;  1K8A W;  5LOV B;  4LF9 O;  3BAB A;  2RCV A;  4JI7 O;  2Q5Z A;  5EZY A;  4GLX A;  5JH7 B;  3LDD A;  3ABU A;  1DK1 A;  2E75 B;  2JGU A;  1BCC H;  3LSQ A;  4WFF A;  3ZX6 A;  4OX9 O;  2EBO A;  4DW1 A;  1AVM A;  4F4L A;  3EFF K;  4FFB A;  2W0F C;  4FLU A;  1ZL8 B;  4ZHQ A;  1ZTE A;  1SF9 A;  2OIG A;  1K5Q A;  2JJ1 G;  1SER A;  5KHH A;  4ZBM A;  3RVY A;  5LYJ B;  3F7V C;  4IHJ A;  1WPB A;  5LA6 A;  4TV8 B;  3FB7 C;  3TXS A;  2EJR A;  3L70 H;  4UV8 A;  5LGU A;  3GWO A;  2HJD A;  3K79 A;  2OT5 A;  3KCY A;  3N2K B;  4J41 A;  4PDR A;  1BZK A;  4JAA A;  4R6Z A;  5FL7 G;  4DV3 O;  3AG7 A;  3AG1 B;  1J5E O;  4MW3 A;  1HNZ O;  1DTO A;  3SYQ A;  1JOY A;  1GN3 A;  2EJ7 A;  3JCU Z;  2A79 B;  2BE3 A;  1QLE C;  2DN9 A;  4YJ2 A;  2X6A A;  1XRE A;  2PYL A;  5LMN O;  2EUL A;  3NXS A;  2HJF C;  1Q82 W;  4DR3 O;  1JA8 A;  1V9P A;  1F23 A;  4R50 A;  1XOU A;  4JAV A;  5KAF Z;  2HG5 C;  1R6K A;  2R9A A;  3CHX A;  1K33 A;  2UXD O;  3C3S A;  2Y69 B;  4UCV A;  5L3F A;  4UXN A;  5KHI A;  1XMO O;  2DYS B;  1WB7 A;  2CGO A;  4ZKI A;  3SGI A;  4IL6 Z;  4DV5 O;  1HR0 O;  2ADP A;  4P30 A;  3ASO B;  2E5L O;  4UVB A;  4FK5 C;  1KP2 A;  3J7A U;  2ZXW C;  1XNQ B;  4DR4 O;  1N36 O;  1CP9 A;  2XTA A;  1BT8 A;  3CD6 V;  3KCX A;  1B3Q A;  5EK0 A;  1WB8 A;  4PI2 A;  4FLZ A;  2PF4 E;  1EFR G;  2R9R B;  2OTL V;  1I5Y A;  2Y4U A;  5GON B;  4BW5 A;  4JI6 O;  2B1G A;  2XHB A;  3CCM V;  4JAS A;  2ATK C;  4PA6 A;  1L1F A;  5IDJ A;  1YF2 A;  3HKC A;  1M56 C;  3G67 A;  3E8F A;  2XOK G;  4U7O A;  2PYJ A;  1M5I A;  2GTA A;  3AG3 B;  1YHQ V;  2YI8 A;  1Z5V A;  1JX9 A;  2W6J G;  3JCZ A;  2ZIM A;  3G6E V;  4ABM A;  5E1A C;  4UCR A;  4X89 A;  4FZ1 A;  1DF4 A;  1E1Q G;  4KL1 A;  3B09 A;  2Y48 A;  1OV9 A;  4K0K O;  4LF7 B;  1PKX A;  2OTJ V;  2UXC O;  1NU1 H;  1X4T A;  2Q68 A;  4MVZ A;  1TVK B;  3ZCC A;  2RQ6 A;  4HNA A;  1XHZ A;  3UT5 A;  4LF9 B;  4RWU A;  4MVU A;  1X59 A;  2ZE7 A;  3WG7 B;  3CCR V;  3I5D A;  3K0G A;  3ZMZ A;  5C8Y A;  1DF5 A;  1FXK C;  3B8N A;  5HFM A;  1FFT B;  3P3N A;  4X9Q A;  1K97 A;  4MTO A;  2EIN C;  3BHP A;  1QBZ A;  1QVF U;  2UUC B;  2CTP A;  4G27 B;  1S76 D;  4QJF B;  4PV1 B;  4JI5 B;  3AG4 B;  1HNX O;  2DMX A;  3ETG A;  1N8R W;  4O4I A;  4X62 O;  4H33 A;  1M1K W;  1MZE A;  4D7T A;  3ABL B;  3AK3 A;  4GKJ O;  1QVG U;  4FMT A;  3FB8 C;  3E8G A;  4K8X A;  2BOB C;  5D5P A;  1PNM A;  4WBN B;  1XQ8 A;  3W7S A;  2UUA O;  3H9V A;  1G8M A;  4PA3 A;  4F6E A;  1HNZ B;  4J10 A;  4PA9 A;  2JS5 A;  4I4T A;  3WB1 A;  5BMV A;  4ICG A;  2B5U A;  1BQ0 A;  3CB2 A;  1VQ6 V;  4QPJ A;  1TAE A;  4LWS B;  4OGQ B;  3R66 A;  4DR3 B;  4LH6 A;  5CA3 A;  5B1A B;  1JCH A;  2UXD B;  1NZ6 A;  4H37 A;  2EIJ C;  2DJV A;  5EZY B;  5JJN B;  3F5W C;  3H1I H;  2ZR2 A;  1XMO B;  2X7R B;  1MOF A;  2WLJ A;  4QE9 A;  1YIJ V;  3BFR A;  2F23 A;  1RSO A;  1NR7 A;  1RPR A;  2ZDI C;  3WFV A;  2QWN B;  4FFB B;  4JYA B;  3AG2 C;  4O2A A;  1NH2 B;  1HR0 B;  2Q9L A;  4ZHQ B;  4I7Z B;  5IT9 N;  2RMK B;  4YY3 O;  2A7W A;  2DQ0 A;  4O4H B;  4JTC B;  3RFR A;  4IHJ B;  3BA8 A;  3U0Z A;  4E2L A;  1R6T A;  4DR5 O;  4LF4 B;  4X64 B;  3X2Q C;  1GRJ A;  5LBQ A;  2LW7 A;  4PJ0 Z;  2QM4 A;  5KX5 B;  1R3L C;  2DYR B;  2EIK B;  4EEQ A;  1VF6 C;  4C7U A;  4DR7 B;  1WA8 A;  1H2N A;  2WSS G;  3JAT B;  1F51 A;  3HKB A;  1RM1 B;  3HKE A;  2D3O W;  1DGS A;  1IVS A;  4YJ2 B;  2AZ2 A;  3IFX A;  4OPH A;  1VP7 A;  4PDV A;  1AJP A;  5EBW C;  4X1I A;  2EIL B;  2R9I A;  3RW0 A;  1RFY A;  3BCC H;  3SPG A;  1IBM O;  1CPY A;  4J9Y B;  2QTO A;  2QDO A;  3J81 N;  1M9N A;  5BZB A;  4JI0 B;  1KC8 W;  2ITD C;  4KXR A;  4MW8 A;  2QR4 A;  4EFE A;  3HB3 B;  4DR6 O;  3G6B A;  4K0K B;  1OCC B;  2Y4T A;  3E89 A;  5B1B B;  2KB1 A;  3K5M A;  3B2E E;  1I94 O;  2UXC B;  2XAH A;  3CE2 A;  4NXM O;  1UJW B;  5EYP A;  4Z1M G;  3RYI B;  1YTF B;  5LHH A;  1VEW A;  3CMA V;  3HPL C;  1PPJ H;  4WFE A;  3TCU A;  2ARH A;  4DW0 A;  1N32 O;  2A3Q A;  3J80 N;  2XUM A;  1BGY H;  1CEZ A;  2YXH A;  3ZRV A;  3CCJ V;  1MG1 A;  2XAS A;  5B5E Z;  4TV9 A;  5LP6 C;  1FPO A;  2F4V O;  2Q4P A;  1AI4 A;  2PTM A;  4XDK A;  3HKC B;  3GWK C;  4CH5 A;  2DWE C;  1HNX B;  3S3W A;  4J11 A;  3ICX A;  1NT2 B;  3ZHS A;  4UCU A;  4B3T B;  4NXN O;  4B7E A;  5JCO A;  2EIM C;  1SQQ H;  3SYA A;  2JJ2 G;  3OR6 C;  4DR2 O;  2JGD A;  4J7K A;  2YSU B;  1NJI W;  3E2E A;  1SC5 B;  3RN4 A;  2XT9 A;  1SKV A;  4EKW A;  2CGN A;  3D36 C;  1ZWI C;  1L0L H;  5KAI Z;  2QGN A;  4LP8 A;  2E3C A;  4YHH O;  3NR7 A;  1W2B U;  5J2U A;  1N33 O;  4H44 B;  1XL4 A;  3H1H H;  2Z5U A;  2ZR3 A;  5DEC A; 
#chains in the Genus database with same CATH homology
 2YUA A;  2GUZ B;  1FPO A;  3UCS C;  3UO2 A;  1IUR A;  1FAF A;  2GUZ A;  2OCH A;  3APO A;  2CTP A;  2CTW A;  1N4C A;  2KQX A;  2N04 A;  3BVO A;  3AG7 A;  1HDJ A;  2LO1 A;  4J80 A;  2YS8 A;  1XBL A;  2L6L A;  2CTR A;  1NZ6 A;  2DMX A;  2QWQ B;  3UO3 A;  4RWU A;  4IT5 A;  2QWO B;  1WJZ A;  2CUG A;  2CTQ A;  4J7Z A;  1BQZ A;  2EJ7 A;  3APQ A;  2PF4 E;  2DN9 A;  1GH6 A;  2QSA A;  2QWP B;  1BQ0 A;  2Y4U A;  2Y4T A;  2QWR B;  2LGW A;  2QWN B;  2N05 A;  2M6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...