2LO1A

Nmr structure of the protein bc008182, a dnaj-like domain from homo sapiens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
b'GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily A member 1
publication title NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lo1A00
1FPOA 2QWPB 1N4CA 4J80A 2DMXA 2QWRB 2Y4TA 2CTQA 3UO3A 3APQA 1NZ6A 2CTWA 1BQ0A 1GH6A 1HDJA 2CTRA 2L6LA 2GUZB 2CUGA 2M6YA 2EJ7A 2YS8A 3BVOA 3APOA 3AG7A 3UCSC 1IURA 2LO1A 2Y4UA 4IT5A 2LGWA 4J7ZA 2QWOB 2QWQB 1FAFA 2N05A 2YUAA 2N04A 2QWNB 1BQZA 1XBLA 3UO2A 2GUZA 2QSAA 1WJZA 2OCHA 2CTPA 4RWUA 2KQXA 2PF4E 2DN9A
chains in the Genus database with same CATH superfamily
1F4MA 2QJ1A 3OM3B 5L3EA 1OCZC 1AROP 1AJQA 2ZD9A 4KHPB 1IBLB 4LF4O 2RMKB 5IYBO 4GX0A 2IU3A 3WFVA 1WLEA 1AI5A 1YSCA 4JYBA 4X88A 2IJJA 1EN6A 1XHXA 3FX7A 1IDSA 1W2BU 1HNXO 4MVRA 1S77D 1TGOA 1MZFA 3QVNA 4DR1O 1KD1W 4DR4B 3S3WA 3ZHVA 4J80A 4Q20A 5J2UA 4LNUB 4B7KA 4DR7B 4GKJO 1EM1A 4HZ3A 2Q7EA 3RYFB 1K5SA 4CS3A 3OGCC 4O2AB 4I9QA 1VMGA 3E86A 3JD1A 3STZC 4JASA 1R6NA 1XILA 5LMUB 5IYCO 3BABA 3O9OA 5B1BB 1JA8A 4X65B 1O9GA 3CS5A 4B08A 4MVQA 4XBFA 5TISZ 4JTCB 5KMGA 1HNWB 3FB7C 3AG7A 1Q6HA 4DR3B 1OJHA 3DXRB 2DE0X 1XNQB 1JPXA 1QVGU 1GN6A 3IJ4A 2OWOA 2RJZA 1FFXB 3CCSV 1D2DA 2Q6AA 1BT8A 2WPDG 2EJ7A 5LP6C 4OX9O 2JS5A 4B7EA 4D6TH 3JD0A 1L0NH 3B09A 3T1YB 4JV5B 4WBNB 3HKEA 1PL4A 2HEPA 1G4YB 1VQLV 5GTIZ 2H3OA 2KQXA 2OTLV 2GTAA 4PELA 1D5NA 4RUEA 1R3KC 3C3TA 4CZZA 1WB8A 3MHHC 2YI9A 4JTDB 3AG4B 1SRYA 4HAMA 4DUYB 1W0JG 1E79G 1VIBA 1E1RG 1PKXA 2QTOA 3UCSC 1RM1C 1B3QA 4LNUA 4DK0A 1ZLZA 2BTQB 3JD4A 1B06A 4BIZA 1EZVH 5LGUA 4O2AA 4I0XB 4UXNA 1K4DC 4PHZA 1GRJA 4LH7A 3QTCA 1QHTA 1HDJA 3GWOA 4OXSA 3BHPA 3IAYA 3S3XA 5KA5A 2BE3A 2R9AA 1QNMA 3ZHRA 2QWQB 1VQPV 2Y48A 1SETA 3AK2A 4NXMO 5IWAO 2P90A 1YITV 4PDRA 3ZMVA 2HJDA 2JJ2G 1YVWA 4JPRA 4RAIA 4XDJA 5B66Z 1S5HC 4JI3B 5KX5B 3MD0A 4G2KA 2RNBA 3ABMB 4CH6A 5IY5B 3RYIB 3ABLC 1ORQC 3OTOB 3O65A 3H1KH 5FNVB 1NVPD 2ZCEA 1VARA 3HKBB 1H8HG 3D8CA 1WP8A 4X1KB 2UXBO 4TV9B 5LGNA 1AILA 1VP7A 2JGDB 2JIZG 5FLXN 1X59A 3LDDA 1MOFA 3HPLC 2DQ0A 1YJWV 2AXTZ 4LF8O 5IYZB 1NH2B 3KKYA 4JI5B 5H2FZ 4EEQA 2X6AA 3E83A 5JJNB 4UCUA 2E3CA 5L3DA 1EZJA 1Q82W 1QVFU 4J11A 4TOIA 4X1YA 1VQ7V 4I0XA 4MVOA 2UU9O 3U0ZA 2LGWA 4KP4A 1GN2A 3QO5A 4EB6B 5LGTA 2UXDO 1F4NA 2XAQA 1SQXH 1P7GA 4MTOA 4NXNO 4UV8A 3W7TA 3K3WA 3KCXA 4DV5O 1NZ6A 2PUSA 5KHIA 4LWSA 1XNRB 4I55A 2JEUA 2UXXA 1KMIZ 3ZHSA 2ARHA 1UFIA 2XTAA 1DK1A 2OIGA 3N2KB 2ZM6O 1H8EG 4PI2A 4PJ0Z 1RSOB 1G8MA 2JVDA 3K5NA 4DV4B 2P5OA 3RYIA 1AJNA 1SZXA 4CH4A 5FNVA 3THOA 5JCOC 4UCVA 4GUNA 4BIOA 1SQVH 2UXCO 2F23A 3AG2C 5LYJB 3PN1A 2BOCC 2DJVA 3T1HB 2WA3A 3HKCB 3DC6A 3VBBA 3RVZA 1NI8A 1YDXA 3APQA 3AG3B 4MVUA 1G6UA 4TQDA 3OFNG 3OAAG 5KHHA 5FPOA 1NT2B 1SERA 4LF6O 5HFLA 3WU2Z 1IBKO 4HYOA 3N27A 4F4LA 3LDEA 1K73W 1N33B 3K04A 1RFYA 4AQYO 4IYIA 4EB6A 1A32A 2GDSA 3CCRV 3BCCH 4IHJA 5EK0A 1XREA 4QE9A 1JCHA 4B3MO 3MAQA 3JSNA 5KHGA 4PA9A 2QSAA 1JFFA 4K3AA 2Q73A 1S5JA 4FZ0A 2QWPB 2E5LB 1Y74A 3A0HZ 2FTKA 2HHHB 1N8RW 4WFEA 2HKOA 1NQTA 3F7VC 1N0JA 3SPCA 1ZUQA 4ZKIA 1XMOO 3A0RA 1RSOA 5C8YA 2EX3A 3ZN0A 3HKDB 2LO1A 2QGNA 1V55B 2M7WA 4J42A 4RQEA 2B1IA 4TUYA 4ZHQB 1I94B 5B1BC 3GB7C 5CB4B 4GKKB 1VF6A 2HFEC 4GYCB 3ZIAG 4OPHA 2QKSA 3HKCA 2IH3C 2GUZB 2CK3G 4YJ3B 3OE7G 3UT5A 2PZSA 2JRIA 4GLXA 1Q86W 4QNHB 4JAAA 2EIKB 4LFBO 3JAWB 1YJ9V 1L1FA 3E2EA 5IJ9B 1FJGO 2R9RB 4UCRA 3E35A 3EHBB 4L87A 4YHHO 1KU9A 3B2EE 2ZNJA 5BR8B 3ETEA 3K0GA 3G6BA 3ZHQA 4X9QA 5ITZB 3LNNA 3SJCC 1S5LZ 1AJPA 1MABG 1YF2A 5EBLC 2NN4A 4E2LA 3NR7A 1VQOV 2CTQA 1YEWA 3AG4C 1ROPA 2F4VB 3I55V 4KXRA 2LP7A 2Q7HA 4YIPA 1IURA 4IT5A 1PP9H 4YJ2A 3OW2U 2ZXWB 3VOUA 3CJHB 2GBOA 2A9HA 3SPHA 1K3EA 2KSDA 1QR8A 2Y0IA 3ABKB 1BZKA 4DR5O 3HKDA 3CEIA 1XMQO 4U7OA 3X2QB 1OCRB 3ZS8C 2PYLA 4JI1B 1PPJH 2ZR3A 2CTWA 2BCCH 4LH6A 2RCVA 2BTOA 1W59A 1ZX3A 3GVMA 2A3QA 4WFAV 4TSFG 2KG7A 4DXWA 5LOVB 4J10A 4WFGA 2QDOA 1AR1B 1W0KG 1LNQA 2CUGA 1MSDA 1SZTA 1WP7A 3FB6C 4DRXA 1OZ0A 4JI4B 1N34B 3JAWA 3ABMC 5J2UB 3KZIZ 4CBCA 5IY5C 1JJ2U 1R3JC 4JI2O 4B3TB 4PA7A 5A2QN 2QWRB 4H33A 5ITZA 2R70A 4DV7B 1AI6A 3ZRWA 1DGSA 2Y0PA 4J9ZB 2PYJA 2XASA 5KMGB 3E8GA 4FLZA 1XI1A 4ZOLB 4MVMA 4JAVA 3FB5C 2VQEB 4DUZB 4F6RB 2Y69B 5CMUA 1MZEA 1SQQH 3SR2C 1L0LH 2AHYA 3IC7A 2UUAO 4DO2A 4LF9B 4X1IA 5H5NA 2YXHA 4UB6Z 1YTFD 1YCIA 3EFFK 1WB7A 2CH7A 2QM7A 4FFKA 1N4CA 3ZMTA 4LCUC 2LFRA 1DTOA 4MTXA 1FXHA 3HKEB 1NU1H 5LOVA 4H0LB 4LFAB 3IGAC 3JSLA 1HP8A 2M6YA 1Y76A 4UCTA 4TV8A 3CRQA 3ZRSA 3CPWU 2VQFB 2HG5C 2Q4PA 2CGNA 4LF7O 1B04A 2ODMA 1RPRA 4Z1VA 1Q43A 5BY1A 2ETNA 1URFA 1HNZB 5GTHZ 3OEHG 3ABTA 3W7XA 1H2MA 2QKCA 4UCOA 3CXCU 4KHPO 1IBLO 1N0NA 1Y67A 2G38A 2ZIOA 2IM9A 3CB2A 4I9WA 3SPIA 2F1MA 2EBOA 5CA1B 3H01A 2YICA 5DM6V 1BCCH 3OT7A 3L9DA 4DV1B 1S72V 3LSUA 1TUBB 4DR7O 1Z5WA 3QNEA 3E8HA 2IJHA 2JGUA 3AG3C 1OCOB 1R6KA 4DV2B 1FD9A 1GM7A 2JS3A 2OCCB 4ZOLA 5LMUO 4I5SA 1ENVA 4F6RA 4X65O 1WJZA 1I08A 5EBWC 4O4LB 1M56C 1Y66A 3FD9A 3DC5A 5JWPA 3B4SA 3K9AA 1HNWO 1DF4A 4DR3O 3B77A 4ZI7A 4FLUA 1XNQO 3WB0A 2V7QG 5GW7A 1GKFA 3RT3C 1KQSU 1KYOF 3ETGA 1HR0B 3K03A 3BPZA 3M99B 1FXKB 5EIBC 1KB9F 2W6JG 1CEZA 3TETA 3VQVA 4DV6B 3SJQC 4JV5O 2ZT9B 4DYLA 1V55C 4MTGA 1ZL8B 3BEHA 1KUQA 5FL7G 4X1YB 4FLXA 1DF5A 3E8BA 1AP6A 1F7YA 2QKAA 1EBOA 5CA1A 4DUYO 1XHZA 3D36A 2W0XA 4B3SB 1G1XB 4C7UA 5LBQA 3BY6A 1ZTEA 1TUBA 2B9ZA 2DYRB 2EIJB 1SKVA 3JASB 2YIAA 5BMVB 3SDLA 4DK1A 4X66B 4LWSB 2EIKC 3T1CA 5F2VO 3SPJA 2WA4A 2P06A 3CX5F 4I55B 5KHKA 4FIPC 2ZIMA 1BQ0A 3CMEV 1IXBA 2WWWA 2AGAA 3SYPA 2JDIG 5LHGA 1FFTB 4O4LA 2ZINA 3TCUA 1PV0A 1FAFA 4UCSA 4YY3B 3K9SA 1THZA 2ADQB 1GN4A 1VQ5V 2LGQA 3DSQA 4FPPA 5LMNB 4DV0B 4U3JB 1E1QG 4K0KB 4JI3O 2QR4A 3OR6C 3QO8A 1BE3H 4FLWA 2P4VA 4JI6B 1ZSPA 5BXZA 4DR6B 3VQWA 5CBGA 3SJAC 5D5PA 3OTOO 3JALA 5L3GA 2IU0A 2ZXWC 1FXKA 3R66A 3ABKC 3R65A 3X2QC 1OCRC 3SYQA 4Z1MG 1MNGA 4O2BA 3JAMN 1ZL8A 3ZEDA 1AVMA 4JYYA 4MW3A 3SJBC 4QIWF 3T2MA 2WLJA 3AK1A 5BZBA 2ITCC 2UU9B 2YIBD 3WB1A 3RFRA 4FM1A 2Z0AA 4QPJA 1FYJA 4ICGA 4UFZA 4JI5O 1AI7A 3ETDA 3F5TA 3OR7C 4L8JA 3JASA 4IHJB 5L3BA 2Z5UA 4AILC 5BMVA 2JEXA 5GONA 3J81N 1IXMA 1F51A 1M4UA 1NTMH 1JFFB 4HBNA 2DYSB 3SYOA 2Q0AA 1Y74B 3D3QA 4DR2O 2IJKA 3K0DA 3ZMUA 3L70H 2ZM6B 2XAHA 1N36B 3N2GA 5C8YB 3ZMZA 2HVJC 2EILB 2EIMB 1BHBA 4LC1A 1XNRO 3BRCA 2F93B 4TUYB 2BSKB 4JYCA 3G4SV 5JJEB 2PY5A 4J9YB 2JK5C 3Q4HA 4U3JA 1XDCA 4NTXA 4FK5C 1VEWA 4PV1B 1AB3A 2WSSG 1JOYA 2CTPA 1J5EB 3PJSK 1BSMA 1JJOA 4DV4O 3L73H 4A5UB 3BAAA 1SC5B 2ZE5A 2H8PC 3UT5B 2AZ0A 1H2SB 4IIJA 2A0LA 1D5AA 5B3SB 1WNSA 4GZRB 2QTSA 1SQBH 3H9VA 1AR4A 2Y69C 4K35A 2LW1A 2YSUB 4LF6B 3T1HO 3ZRVA 5D5QA 5J2TB 2FYUH 1OCCB 2WLIA 3K06A 2ADPA 2DW4A 4FFBB 3FB8C 1BGYH 3P30A 3OUSA 4DV3B 4LF5B 2ZE7A 4H37A 3RWRD 4UUJC 2DOSA 1S3JA 4X62B 4PA3A 1N33O 1M90W 2OIEA 2LW7A 4X64B 5LHHA 4QGPA 2CAZC 2VWKA 4PA4A 4YJ2B 2UXNA 4PI0A 1YIJV 1I5YA 3D3IA 4XDLA 4MVSA 4TQFA 4JYAB 1AR5A 2PGGA 2E75B 5L3CA 5LHIA 4FM0A 1V54B 4CC5A 2BSKA 1FKAO 4O4IA 5B1NA 5EYPA 2E5LO 1NKDA 2HHHO 2KG7B 3AK3A 3P32A 3E89A 1QBZA 3L72H 3CC7V 1AP5A 5CBFA 1OCOC 2ZNIA 2YXLA 1HWYA 2WLMA 2OCCC 1U97A 4DRXB 1I94O 1GM8A 4JZ2A 4O4HB 3EXAA 1OHHG 2FKXA 4GKKO 2WLKA 4CH5A 4WF9V 3J80N 2GV9A 2A06H 5LA6A 4I4TA 5EZYA 2XOKG 4OGQB 1GMGA 1IX9A 5J2TA 1V9PA 5KHJA 4JI0B 1BMFG 2XAGA 4R6ZA 3G6EV 3T4ZA 4D7SA 4FFBA 4G28B 3UKMA 5FPRA 2XNDG 3ML0A 3ZRWB 3JD3A 4BR6A 3GWKC 5IDJA 4PD4F 1FXKC 5AG2A 4QPKA 1YZBA 5KAFZ 2YS8A 3F5WC 4H44B 1HW7A 2VWJA 5BR8O 3JCUZ 1MMMA 1PD3A 4X20A 3ASNB 4CS2A 2KKWA 3CE2A 4P2ZA 2LFSA 5KAIZ 5LP6A 3W7SA 1F23A 1MG1A 1VQKV 1IBMB 1XL6A 3P3NA 1XMQB 4LFCB 2Q0OC 2DMXA 4JI7B 2XAJA 3P3PA 4X1IB 3UO3A 3RYCA 1QLEB 5JQGA 2F4VO 2UUCB 5J9PC 2GHYA 1EN5A 1JR9A 1S0VA 4JI8O 2V4DA 2CH7B 3L74H 3HR0A 4NR1A 3SPGA 2EIJC 1VQ4V 2WLNA 3ZJZA 3LUTB 5H9CA 1CPYA 3B40A 2EULA 1Y76B 3CYOA 2Z3YA 4TV8B 1FPOA 3K5MA 3CCEV 1YJNV 4JI1O 4LR3A 2IBZH 4KL1A 4O4HA 2B5UA 2F95B 2C2AA 4I50A 4AHCA 2W6IG 2ZQMA 3BFRA 5K1XA 3E22A 4B3RB 4JAUA 3JCZA 1XQ8A 1VF5B 2Q67A 4FVMA 2DN9A 5EIBD 2ZR2A 4UB8Z 4J41A 2Q69A 4JI4O 1FS0G 5B1AB 1ZAUA 2L6LA 3IFXA 3ZHTA 5HFMA 2PI5A 3RYHA 1N34O 1N32B 3ICXA 4YXWG 4N23A 4YIOA 5DN6G 2DWEC 4LBEC 3G71V 2UUBB 3SGIA 4RQFA 1Q81W 1SA0B 3DGEA 4MVZA 4PDMA 4CH3A 1H38A 2K9PA 1Q7YW 2FL4A 5CA0B 4GCZA 5H6QA 4DV7O 1KC8W 2BOBC 3QF7A 3G67A 1UPGA 1B6QA 1Q6UA 2Q68A 3CCLV 1NBMG 3JATB 3C3SA 3FAVB 4Q6GA 2HR3A 4ZI7B 2VQEO 4EFBA 4DUZO 1KP2A 1EFRG 3CRAA 1GAXA 4I7ZB 3ASOB 4LF9O 2DYSC 4LF4B 2HP8A 1PL0A 4JTAB 4CS4A 2N05A 2YUAA 1Q90D 3B8NA 1WPXA 1HNXB 4DR1B 1R3IC 2QM4A 3J7AU 2EILC 4GKJB 2EIMC 5JVDA 4LFAO 2HLDG 3CC2V 1K7DA 4GT1A 4PA6A 2P22C 2VQFO 4ABMA 2P6JA 3U10A 1PNLA 1JQ0A 1VF6C 4ZBMA 4O4JA 3ZRXA 1HNZO 4XDKA 3JAKA 2F43G 3K79A 3VQYA 3JARA 4DR4O 2VS0A 1UJWB 5IJ0B 1NVPB 2X6BA 3TXSA 2FB5A 1H2GA 2IW5A 5B3SC 1SQPH 2HJFC 3HB3B 2P4KA 1SA0A 2GSMB 1Q5OA 1VQMV 3H1HH 1CP9A 5JCOA 5CA0A 4NTWA 2PTMA 4DV1O 3I56V 3CRCA 4IL6Z 3WG7B 3OUFA 1IVSA 1OCCC 4WFBV 2IH1C 1P84F 4NTYA 4X8AA 1KKCA 1JX9A 4E4EA 1O9HA 1K5QA 4DV2O 4MW8A 1LUWA 1OV9A 2K1EA 4OX9B 3JATA 3FAVA 2A79B 2N74A 2NR5A 1PM9A 4FLYA 1EN4A 3BA9A 3OMNB 1IZ3A 3OMAB 3MHSC 4HNAA 3CC4V 1RPOA 1QU7A 3ZCCA 2ZDIA 4P9OA 1NJIW 3JALB 5JH7A 2EJRA 3LNMB 4UVBA 3B8MA 3H1JH 2ZE8A 4P30A 4TT3G 4CC6A 4J7KA 4BAYA 1K34A 5B5EZ 3RW0A 5KA6A 3G80A 4BWAA 3T1YO 4J7ZA 2YIDA 2QWNB 4O2BB 2XHBA 1PNMA 1V54C 2CGOA 1HR0O 2Q5ZA 4BW5A 1KECA 3AG1B 5E79Z 3CSXA 3W7UA 1M57B 2QEXV 1WAZA 1YXBA 3JD2A 1TA8A 5EC2C 1GTOA 4DV6O 4X89A 4BW9A 4NVPA 4RO2A 1TVKB 5IJ0A 3KCYA 5EBMC 4GX2A 1K97A 2JJ1G 3RBZA 2WLHA 3RYFA 5GONB 2EZPA 2DQ3A 1XUQA 1YI2V 2Q9LA 4W4LA 5IWAB 4NXMB 4MTFA 3LSQA 3LSSA 4B3SO 1BS3A 2H94A 1SF9A 3A0BZ 2CE4A 3TXQA 3N2GB 2CDYA 2Q7GA 5E1AC 5CBHA 4X66O 1BL8A 1BQZA 2FMLA 3ETQA 3K58A 1VQ6V 2YXYA 2A7WA 3ZHUA 4PDVA 3DXRA 3Q4HB 5JJJB 1Z5VA 2UXBB 3NXSA 2RN9A 3I5DA 2YIBA 5H6RA 3ABUA 4WFFA 1FFXA 1SQGA 3FYIB 4YY3O 4IIJB 3ASNC 3UM7A 1GM9A 3UO2A 1KP3A 3K5OA 2R9IA 2WAMA 5LMNO 2E76B 4ASUG 1NR7A 4DV0O 3M7MX 4H13B 5CA3A 4LF8B 1WN7A 1CXZB 3CXHF 1AI4A 4K0KO 4WBNA 4R7CA 1QLEC 4JI6O 4DR6O 2Q8VA 1M9NA 1Z2GA 4MT8A 2Y4UA 2WLIB 1Q6IA 2HVKC 4IYHA 3RVYA 1S76D 2UXDB 3FYEB 2E74B 4Z2WA 3ZN1A 4GX5A 1TVKA 4NXNB 2X6CA 4RUFA 2BTQA 4EFEA 2LJ2A 3KG2A 2V1DA 4WFHA 4DV5B 2CTRA 3A2FA 2OYQA 1NTZH 4FM2A 3K59A 3CHXA 1YHQV 4DR2B 2EINB 3K5LA 1WPBA 3OTFA 4IGGA 5KLVH 3L71H 2ILMA 2Y4TA 1OCZB 5B1AC 4NYKA 2OTJV 3CMAV 1NTKH 1LUVA 2OT5A 4O4IB 1Q8IA 4MS2A 3RN4A 3CCVV 5EYPB 4JF3A 1U96A 4FLVA 2UXCB 2P67A 4LP8A 1L8DA 3CRMA 5KX5A 1N36O 1BHAA 5LL6Y 1QCEA 1VQNV 1Q3EA 2GTSA 1K4CC 5C93A 2RDCA 3HKBA 3LDCA 4FJCC 3UQ8A 3OEEG 2QM8A 5DEDA 4X1KA 4TV9A 1P49A 1TAEA 5LA6B 2YC0A 3DTUB 2JGDA 4I4TB 5EZYB 1IBKB 1M1KW 4K8XA 1J5EO 1K8AW 3WB2A 3CCMV 1R3LC 1GN3A 1VF7A 3W7WA 2D2CB 5K1PA 4AQYB 5IYZA 5KUMA 1K9MW 3ASOC 4QE7A 1GK9A 4W4KA 1H2KA 1JMKC 3QG5A 2NLJC 2DWDC 2ZDIC 4B3MB 1FXVA 2AZ2A 4JGSA 1M56B 3TJTA 4KFMA 3CWBH 1QLNA 4X20B 1M5IA 4DV3O 3CRRA 4LF5O 2MK3A 5LP6B 1NR1A 2ATKC 3APOA 4DW0A 1XMOB 1LR1A 3TK1A 1NH2D 3RYCB 4X62O 5JQGB 1XBLA 4R50A 1TUEB 3OD4A 3D36C 2L35A 4X64O 5CN0A 1R73A 1SS3A 4TWKA 4ZIBA 2F66C 1KKDA 2YEVB 4NKGB 3F7YC 3N2KA 5LXTB 3BVOA 1H2NA 3SYAA 4JYAO 4NB5A 2W0FC 1RM1B 4DW1A 1T5EA 2PI4A 3CCUV 4LFBB 4I50B 3STLC 5LYJA 3WG7C 1RP3B 3C90A 3CD6V 3FKSG 4J7JA 2ZE6A 4FLTA 3E22B 1FJGB 2LQTA 2B1GA 4YHHB 1COWG 2NNUA 2WLLB 1MA1A 3ZBHA 1SESA 3FFQA 1DLBA 1I0HA 4U3FH 3BA8A 3MDSA 3CCJV 2AW9A 3RYHB 4P9PA 2P7TC 4OPAA 1YTFB 1WA8B 3QO7A 2X0LA 1VQ9V 4JI0O 2R72A 3ZMSA 3U11A 4AI8A 1Y4MA 5A9GA 2EZOA 1US6A 2XT9A 3ABLB 4GX1A 1QR9A 2AHZA 1XL4A 3T4DA 3K08A 3CP1A 3ZX6A 4DR5B 4FZ1A 3AG1C 1M57C 1GH6A 1Y6XA 3CCQV 1ZWIC 2XAFA 3TGUH 3VQXA 5IE9A 4JI8B 2KB1A 2O57A 3M8AA 4G27B 2DYRC 3IC9A 1GO3F 2YEVA 4WCEV 1XOUA 1R1BA 5LXTA 2QWOB 2ITDC 1IBMO 4LFCO 4JI7O 2X7RB 3SYCA 1JVMA 3OMIB 4FMTA 2UUCO 4ZHQA 5KUKA 2MW2B 5EC1C 5CB4A 1K92A 1KBHA 1P7BA 1XEQA 3RGBA 3OGIB 1H2LA 1I7FA 2GUZA 5JVDB 2RQ6A 4YJ3A 2WLLA 4BIUA 4JI2B 2QE7G 4QJFB 3H1IH 2ZKOA 4O4JB 4UVCA 3AEIA 3JAKB 3JARB 5DECA 1PNKA 1SQFA 3K57A 3H1LH 1WA8A 4KUMA 1MSWD 4UV9A 5IJ9A 3A8TA 4B3RO 4N21A 2QA4V 2IJIA 2OCHA 4PDLA 2YDEA 5L3FA 4B3TO 1QQCA 1M93A 4MSWC 2XUMA 2D3OW 1P4RA 1N32O 3AG2B 2UUAB 4JZGA 4R8CA 1X4TA 1J95A 3E8FA 2UUBO 4RWUA 4K8ZA 2PF4E 2YI8A 1I5XA 3EVKA 5B1OA 1NS1A 5IYDO 3CJHA 4U7NA 2VRZA 4EKWA 4D7TA 5IT9N 4F6EA 4HNAB 4LF7B 3JYCA 1K33A 2EINC 2N04A 5JH7B 4UVAA 3L75H 1R6TA 1VQ8V
chains in the Genus database with same CATH topology
1FPOA 2QWPB 1N4CA 4J80A 2DMXA 2QWRB 2Y4TA 2CTQA 3UO3A 3APQA 1NZ6A 2CTWA 1BQ0A 1GH6A 1HDJA 2CTRA 2L6LA 2GUZB 2CUGA 2M6YA 2EJ7A 2YS8A 3BVOA 3APOA 3AG7A 3UCSC 1IURA 2LO1A 2Y4UA 4IT5A 2LGWA 4J7ZA 2QWOB 2QWQB 1FAFA 2N05A 2YUAA 2N04A 2QWNB 1BQZA 1XBLA 3UO2A 2GUZA 2QSAA 1WJZA 2OCHA 2CTPA 4RWUA 2KQXA 2PF4E 2DN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPO A;  2QWP B;  1N4C A;  4J80 A;  2DMX A;  2QWR B;  2Y4T A;  2CTQ A;  3UO3 A;  3APQ A;  1NZ6 A;  2CTW A;  1BQ0 A;  1GH6 A;  1HDJ A;  2CTR A;  2L6L A;  2GUZ B;  2CUG A;  2M6Y A;  2EJ7 A;  2YS8 A;  3BVO A;  3APO A;  3AG7 A;  3UCS C;  1IUR A;  2LO1 A;  2Y4U A;  4IT5 A;  2LGW A;  4J7Z A;  2QWO B;  2QWQ B;  1FAF A;  2N05 A;  2YUA A;  2N04 A;  2QWN B;  1BQZ A;  1XBL A;  3UO2 A;  2GUZ A;  2QSA A;  1WJZ A;  2OCH A;  2CTP A;  4RWU A;  2KQX A;  2PF4 E;  2DN9 A; 
#chains in the Genus database with same CATH topology
 1F4M A;  2QJ1 A;  3OM3 B;  5L3E A;  1OCZ C;  1ARO P;  1AJQ A;  2ZD9 A;  4KHP B;  1IBL B;  4LF4 O;  2RMK B;  5IYB O;  4GX0 A;  2IU3 A;  3WFV A;  1WLE A;  1AI5 A;  1YSC A;  4JYB A;  4X88 A;  2IJJ A;  1EN6 A;  1XHX A;  3FX7 A;  1IDS A;  1W2B U;  1HNX O;  4MVR A;  1S77 D;  1TGO A;  1MZF A;  3QVN A;  4DR1 O;  1KD1 W;  4DR4 B;  3S3W A;  3ZHV A;  4J80 A;  4Q20 A;  5J2U A;  4LNU B;  4B7K A;  4DR7 B;  4GKJ O;  1EM1 A;  4HZ3 A;  2Q7E A;  3RYF B;  1K5S A;  4CS3 A;  3OGC C;  4O2A B;  4I9Q A;  1VMG A;  3E86 A;  3JD1 A;  3STZ C;  4JAS A;  1R6N A;  1XIL A;  5LMU B;  5IYC O;  3BAB A;  3O9O A;  5B1B B;  1JA8 A;  4X65 B;  1O9G A;  3CS5 A;  4B08 A;  4MVQ A;  4XBF A;  5TIS Z;  4JTC B;  5KMG A;  1HNW B;  3FB7 C;  3AG7 A;  1Q6H A;  4DR3 B;  1OJH A;  3DXR B;  2DE0 X;  1XNQ B;  1JPX A;  1QVG U;  1GN6 A;  3IJ4 A;  2OWO A;  2RJZ A;  1FFX B;  3CCS V;  1D2D A;  2Q6A A;  1BT8 A;  2WPD G;  2EJ7 A;  5LP6 C;  4OX9 O;  2JS5 A;  4B7E A;  4D6T H;  3JD0 A;  1L0N H;  3B09 A;  3T1Y B;  4JV5 B;  4WBN B;  3HKE A;  1PL4 A;  2HEP A;  1G4Y B;  1VQL V;  5GTI Z;  2H3O A;  2KQX A;  2OTL V;  2GTA A;  4PEL A;  1D5N A;  4RUE A;  1R3K C;  3C3T A;  4CZZ A;  1WB8 A;  3MHH C;  2YI9 A;  4JTD B;  3AG4 B;  1SRY A;  4HAM A;  4DUY B;  1W0J G;  1E79 G;  1VIB A;  1E1R G;  1PKX A;  2QTO A;  3UCS C;  1RM1 C;  1B3Q A;  4LNU A;  4DK0 A;  1ZLZ A;  2BTQ B;  3JD4 A;  1B06 A;  4BIZ A;  1EZV H;  5LGU A;  4O2A A;  4I0X B;  4UXN A;  1K4D C;  4PHZ A;  1GRJ A;  4LH7 A;  3QTC A;  1QHT A;  1HDJ A;  3GWO A;  4OXS A;  3BHP A;  3IAY A;  3S3X A;  5KA5 A;  2BE3 A;  2R9A A;  1QNM A;  3ZHR A;  2QWQ B;  1VQP V;  2Y48 A;  1SET A;  3AK2 A;  4NXM O;  5IWA O;  2P90 A;  1YIT V;  4PDR A;  3ZMV A;  2HJD A;  2JJ2 G;  1YVW A;  4JPR A;  4RAI A;  4XDJ A;  5B66 Z;  1S5H C;  4JI3 B;  5KX5 B;  3MD0 A;  4G2K A;  2RNB A;  3ABM B;  4CH6 A;  5IY5 B;  3RYI B;  3ABL C;  1ORQ C;  3OTO B;  3O65 A;  3H1K H;  5FNV B;  1NVP D;  2ZCE A;  1VAR A;  3HKB B;  1H8H G;  3D8C A;  1WP8 A;  4X1K B;  2UXB O;  4TV9 B;  5LGN A;  1AIL A;  1VP7 A;  2JGD B;  2JIZ G;  5FLX N;  1X59 A;  3LDD A;  1MOF A;  3HPL C;  2DQ0 A;  1YJW V;  2AXT Z;  4LF8 O;  5IYZ B;  1NH2 B;  3KKY A;  4JI5 B;  5H2F Z;  4EEQ A;  2X6A A;  3E83 A;  5JJN B;  4UCU A;  2E3C A;  5L3D A;  1EZJ A;  1Q82 W;  1QVF U;  4J11 A;  4TOI A;  4X1Y A;  1VQ7 V;  4I0X A;  4MVO A;  2UU9 O;  3U0Z A;  2LGW A;  4KP4 A;  1GN2 A;  3QO5 A;  4EB6 B;  5LGT A;  2UXD O;  1F4N A;  2XAQ A;  1SQX H;  1P7G A;  4MTO A;  4NXN O;  4UV8 A;  3W7T A;  3K3W A;  3KCX A;  4DV5 O;  1NZ6 A;  2PUS A;  5KHI A;  4LWS A;  1XNR B;  4I55 A;  2JEU A;  2UXX A;  1KMI Z;  3ZHS A;  2ARH A;  1UFI A;  2XTA A;  1DK1 A;  2OIG A;  3N2K B;  2ZM6 O;  1H8E G;  4PI2 A;  4PJ0 Z;  1RSO B;  1G8M A;  2JVD A;  3K5N A;  4DV4 B;  2P5O A;  3RYI A;  1AJN A;  1SZX A;  4CH4 A;  5FNV A;  3THO A;  5JCO C;  4UCV A;  4GUN A;  4BIO A;  1SQV H;  2UXC O;  2F23 A;  3AG2 C;  5LYJ B;  3PN1 A;  2BOC C;  2DJV A;  3T1H B;  2WA3 A;  3HKC B;  3DC6 A;  3VBB A;  3RVZ A;  1NI8 A;  1YDX A;  3APQ A;  3AG3 B;  4MVU A;  1G6U A;  4TQD A;  3OFN G;  3OAA G;  5KHH A;  5FPO A;  1NT2 B;  1SER A;  4LF6 O;  5HFL A;  3WU2 Z;  1IBK O;  4HYO A;  3N27 A;  4F4L A;  3LDE A;  1K73 W;  1N33 B;  3K04 A;  1RFY A;  4AQY O;  4IYI A;  4EB6 A;  1A32 A;  2GDS A;  3CCR V;  3BCC H;  4IHJ A;  5EK0 A;  1XRE A;  4QE9 A;  1JCH A;  4B3M O;  3MAQ A;  3JSN A;  5KHG A;  4PA9 A;  2QSA A;  1JFF A;  4K3A A;  2Q73 A;  1S5J A;  4FZ0 A;  2QWP B;  2E5L B;  1Y74 A;  3A0H Z;  2FTK A;  2HHH B;  1N8R W;  4WFE A;  2HKO A;  1NQT A;  3F7V C;  1N0J A;  3SPC A;  1ZUQ A;  4ZKI A;  1XMO O;  3A0R A;  1RSO A;  5C8Y A;  2EX3 A;  3ZN0 A;  3HKD B;  2LO1 A;  2QGN A;  1V55 B;  2M7W A;  4J42 A;  4RQE A;  2B1I A;  4TUY A;  4ZHQ B;  1I94 B;  5B1B C;  3GB7 C;  5CB4 B;  4GKK B;  1VF6 A;  2HFE C;  4GYC B;  3ZIA G;  4OPH A;  2QKS A;  3HKC A;  2IH3 C;  2GUZ B;  2CK3 G;  4YJ3 B;  3OE7 G;  3UT5 A;  2PZS A;  2JRI A;  4GLX A;  1Q86 W;  4QNH B;  4JAA A;  2EIK B;  4LFB O;  3JAW B;  1YJ9 V;  1L1F A;  3E2E A;  5IJ9 B;  1FJG O;  2R9R B;  4UCR A;  3E35 A;  3EHB B;  4L87 A;  4YHH O;  1KU9 A;  3B2E E;  2ZNJ A;  5BR8 B;  3ETE A;  3K0G A;  3G6B A;  3ZHQ A;  4X9Q A;  5ITZ B;  3LNN A;  3SJC C;  1S5L Z;  1AJP A;  1MAB G;  1YF2 A;  5EBL C;  2NN4 A;  4E2L A;  3NR7 A;  1VQO V;  2CTQ A;  1YEW A;  3AG4 C;  1ROP A;  2F4V B;  3I55 V;  4KXR A;  2LP7 A;  2Q7H A;  4YIP A;  1IUR A;  4IT5 A;  1PP9 H;  4YJ2 A;  3OW2 U;  2ZXW B;  3VOU A;  3CJH B;  2GBO A;  2A9H A;  3SPH A;  1K3E A;  2KSD A;  1QR8 A;  2Y0I A;  3ABK B;  1BZK A;  4DR5 O;  3HKD A;  3CEI A;  1XMQ O;  4U7O A;  3X2Q B;  1OCR B;  3ZS8 C;  2PYL A;  4JI1 B;  1PPJ H;  2ZR3 A;  2CTW A;  2BCC H;  4LH6 A;  2RCV A;  2BTO A;  1W59 A;  1ZX3 A;  3GVM A;  2A3Q A;  4WFA V;  4TSF G;  2KG7 A;  4DXW A;  5LOV B;  4J10 A;  4WFG A;  2QDO A;  1AR1 B;  1W0K G;  1LNQ A;  2CUG A;  1MSD A;  1SZT A;  1WP7 A;  3FB6 C;  4DRX A;  1OZ0 A;  4JI4 B;  1N34 B;  3JAW A;  3ABM C;  5J2U B;  3KZI Z;  4CBC A;  5IY5 C;  1JJ2 U;  1R3J C;  4JI2 O;  4B3T B;  4PA7 A;  5A2Q N;  2QWR B;  4H33 A;  5ITZ A;  2R70 A;  4DV7 B;  1AI6 A;  3ZRW A;  1DGS A;  2Y0P A;  4J9Z B;  2PYJ A;  2XAS A;  5KMG B;  3E8G A;  4FLZ A;  1XI1 A;  4ZOL B;  4MVM A;  4JAV A;  3FB5 C;  2VQE B;  4DUZ B;  4F6R B;  2Y69 B;  5CMU A;  1MZE A;  1SQQ H;  3SR2 C;  1L0L H;  2AHY A;  3IC7 A;  2UUA O;  4DO2 A;  4LF9 B;  4X1I A;  5H5N A;  2YXH A;  4UB6 Z;  1YTF D;  1YCI A;  3EFF K;  1WB7 A;  2CH7 A;  2QM7 A;  4FFK A;  1N4C A;  3ZMT A;  4LCU C;  2LFR A;  1DTO A;  4MTX A;  1FXH A;  3HKE B;  1NU1 H;  5LOV A;  4H0L B;  4LFA B;  3IGA C;  3JSL A;  1HP8 A;  2M6Y A;  1Y76 A;  4UCT A;  4TV8 A;  3CRQ A;  3ZRS A;  3CPW U;  2VQF B;  2HG5 C;  2Q4P A;  2CGN A;  4LF7 O;  1B04 A;  2ODM A;  1RPR A;  4Z1V A;  1Q43 A;  5BY1 A;  2ETN A;  1URF A;  1HNZ B;  5GTH Z;  3OEH G;  3ABT A;  3W7X A;  1H2M A;  2QKC A;  4UCO A;  3CXC U;  4KHP O;  1IBL O;  1N0N A;  1Y67 A;  2G38 A;  2ZIO A;  2IM9 A;  3CB2 A;  4I9W A;  3SPI A;  2F1M A;  2EBO A;  5CA1 B;  3H01 A;  2YIC A;  5DM6 V;  1BCC H;  3OT7 A;  3L9D A;  4DV1 B;  1S72 V;  3LSU A;  1TUB B;  4DR7 O;  1Z5W A;  3QNE A;  3E8H A;  2IJH A;  2JGU A;  3AG3 C;  1OCO B;  1R6K A;  4DV2 B;  1FD9 A;  1GM7 A;  2JS3 A;  2OCC B;  4ZOL A;  5LMU O;  4I5S A;  1ENV A;  4F6R A;  4X65 O;  1WJZ A;  1I08 A;  5EBW C;  4O4L B;  1M56 C;  1Y66 A;  3FD9 A;  3DC5 A;  5JWP A;  3B4S A;  3K9A A;  1HNW O;  1DF4 A;  4DR3 O;  3B77 A;  4ZI7 A;  4FLU A;  1XNQ O;  3WB0 A;  2V7Q G;  5GW7 A;  1GKF A;  3RT3 C;  1KQS U;  1KYO F;  3ETG A;  1HR0 B;  3K03 A;  3BPZ A;  3M99 B;  1FXK B;  5EIB C;  1KB9 F;  2W6J G;  1CEZ A;  3TET A;  3VQV A;  4DV6 B;  3SJQ C;  4JV5 O;  2ZT9 B;  4DYL A;  1V55 C;  4MTG A;  1ZL8 B;  3BEH A;  1KUQ A;  5FL7 G;  4X1Y B;  4FLX A;  1DF5 A;  3E8B A;  1AP6 A;  1F7Y A;  2QKA A;  1EBO A;  5CA1 A;  4DUY O;  1XHZ A;  3D36 A;  2W0X A;  4B3S B;  1G1X B;  4C7U A;  5LBQ A;  3BY6 A;  1ZTE A;  1TUB A;  2B9Z A;  2DYR B;  2EIJ B;  1SKV A;  3JAS B;  2YIA A;  5BMV B;  3SDL A;  4DK1 A;  4X66 B;  4LWS B;  2EIK C;  3T1C A;  5F2V O;  3SPJ A;  2WA4 A;  2P06 A;  3CX5 F;  4I55 B;  5KHK A;  4FIP C;  2ZIM A;  1BQ0 A;  3CME V;  1IXB A;  2WWW A;  2AGA A;  3SYP A;  2JDI G;  5LHG A;  1FFT B;  4O4L A;  2ZIN A;  3TCU A;  1PV0 A;  1FAF A;  4UCS A;  4YY3 B;  3K9S A;  1THZ A;  2ADQ B;  1GN4 A;  1VQ5 V;  2LGQ A;  3DSQ A;  4FPP A;  5LMN B;  4DV0 B;  4U3J B;  1E1Q G;  4K0K B;  4JI3 O;  2QR4 A;  3OR6 C;  3QO8 A;  1BE3 H;  4FLW A;  2P4V A;  4JI6 B;  1ZSP A;  5BXZ A;  4DR6 B;  3VQW A;  5CBG A;  3SJA C;  5D5P A;  3OTO O;  3JAL A;  5L3G A;  2IU0 A;  2ZXW C;  1FXK A;  3R66 A;  3ABK C;  3R65 A;  3X2Q C;  1OCR C;  3SYQ A;  4Z1M G;  1MNG A;  4O2B A;  3JAM N;  1ZL8 A;  3ZED A;  1AVM A;  4JYY A;  4MW3 A;  3SJB C;  4QIW F;  3T2M A;  2WLJ A;  3AK1 A;  5BZB A;  2ITC C;  2UU9 B;  2YIB D;  3WB1 A;  3RFR A;  4FM1 A;  2Z0A A;  4QPJ A;  1FYJ A;  4ICG A;  4UFZ A;  4JI5 O;  1AI7 A;  3ETD A;  3F5T A;  3OR7 C;  4L8J A;  3JAS A;  4IHJ B;  5L3B A;  2Z5U A;  4AIL C;  5BMV A;  2JEX A;  5GON A;  3J81 N;  1IXM A;  1F51 A;  1M4U A;  1NTM H;  1JFF B;  4HBN A;  2DYS B;  3SYO A;  2Q0A A;  1Y74 B;  3D3Q A;  4DR2 O;  2IJK A;  3K0D A;  3ZMU A;  3L70 H;  2ZM6 B;  2XAH A;  1N36 B;  3N2G A;  5C8Y B;  3ZMZ A;  2HVJ C;  2EIL B;  2EIM B;  1BHB A;  4LC1 A;  1XNR O;  3BRC A;  2F93 B;  4TUY B;  2BSK B;  4JYC A;  3G4S V;  5JJE B;  2PY5 A;  4J9Y B;  2JK5 C;  3Q4H A;  4U3J A;  1XDC A;  4NTX A;  4FK5 C;  1VEW A;  4PV1 B;  1AB3 A;  2WSS G;  1JOY A;  2CTP A;  1J5E B;  3PJS K;  1BSM A;  1JJO A;  4DV4 O;  3L73 H;  4A5U B;  3BAA A;  1SC5 B;  2ZE5 A;  2H8P C;  3UT5 B;  2AZ0 A;  1H2S B;  4IIJ A;  2A0L A;  1D5A A;  5B3S B;  1WNS A;  4GZR B;  2QTS A;  1SQB H;  3H9V A;  1AR4 A;  2Y69 C;  4K35 A;  2LW1 A;  2YSU B;  4LF6 B;  3T1H O;  3ZRV A;  5D5Q A;  5J2T B;  2FYU H;  1OCC B;  2WLI A;  3K06 A;  2ADP A;  2DW4 A;  4FFB B;  3FB8 C;  1BGY H;  3P30 A;  3OUS A;  4DV3 B;  4LF5 B;  2ZE7 A;  4H37 A;  3RWR D;  4UUJ C;  2DOS A;  1S3J A;  4X62 B;  4PA3 A;  1N33 O;  1M90 W;  2OIE A;  2LW7 A;  4X64 B;  5LHH A;  4QGP A;  2CAZ C;  2VWK A;  4PA4 A;  4YJ2 B;  2UXN A;  4PI0 A;  1YIJ V;  1I5Y A;  3D3I A;  4XDL A;  4MVS A;  4TQF A;  4JYA B;  1AR5 A;  2PGG A;  2E75 B;  5L3C A;  5LHI A;  4FM0 A;  1V54 B;  4CC5 A;  2BSK A;  1FKA O;  4O4I A;  5B1N A;  5EYP A;  2E5L O;  1NKD A;  2HHH O;  2KG7 B;  3AK3 A;  3P32 A;  3E89 A;  1QBZ A;  3L72 H;  3CC7 V;  1AP5 A;  5CBF A;  1OCO C;  2ZNI A;  2YXL A;  1HWY A;  2WLM A;  2OCC C;  1U97 A;  4DRX B;  1I94 O;  1GM8 A;  4JZ2 A;  4O4H B;  3EXA A;  1OHH G;  2FKX A;  4GKK O;  2WLK A;  4CH5 A;  4WF9 V;  3J80 N;  2GV9 A;  2A06 H;  5LA6 A;  4I4T A;  5EZY A;  2XOK G;  4OGQ B;  1GMG A;  1IX9 A;  5J2T A;  1V9P A;  5KHJ A;  4JI0 B;  1BMF G;  2XAG A;  4R6Z A;  3G6E V;  3T4Z A;  4D7S A;  4FFB A;  4G28 B;  3UKM A;  5FPR A;  2XND G;  3ML0 A;  3ZRW B;  3JD3 A;  4BR6 A;  3GWK C;  5IDJ A;  4PD4 F;  1FXK C;  5AG2 A;  4QPK A;  1YZB A;  5KAF Z;  2YS8 A;  3F5W C;  4H44 B;  1HW7 A;  2VWJ A;  5BR8 O;  3JCU Z;  1MMM A;  1PD3 A;  4X20 A;  3ASN B;  4CS2 A;  2KKW A;  3CE2 A;  4P2Z A;  2LFS A;  5KAI Z;  5LP6 A;  3W7S A;  1F23 A;  1MG1 A;  1VQK V;  1IBM B;  1XL6 A;  3P3N A;  1XMQ B;  4LFC B;  2Q0O C;  2DMX A;  4JI7 B;  2XAJ A;  3P3P A;  4X1I B;  3UO3 A;  3RYC A;  1QLE B;  5JQG A;  2F4V O;  2UUC B;  5J9P C;  2GHY A;  1EN5 A;  1JR9 A;  1S0V A;  4JI8 O;  2V4D A;  2CH7 B;  3L74 H;  3HR0 A;  4NR1 A;  3SPG A;  2EIJ C;  1VQ4 V;  2WLN A;  3ZJZ A;  3LUT B;  5H9C A;  1CPY A;  3B40 A;  2EUL A;  1Y76 B;  3CYO A;  2Z3Y A;  4TV8 B;  1FPO A;  3K5M A;  3CCE V;  1YJN V;  4JI1 O;  4LR3 A;  2IBZ H;  4KL1 A;  4O4H A;  2B5U A;  2F95 B;  2C2A A;  4I50 A;  4AHC A;  2W6I G;  2ZQM A;  3BFR A;  5K1X A;  3E22 A;  4B3R B;  4JAU A;  3JCZ A;  1XQ8 A;  1VF5 B;  2Q67 A;  4FVM A;  2DN9 A;  5EIB D;  2ZR2 A;  4UB8 Z;  4J41 A;  2Q69 A;  4JI4 O;  1FS0 G;  5B1A B;  1ZAU A;  2L6L A;  3IFX A;  3ZHT A;  5HFM A;  2PI5 A;  3RYH A;  1N34 O;  1N32 B;  3ICX A;  4YXW G;  4N23 A;  4YIO A;  5DN6 G;  2DWE C;  4LBE C;  3G71 V;  2UUB B;  3SGI A;  4RQF A;  1Q81 W;  1SA0 B;  3DGE A;  4MVZ A;  4PDM A;  4CH3 A;  1H38 A;  2K9P A;  1Q7Y W;  2FL4 A;  5CA0 B;  4GCZ A;  5H6Q A;  4DV7 O;  1KC8 W;  2BOB C;  3QF7 A;  3G67 A;  1UPG A;  1B6Q A;  1Q6U A;  2Q68 A;  3CCL V;  1NBM G;  3JAT B;  3C3S A;  3FAV B;  4Q6G A;  2HR3 A;  4ZI7 B;  2VQE O;  4EFB A;  4DUZ O;  1KP2 A;  1EFR G;  3CRA A;  1GAX A;  4I7Z B;  3ASO B;  4LF9 O;  2DYS C;  4LF4 B;  2HP8 A;  1PL0 A;  4JTA B;  4CS4 A;  2N05 A;  2YUA A;  1Q90 D;  3B8N A;  1WPX A;  1HNX B;  4DR1 B;  1R3I C;  2QM4 A;  3J7A U;  2EIL C;  4GKJ B;  2EIM C;  5JVD A;  4LFA O;  2HLD G;  3CC2 V;  1K7D A;  4GT1 A;  4PA6 A;  2P22 C;  2VQF O;  4ABM A;  2P6J A;  3U10 A;  1PNL A;  1JQ0 A;  1VF6 C;  4ZBM A;  4O4J A;  3ZRX A;  1HNZ O;  4XDK A;  3JAK A;  2F43 G;  3K79 A;  3VQY A;  3JAR A;  4DR4 O;  2VS0 A;  1UJW B;  5IJ0 B;  1NVP B;  2X6B A;  3TXS A;  2FB5 A;  1H2G A;  2IW5 A;  5B3S C;  1SQP H;  2HJF C;  3HB3 B;  2P4K A;  1SA0 A;  2GSM B;  1Q5O A;  1VQM V;  3H1H H;  1CP9 A;  5JCO A;  5CA0 A;  4NTW A;  2PTM A;  4DV1 O;  3I56 V;  3CRC A;  4IL6 Z;  3WG7 B;  3OUF A;  1IVS A;  1OCC C;  4WFB V;  2IH1 C;  1P84 F;  4NTY A;  4X8A A;  1KKC A;  1JX9 A;  4E4E A;  1O9H A;  1K5Q A;  4DV2 O;  4MW8 A;  1LUW A;  1OV9 A;  2K1E A;  4OX9 B;  3JAT A;  3FAV A;  2A79 B;  2N74 A;  2NR5 A;  1PM9 A;  4FLY A;  1EN4 A;  3BA9 A;  3OMN B;  1IZ3 A;  3OMA B;  3MHS C;  4HNA A;  3CC4 V;  1RPO A;  1QU7 A;  3ZCC A;  2ZDI A;  4P9O A;  1NJI W;  3JAL B;  5JH7 A;  2EJR A;  3LNM B;  4UVB A;  3B8M A;  3H1J H;  2ZE8 A;  4P30 A;  4TT3 G;  4CC6 A;  4J7K A;  4BAY A;  1K34 A;  5B5E Z;  3RW0 A;  5KA6 A;  3G80 A;  4BWA A;  3T1Y O;  4J7Z A;  2YID A;  2QWN B;  4O2B B;  2XHB A;  1PNM A;  1V54 C;  2CGO A;  1HR0 O;  2Q5Z A;  4BW5 A;  1KEC A;  3AG1 B;  5E79 Z;  3CSX A;  3W7U A;  1M57 B;  2QEX V;  1WAZ A;  1YXB A;  3JD2 A;  1TA8 A;  5EC2 C;  1GTO A;  4DV6 O;  4X89 A;  4BW9 A;  4NVP A;  4RO2 A;  1TVK B;  5IJ0 A;  3KCY A;  5EBM C;  4GX2 A;  1K97 A;  2JJ1 G;  3RBZ A;  2WLH A;  3RYF A;  5GON B;  2EZP A;  2DQ3 A;  1XUQ A;  1YI2 V;  2Q9L A;  4W4L A;  5IWA B;  4NXM B;  4MTF A;  3LSQ A;  3LSS A;  4B3S O;  1BS3 A;  2H94 A;  1SF9 A;  3A0B Z;  2CE4 A;  3TXQ A;  3N2G B;  2CDY A;  2Q7G A;  5E1A C;  5CBH A;  4X66 O;  1BL8 A;  1BQZ A;  2FML A;  3ETQ A;  3K58 A;  1VQ6 V;  2YXY A;  2A7W A;  3ZHU A;  4PDV A;  3DXR A;  3Q4H B;  5JJJ B;  1Z5V A;  2UXB B;  3NXS A;  2RN9 A;  3I5D A;  2YIB A;  5H6R A;  3ABU A;  4WFF A;  1FFX A;  1SQG A;  3FYI B;  4YY3 O;  4IIJ B;  3ASN C;  3UM7 A;  1GM9 A;  3UO2 A;  1KP3 A;  3K5O A;  2R9I A;  2WAM A;  5LMN O;  2E76 B;  4ASU G;  1NR7 A;  4DV0 O;  3M7M X;  4H13 B;  5CA3 A;  4LF8 B;  1WN7 A;  1CXZ B;  3CXH F;  1AI4 A;  4K0K O;  4WBN A;  4R7C A;  1QLE C;  4JI6 O;  4DR6 O;  2Q8V A;  1M9N A;  1Z2G A;  4MT8 A;  2Y4U A;  2WLI B;  1Q6I A;  2HVK C;  4IYH A;  3RVY A;  1S76 D;  2UXD B;  3FYE B;  2E74 B;  4Z2W A;  3ZN1 A;  4GX5 A;  1TVK A;  4NXN B;  2X6C A;  4RUF A;  2BTQ A;  4EFE A;  2LJ2 A;  3KG2 A;  2V1D A;  4WFH A;  4DV5 B;  2CTR A;  3A2F A;  2OYQ A;  1NTZ H;  4FM2 A;  3K59 A;  3CHX A;  1YHQ V;  4DR2 B;  2EIN B;  3K5L A;  1WPB A;  3OTF A;  4IGG A;  5KLV H;  3L71 H;  2ILM A;  2Y4T A;  1OCZ B;  5B1A C;  4NYK A;  2OTJ V;  3CMA V;  1NTK H;  1LUV A;  2OT5 A;  4O4I B;  1Q8I A;  4MS2 A;  3RN4 A;  3CCV V;  5EYP B;  4JF3 A;  1U96 A;  4FLV A;  2UXC B;  2P67 A;  4LP8 A;  1L8D A;  3CRM A;  5KX5 A;  1N36 O;  1BHA A;  5LL6 Y;  1QCE A;  1VQN V;  1Q3E A;  2GTS A;  1K4C C;  5C93 A;  2RDC A;  3HKB A;  3LDC A;  4FJC C;  3UQ8 A;  3OEE G;  2QM8 A;  5DED A;  4X1K A;  4TV9 A;  1P49 A;  1TAE A;  5LA6 B;  2YC0 A;  3DTU B;  2JGD A;  4I4T B;  5EZY B;  1IBK B;  1M1K W;  4K8X A;  1J5E O;  1K8A W;  3WB2 A;  3CCM V;  1R3L C;  1GN3 A;  1VF7 A;  3W7W A;  2D2C B;  5K1P A;  4AQY B;  5IYZ A;  5KUM A;  1K9M W;  3ASO C;  4QE7 A;  1GK9 A;  4W4K A;  1H2K A;  1JMK C;  3QG5 A;  2NLJ C;  2DWD C;  2ZDI C;  4B3M B;  1FXV A;  2AZ2 A;  4JGS A;  1M56 B;  3TJT A;  4KFM A;  3CWB H;  1QLN A;  4X20 B;  1M5I A;  4DV3 O;  3CRR A;  4LF5 O;  2MK3 A;  5LP6 B;  1NR1 A;  2ATK C;  3APO A;  4DW0 A;  1XMO B;  1LR1 A;  3TK1 A;  1NH2 D;  3RYC B;  4X62 O;  5JQG B;  1XBL A;  4R50 A;  1TUE B;  3OD4 A;  3D36 C;  2L35 A;  4X64 O;  5CN0 A;  1R73 A;  1SS3 A;  4TWK A;  4ZIB A;  2F66 C;  1KKD A;  2YEV B;  4NKG B;  3F7Y C;  3N2K A;  5LXT B;  3BVO A;  1H2N A;  3SYA A;  4JYA O;  4NB5 A;  2W0F C;  1RM1 B;  4DW1 A;  1T5E A;  2PI4 A;  3CCU V;  4LFB B;  4I50 B;  3STL C;  5LYJ A;  3WG7 C;  1RP3 B;  3C90 A;  3CD6 V;  3FKS G;  4J7J A;  2ZE6 A;  4FLT A;  3E22 B;  1FJG B;  2LQT A;  2B1G A;  4YHH B;  1COW G;  2NNU A;  2WLL B;  1MA1 A;  3ZBH A;  1SES A;  3FFQ A;  1DLB A;  1I0H A;  4U3F H;  3BA8 A;  3MDS A;  3CCJ V;  2AW9 A;  3RYH B;  4P9P A;  2P7T C;  4OPA A;  1YTF B;  1WA8 B;  3QO7 A;  2X0L A;  1VQ9 V;  4JI0 O;  2R72 A;  3ZMS A;  3U11 A;  4AI8 A;  1Y4M A;  5A9G A;  2EZO A;  1US6 A;  2XT9 A;  3ABL B;  4GX1 A;  1QR9 A;  2AHZ A;  1XL4 A;  3T4D A;  3K08 A;  3CP1 A;  3ZX6 A;  4DR5 B;  4FZ1 A;  3AG1 C;  1M57 C;  1GH6 A;  1Y6X A;  3CCQ V;  1ZWI C;  2XAF A;  3TGU H;  3VQX A;  5IE9 A;  4JI8 B;  2KB1 A;  2O57 A;  3M8A A;  4G27 B;  2DYR C;  3IC9 A;  1GO3 F;  2YEV A;  4WCE V;  1XOU A;  1R1B A;  5LXT A;  2QWO B;  2ITD C;  1IBM O;  4LFC O;  4JI7 O;  2X7R B;  3SYC A;  1JVM A;  3OMI B;  4FMT A;  2UUC O;  4ZHQ A;  5KUK A;  2MW2 B;  5EC1 C;  5CB4 A;  1K92 A;  1KBH A;  1P7B A;  1XEQ A;  3RGB A;  3OGI B;  1H2L A;  1I7F A;  2GUZ A;  5JVD B;  2RQ6 A;  4YJ3 A;  2WLL A;  4BIU A;  4JI2 B;  2QE7 G;  4QJF B;  3H1I H;  2ZKO A;  4O4J B;  4UVC A;  3AEI A;  3JAK B;  3JAR B;  5DEC A;  1PNK A;  1SQF A;  3K57 A;  3H1L H;  1WA8 A;  4KUM A;  1MSW D;  4UV9 A;  5IJ9 A;  3A8T A;  4B3R O;  4N21 A;  2QA4 V;  2IJI A;  2OCH A;  4PDL A;  2YDE A;  5L3F A;  4B3T O;  1QQC A;  1M93 A;  4MSW C;  2XUM A;  2D3O W;  1P4R A;  1N32 O;  3AG2 B;  2UUA B;  4JZG A;  4R8C A;  1X4T A;  1J95 A;  3E8F A;  2UUB O;  4RWU A;  4K8Z A;  2PF4 E;  2YI8 A;  1I5X A;  3EVK A;  5B1O A;  1NS1 A;  5IYD O;  3CJH A;  4U7N A;  2VRZ A;  4EKW A;  4D7T A;  5IT9 N;  4F6E A;  4HNA B;  4LF7 B;  3JYC A;  1K33 A;  2EIN C;  2N04 A;  5JH7 B;  4UVA A;  3L75 H;  1R6T A;  1VQ8 V; 
#chains in the Genus database with same CATH homology
 1FPO A;  2QWP B;  1N4C A;  4J80 A;  2DMX A;  2QWR B;  2Y4T A;  2CTQ A;  3UO3 A;  3APQ A;  1NZ6 A;  2CTW A;  1BQ0 A;  1GH6 A;  1HDJ A;  2CTR A;  2L6L A;  2GUZ B;  2CUG A;  2M6Y A;  2EJ7 A;  2YS8 A;  3BVO A;  3APO A;  3AG7 A;  3UCS C;  1IUR A;  2LO1 A;  2Y4U A;  4IT5 A;  2LGW A;  4J7Z A;  2QWO B;  2QWQ B;  1FAF A;  2N05 A;  2YUA A;  2N04 A;  2QWN B;  1BQZ A;  1XBL A;  3UO2 A;  2GUZ A;  2QSA A;  1WJZ A;  2OCH A;  2CTP A;  4RWU A;  2KQX A;  2PF4 E;  2DN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...