2LO1A

Nmr structure of the protein bc008182, a dnaj-like domain from homo sapiens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily A member 1
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lo1A00
2GUZA 2QWNB 2DN9A 3AG7A 2L6LA 2Y4TA 1IURA 1FPOA 2PF4E 2CTWA 2GUZB 3BVOA 2CTRA 1GH6A 2QWOB 2N04A 2QWRB 3UO2A 2OCHA 3APQA 2Y4UA 2LGWA 2LO1A 2QWPB 2YS8A 4RWUA 3APOA 3UCSC 2EJ7A 4IT5A 1WJZA 2M6YA 1XBLA 2CUGA 2KQXA 4J80A 2CTPA 1BQZA 2DMXA 1NZ6A 4J7ZA 1FAFA 1BQ0A 1HDJA 2QWQB 2QSAA 2N05A 2CTQA 1N4CA 2YUAA 3UO3A
chains in the Genus database with same CATH superfamily
1KBHA 3JARB 4UVCA 3SJAC 5FPRA 4DV5B 1ZAUA 2IJIA 2JJ1G 1FKAO 1NJIW 3HKBA 4LF6B 4LFAB 1BZKA 2CAZC 3OW2U 2WLHA 1FXKC 2FL4A 1O9HA 5LOVA 1N33O 3QG5A 4IL6Z 2JGDA 1XREA 2IJHA 4P9PA 3U11A 1SZTA 2ODMA 4B3SB 1IURA 2ZKOA 1JFFB 3JSLA 3LDDA 1GO3F 1EM1A 1JOYA 4YIOA 3CRCA 2X6CA 1VF6A 3BFRA 3H1LH 5IT9N 1MZEA 4NYKA 4XDJA 2YIDA 2LGQA 2YXLA 1NTZH 3AG2B 4KUMA 4IIJB 1NVPD 3P3NA 2Q73A 2WWWA 2H8PC 2A3QA 1YIJV 4X1YA 4WFEA 1K92A 3ZIAG 1Q6UA 5B1NA 3OR7C 1ZL8A 4I55A 2E5LO 2QTOA 1EN4A 3FAVA 5B3SB 4ASUG 3HB3B 2G38A 1XHZA 3ZEDA 1WPXA 4LR3A 1K5QA 2YUAA 3ICXA 2XT9A 2WPDG 2P22C 3TK1A 4LFBB 4OGQB 3KG2A 4J11A 1Y74A 4G28B 3QTCA 5HFMA 3CMAV 4LFCB 3AK2A 1GTOA 2EIJB 2PTMA 3IGAC 3DXRA 1O9GA 1YJ9V 4FLVA 3K0GA 1L8DA 1FPOA 5EIBD 3JCUZ 1BHAA 3EVKA 4DK1A 3P30A 3E35A 4O4JB 4X89A 2OCCB 2ZNIA 1VEWA 2HKOA 2P5OA 1GAXA 1U97A 4ZI7B 1PKXA 5BMVB 1GN2A 2EINB 3JAWA 1ZWIC 1OJHA 3ZX6A 1SRYA 1BE3H 2R9AA 5L3DA 1QVFU 4PDLA 4X1KA 1F4NA 2HVJC 4LNUA 1I5XA 1P84F 1BS3A 1ROPA 1S76D 1CP9A 4MVOA 3DTUB 1GM9A 4UB8Z 2QEXV 2X6AA 1SETA 4JI6B 3ZN0A 3R66A 1WA8B 4WFBV 1MG1A 4NXNB 4I50A 2PGGA 4IGGA 3SPCA 2HEPA 5A2QN 3T1HO 2ETNA 3OGCC 1IDSA 2AW9A 2EILB 3CRAA 2N74A 2Q0OC 1AB3A 3ASNC 2BSKB 5CB4A 1WP8A 4ZOLA 3HKCB 3I56V 2UXBB 1XNQB 1HNWB 1PNKA 1VQKV 2L6LA 4GLXA 3K03A 1AJPA 4HNAA 1A32A 1US6A 3FKSG 4X88A 3AEIA 4J10A 5KHGA 4X66B 1G4YB 3CWBH 1Q86W 4R50A 2XAQA 3J81N 4YIPA 1OCRC 4MVRA 1FFXB 1QNMA 1JJ2U 4DV6B 1K8AW 5JJNB 5DM6V 3P3PA 2CGNA 2FMLA 3WG7B 4O4HA 3A8TA 4BR6A 4EEQA 3K5LA 2NNUA 1XHXA 2EZPA 5H9CA 3H1IH 2GTSA 1THZA 5CA0B 5B1BB 3OUSA 1EZJA 1W0KG 1H8EG 2Q7HA 1HNZB 4MS2A 3GVMA 2ZD9A 1OCZC 1BQ0A 5KHJA 3CHXA 3RVYA 3ABKB 4MTOA 5C8YB 1S3JA 3BRCA 4I5SA 1Z5WA 4JZGA 5CBFA 2PI4A 3L71H 2UXCB 4ZOLB 3OT7A 1GKFA 3BA8A 3BAAA 1WJZA 5B1AB 2PYJA 3U10A 3K57A 2QKAA 4BIUA 3L70H 2VS0A 1NR7A 1Q8IA 2JJ2G 4DV2B 4DR3O 1PL4A 3OEEG 3TGUH 2OWOA 1GH6A 2QJ1A 2QWOB 2IU3A 4I0XA 1PD3A 2EIMC 2E76B 3OTFA 3R65A 1V55B 2CUGA 4DR6O 1TGOA 1WPBA 1ZX3A 3WB2A 1SS3A 2QGNA 3T1YB 1D5NA 2Q8VA 1N34B 3LSSA 1VP7A 3CJHA 3N2KA 3SJCC 2ILMA 4AHCA 4NTXA 3DC6A 4Q20A 2QKCA 3JAWB 4FLTA 4O2AA 2HR3A 3MHHC 4DR2O 4U3JB 2LFSA 4C7UA 2BTQA 4MVUA 2YI8A 3T1YO 4X9QA 3CXHF 4Z1VA 1SA0B 4LP8A 2RNBA 3ZHTA 5AG2A 2VQEO 2QTSA 1XEQA 3KCYA 1XL6A 3DGEA 4GCZA 4GKKB 2RN9A 4O4IB 3BEHA 1JJOA 1FFTB 4P30A 4UXNA 1KUQA 1WB7A 3CCJV 3ABUA 4JI5O 2ZDIA 4JYAO 3ZRWA 4QPKA 2Z5UA 4LF4O 1OCZB 1LNQA 1IBKB 1JCHA 1FXKB 2A7WA 1N36B 1RFYA 3T2MA 4L87A 3FAVB 1V9PA 2YIBD 4J7JA 3SYOA 2QWQB 2H94A 3ASOC 3VQVA 1NQTA 1ZL8B 1S0VA 1H8HG 5DEDA 5HFLA 3RYHB 4B3SO 4DV0O 4J42A 2OIGA 3H1HH 4RUFA 1KC8W 4KP4A 5KA5A 1LUWA 1Q3EA 2H3OA 2K9PA 4YJ2B 4GKJB 3JALB 4LBEC 4PA4A 3RWRD 4F4LA 2AZ2A 2BCCH 5H6QA 1BCCH 4Z2WA 4JI4O 2Y4UA 3SYCA 3E83A 3QO5A 4CH4A 2LW1A 1PNLA 4YHHB 2WLIA 4MW3A 4K8XA 5J2TB 1AROP 1P4RA 3D3IA 4UCSA 3ZHRA 1SKVA 1M1KW 4PJ0Z 1GK9A 2ZIMA 1S5LZ 4TUYA 1NH2B 2QE7G 1ZLZA 1VQOV 1IXBA 4ZHQA 2WLMA 5EZYB 3T4ZA 1I0HA 1XQ8A 2AXTZ 5LYJA 3MDSA 5KAIZ 1SQVH 4MVZA 3UQ8A 1BL8A 5FLXN 2JIZG 1HNZO 4LH6A 3RFRA 1B6QA 1XL4A 1IBLO 3ZN1A 3IAYA 3KKYA 4FJCC 3HPLC 1N33B 4PA9A 2E74B 2OCCC 3W7WA 5BR8B 4DR5O 1PM9A 3ML0A 4H37A 3OD4A 3B8NA 2P6JA 4DR7B 5CA0A 4KHPB 2Q5ZA 1BQZA 1J95A 5JVDA 2RJZA 1K4DC 3TXSA 3K9AA 3OTOB 3VQYA 2CGOA 2EIJC 4FFBB 4KXRA 1IBLB 1MA1A 4JYYA 1YXBA 3P32A 3JSNA 3JYCA 4G2KA 2GSMB 2UXDB 2A79B 2Z3YA 4HZ3A 4RQEA 1V54C 2QM8A 4JI7O 1N32O 3Q4HB 2DQ3A 4D7SA 3RYCA 3ABMB 4LH7A 2Q6AA 4PA3A 1YJNV 3FB5C 3WB0A 5LP6B 2JK5C 2Q0AA 4O4IA 4PV1B 4ZIBA 4J80A 2P4KA 4R7CA 2M7WA 1B3QA 1SF9A 3CS5A 4JI4B 1B06A 3ZMTA 3AK3A 3UM7A 3F5TA 2CK3G 5TISZ 3JD0A 1VQ7V 4RQFA 4GX5A 1OZ0A 3CRQA 1XI1A 2UXXA 1FYJA 3E8BA 4FLUA 1ENVA 4QJFB 1W2BU 5KMGB 3SJQC 3APOA 2RQ6A 1Q6IA 2BTQB 5CBGA 4X66O 4OX9O 5KX5B 3OAAG 3E8HA 3LDEA 5D5QA 1OHHG 1L1FA 5KHIA 1NTKH 2YIBA 3F7VC 3AK1A 1Y66A 2LJ2A 4X8AA 1VF6C 2YS8A 4E2LA 4UCRA 1S72V 5LHGA 1YCIA 4DV3B 2XUMA 3K79A 3ABLC 3DSQA 4JI8O 1KECA 3RBZA 1H2KA 4FIPC 2YSUB 5KHHA 3S3XA 3A0RA 2IH1C 3K9SA 1MZFA 5IYCO 3DXRB 4W4LA 2HJFC 2Q67A 3UO2A 2D3OW 3ZJZA 3ABKC 2BOCC 1SESA 4W4KA 2KG7A 4LC1A 1RM1C 3BA9A 1XDCA 1OCCB 3M8AA 3H9VA 4NTWA 4U7NA 1FAFA 3CCLV 2WA3A 3ZHSA 4RWUA 2RMKB 3K58A 3D36A 1R1BA 5B1BC 1LR1A 4PA7A 4UV9A 4DR3B 2JS3A 4NR1A 5FNVA 4MVQA 4JYCA 1YJWV 1SQXH 2E5LB 3OR6C 3RW0A 4AQYO 1TA8A 2FYUH 1KD1W 2ZDIC 1H2SB 2GV9A 5K1XA 1P49A 1M9NA 1OV9A 2RCVA 1OCRB 4FMTA 4WFAV 4X62O 5IY5C 1TUBA 3CXCU 1IBKO 4NTYA 4ZBMA 5ITZA 1XMOO 2Q9LA 5GONA 2QM4A 1VIBA 3K04A 3I5DA 1SQBH 1M5IA 1AI6A 1D2DA 2EIKB 4FM0A 2Q7GA 5LA6B 4FFBA 1MMMA 4DRXA 3BPZA 1X4TA 1KKCA 3TETA 5LOVB 1H2LA 2R72A 5D5PA 5BXZA 2D2CB 4J41A 3U0ZA 3N2GA 4X65O 4TUYB 2Y69C 4YY3B 5FPOA 4BIOA 4FZ1A 1N8RW 2ZT9B 3JATB 2OIEA 4LCUC 2VWKA 5L3GA 3VQXA 2JRIA 4DV4O 4X1IB 1ZSPA 4CS3A 1EBOA 4I4TB 2WLIB 1IX9A 1YF2A 5GTIZ 4WBNA 2PI5A 5LYJB 4UVBA 1I08A 4GX0A 4YHHO 1D5AA 2YDEA 5F2VO 4LNUB 3E8GA 2PZSA 2N05A 3J7AU 3JASB 3K08A 3ABMC 1GMGA 2XNDG 1VQPV 2PF4E 3JATA 1HR0O 2QM7A 2K1EA 3K5OA 3L75H 2IBZH 2ARHA 2ZE8A 2DWEC 2AHYA 4H0LB 1QVGU 1I94O 1MSWD 4FM1A 1XMQO 4NXMO 4DR4O 4RAIA 4JAUA 1PP9H 1HR0B 3FB8C 2CTRA 4YXWG 3SPHA 2UUBO 1M93A 2LGWA 4ICGA 1IXMA 2EULA 2DYSB 2FKXA 3RGBA 1JR9A 1VQ8V 1TUEB 3EHBB 3JD3A 1R3JC 2ZIOA 1MABG 1M57B 3ZRWB 4DV1B 4DR4B 2HLDG 1N0NA 4WF9V 2OTLV 1PV0A 3W7XA 3FB7C 1S77D 2HVKC 3ETDA 1BSMA 4L8JA 5L3FA 4UCUA 4UB6Z 3E89A 3CD6V 4R6ZA 4XBFA 4G27B 5FNVB 4JYAB 4B3RB 3B77A 2Y4TA 2L35A 3I55V 2Q4PA 4X1YB 3WB1A 5JH7A 3KCXA 3A0HZ 5KA6A 2WLNA 4JI1B 5LBQA 1MSDA 2UU9O 2UUCO 3G80A 4MW8A 4MVSA 4CBCA 2FTKA 1EN6A 5L3CA 2F95B 5CMUA 2F43G 3JD1A 3VQWA 1VQ6V 1JFFA 1QLEC 3JCZA 2JGDB 3CE2A 1P7BA 4YJ3A 2B9ZA 1HNXB 2O57A 1H2MA 1Q6HA 4JI1O 2R9IA 4PELA 4PDRA 5IWAB 3BY6A 3CC2V 1Z2GA 4EFEA 2P7TC 1UJWB 2XAFA 1G1XB 2MW2B 3H1KH 4AQYB 3CRMA 1NKDA 2HHHO 3F7YC 4DR7O 1WNSA 3ABLB 1YDXA 2Y48A 4BWAA 5LHIA 3STLC 4B3MO 1PPJH 2X6BA 2JEUA 2QWPB 4FFKA 2A9HA 2EJ7A 4JI3B 3QO8A 4LF8B 1N0JA 4CC5A 2EBOA 2HP8A 4U7OA 3SJBC 1R3LC 5C8YA 4X1IA 4JPRA 5EBMC 1IBMB 3X2QB 4B3TB 4PA6A 2XHBA 2F1MA 2RDCA 4XDKA 1YI2V 2QKSA 2ZE7A 4IT5A 4JI2B 3THOA 3B09A 3LSQA 3E8FA 4WFFA 5LMUB 1VQNV 3GB7C 1WAZA 3RN4A 5EYPB 1I7FA 4KFMA 1HDJA 3NR7A 3W7SA 5KAFZ 1X59A 1FXVA 4O4HB 2R9RB 1NR1A 1G6UA 4LF4B 5IJ0B 3BVOA 3RYCB 2QWRB 1Y76A 4TWKA 1F7YA 4K0KO 2X0LA 3MAQA 3L72H 5BY1A 4K8ZA 4B3RO 4TQDA 2KQXA 4KHPO 1M4UA 3K3WA 1ORQC 1Y76B 1KU9A 1VQ4V 4HNAB 4MTFA 2QWNB 4PDVA 2GUZB 1FJGB 5CB4B 1RSOB 5EC2C 4EKWA 2ZE6A 2EIMB 2P06A 2B5UA 1M56B 1NH2D 3OFNG 4DV7O 2HG5C 3FYIB 5EK0A 4HYOA 2KKWA 4UCTA 2CTPA 5LGUA 1FFXA 1H2GA 1VQMV 1E1RG 3RYFB 4NKGB 1WA8A 3MHSC 4PHZA 1PNMA 4N23A 1G8MA 3EXAA 4FPPA 5LXTB 4DV3O 1Q5OA 3CRRA 2XAJA 2ZM6O 1DLBA 1K5SA 4CS2A 1JMKC 1KB9F 3VOUA 3HR0A 4DR2B 2IJKA 4JF3A 2BSKA 4X65B 4K3AA 2VQFO 3WFVA 2W0XA 1QU7A 1VF7A 3CCQV 1IVSA 1ZUQA 3UO3A 4B7EA 4NVPA 3SYAA 2DN9A 1Q7YW 3JD2A 2UUAO 1K7DA 5B5EZ 4FVMA 3L74H 3ZMZA 3CB2A 1YEWA 5BZBA 1AI4A 2PYLA 2YI9A 2P67A 2HFEC 2Q69A 3N27A 4PI0A 3G67A 1VQ5V 2VRZA 2P4VA 2ZNJA 2QDOA 4FZ0A 3SGIA 5L3BA 1YTFB 2V1DA 2ITCC 3JALA 3S3WA 1N32B 3D3QA 3QO7A 4QE7A 3FD9A 3G6BA 4CS4A 5BMVA 1AP5A 1Y74B 4LFCO 3LNMB 5A9GA 5H2FZ 5JH7B 1DGSA 2F4VO 5KMGA 4O4JA 4NB5A 2IM9A 3TXQA 5CN0A 4DV4B 1DF5A 4A5UB 1JA8A 3ZHVA 2B1GA 3ASNB 3OMIB 3K5MA 4QGPA 5IY5B 2DW4A 1SQQH 1R6NA 3EFFK 3SPJA 4DR6B 1OCOB 1FJGO 5J9PC 2QSAA 3O9OA 3O65A 4JV5B 1SQPH 4X64O 1GM7A 2UXCO 1NS1A 1QBZA 1VARA 4FLYA 2C2AA 2ZQMA 1RM1B 2OYQA 3SYPA 4GX2A 4X62B 2ZE5A 4NXNO 3DC5A 3HKDB 4TV8B 3FFQA 2DYRC 1R3IC 3B40A 1SZXA 3M7MX 2LO1A 5LL6Y 4NXMB 4B7KA 4IIJA 3UCSC 1VQLV 4FLZA 5JVDB 4Z1MG 4QNHB 1XBLA 5J2UB 4B3TO 1YITV 2YXYA 1XUQA 4X20B 1YZBA 2LW7A 3E22B 1N34O 1ZTEA 3BCCH 3JARA 5DECA 4JI0O 1T5EA 5E1AC 2LQTA 4TV9B 5IYZB 4CZZA 2YXHA 2Z0AA 4ABMA 4BIZA 4GZRB 3JASA 1SERA 5JJEB 1Q43A 2YEVA 4O2BA 3VBBA 5B66Z 4WFGA 4XDLA 2R70A 4LF5B 4FK5C 2XAHA 4IYIA 2LP7A 4I4TA 5E79Z 2DYSC 1LUVA 2ZCEA 1NU1H 4E4EA 3T1CA 2JS5A 4H33A 1K97A 4LF9O 5FL7G 5IE9A 2N04A 4DYLA 5B3SC 1GN6A 3OEHG 4JAAA 5J2TA 3JD4A 3N2GB 3WU2Z 3CCMV 3T4DA 1QCEA 2IU0A 3ZHQA 1H2NA 1QLNA 1HWYA 4N21A 3PJSK 4JAVA 1NVPB 4DRXB 5IDJA 5LXTA 5LA6A 1YSCA 2WLLA 1MOFA 1IBMO 5CBHA 4LF9B 1KKDA 3OMNB 1RPOA 4TSFG 3TCUA 4DR5B 4YJ2A 2DYRB 4RUEA 2M6YA 2UXNA 5GONB 2OTJV 4LF7O 4F6RB 3AG1C 2Y0IA 1CPYA 2VQEB 4DUYB 3A2FA 4HAMA 1RSOA 4IHJB 2GUZA 4H13B 2VQFB 2Y0PA 5JJJB 3RYHA 2BOBC 3H1JH 3B4SA 3SYQA 3BABA 2GBOA 1CXZB 2B1IA 1AR1B 1NI8A 1F23A 1JVMA 4JI7B 2CTQA 3WG7C 4DV1O 2ATKC 3E86A 4AILC 1AI7A 1YVWA 3QF7A 4EB6B 3C3SA 2IW5A 5EYPA 3CPWU 4JYBA 2KG7B 3F5WC 3LUTB 5DN6G 2JEXA 2P90A 3RYIB 4QPJA 4J9ZB 1UFIA 2F93B 2YC0A 2DOSA 4FLXA 5H5NA 5CA1B 2NN4A 2EILC 5LHHA 3K5NA 4LFAO 3IJ4A 3ZCCA 1KYOF 2YEVB 4GX1A 2ZXWC 2UUAB 4DV5O 1JPXA 4GKJO 4U3JA 4UUJC 3CEIA 4RO2A 5JQGA 4O2AB 3LDCA 3HKEA 2X7RB 3HKEB 4X20A 1K33A 5KX5A 1E79G 4ZI7A 2GDSA 4UV8A 5KHKA 4GYCB 2E75B 2QA4V 4BAYA 3FYEB 1MNGA 4JGSA 4MTXA 3OM3B 1OCCC 3ZMUA 4I0XB 3HKDA 1EFRG 4TV8A 1F4MA 4YJ3B 5H6RA 3B8MA 2EINC 3MD0A 4CH3A 4K35A 5IYDO 4J7KA 1AILA 2WA4A 2IJJA 4I7ZB 1VMGA 4OX9B 4JI6O 4DUYO 3RYIA 2V4DA 2GHYA 4DK0A 5GW7A 1NBMG 3ASOB 4CH6A 1WLEA 5EBLC 4GKKO 4LF5O 1Q90D 5LP6A 1XNRB 3QNEA 1BHBA 1FD9A 3RT3C 2JGUA 1AJQA 3AG4B 4EB6A 4TOIA 4UFZA 1HP8A 4P2ZA 4P9OA 4WFHA 5EC1C 1FS0G 3BHPA 3AG3C 3Q4HA 3FB6C 3CYOA 4DXWA 1W59A 3LSUA 4DO2A 2W6JG 2CDYA 2WLKA 1Y6XA 3ZBHA 4JI2O 3RVZA 3UT5A 3AG1B 2CH7B 1J5EO 1GN4A 1NTMH 4I55B 4PDMA 1P7GA 3ETGA 2QR4A 1AI5A 2AHZA 2V7QG 1L0NH 4DW0A 3K06A 4BW5A 1R6TA 2A0LA 3A0BZ 3ETEA 4D7TA 5IYBO 3OMAB 1WB8A 2EZOA 4AI8A 1HW7A 5LGNA 1TVKA 2W6IG 2XOKG 1XOUA 2YIAA 3TJTA 1NT2B 5LP6C 1R6KA 5EIBC 1GRJA 4JTCB 1WP7A 3JAMN 1XILA 2Y69B 3C3TA 4CH5A 3JAKB 4I9WA 3PN1A 3SR2C 5LGTA 3X2QC 1V54B 4D6TH 1V55C 4LWSB 4R8CA 4DV0B 2DWDC 3G4SV 1VQ9V 2DQ0A 4PD4F 4I50B 3CCRV 4JZ2A 1SQFA 1J5EB 3T1HB 2ZINA 5CA3A 4OXSA 1I5YA 3AG4C 3STZC 3KZIZ 3ZRVA 2BTOA 5B1AC 1FXHA 1JQ0A 1S5HC 4LFBO 3ZMVA 1AJNA 3H01A 2DJVA 4QE9A 5IYZA 5KUKA 4UCVA 4UCOA 1UPGA 3E22A 4MTGA 2OT5A 1Y4MA 2XASA 4LWSA 5J2UA 4JTAB 5EBWC 1BMFG 1KP2A 1B04A 3B2EE 1XNRO 3M99B 2GTAA 1QLEB 1U96A 3OE7G 5GTHZ 5KUMA 3IC9A 3JAKA 1K3EA 3IFXA 2FB5A 5K1PA 2CH7A 3C90A 1EZVH 3UT5B 1R73A 2ZR3A 1KQSU 3CP1A 1TVKB 1GM8A 1YTFD 4DUZB 1VF5B 1SC5B 5JWPA 1DTOA 2F4VB 1FXKA 1Z5VA 2CE4A 4EFBA 5ITZB 1JX9A 5LMNB 4I9QA 1CEZA 1TUBB 3ZRSA 4F6EA 3CCSV 1E1QG 4JI5B 1N36O 3OGIB 2A06H 3CMEV 3QVNA 4MVMA 4X64B 5IJ9B 5B1OA 4LF6O 1M90W 1M57C 1KP3A 4DV2O 3L9DA 4JV5O 1SA0A 3G6EV 3G71V 4MSWC 1AR5A 2VWJA 4DV6O 1COWG 3ZRXA 4B3MB 1KMIZ 4PI2A 1PL0A 3SPGA 1XNQO 2HHHB 3CCUV 1URFA 3ZS8C 4J9YB 1RP3B 4JASA 3L73H 3CCVV 1QHTA 2PY5A 1N4CA 2UXBO 1Y67A 3AG7A 4CC6A 3ZHUA 3CJHB 3N2KB 5JQGB 2ADPA 5IWAO 4DR1B 4QIWF 3CSXA 2AGAA 2NR5A 4BW9A 1Q82W 1HNXO 3OUFA 3CC7V 2ZR2A 4TQFA 4DV7B 4Q6GA 5LMUO 4TT3G 4B08A 5CA1A 1NZ6A 2Q7EA 1I94B 3HKBB 3OTOO 3E2EA 1R3KC 3D36C 2UU9B 1GN3A 4MT8A 1WN7A 2CTWA 1QQCA 1DF4A 2IH3C 2OCHA 2EX3A 1K73W 4U3FH 4GT1A 1XMQB 4K0KB 1L0LH 3D8CA 2JDIG 3AG3B 1BGYH 2DMXA 3CC4V 3K0DA 2XAGA 1M56C 4O4LA 2AZ0A 3UKMA 1K34A 1W0JG 4WCEV 3NXSA 4IYHA 3RYFA 5IJ9A 1K9MW 2LFRA 3IC7A 4OPAA 2Q68A 1HNWO 4GUNA 2XTAA 2WLJA 5JCOC 4DUZO 2DE0X 3GWKC 2E3CA 1S5JA 2UUBB 2KB1A 3FX7A 5L3EA 2EIKC 2F23A 1DK1A 4KL1A 3SPIA 2YICA 1QR9A 1AR4A 2BE3A 1TAEA 1AVMA 1BT8A 1F51A 4UVAA 4JI3O 2PUSA 4LF8O 4H44B 2UUCB 4LF7B 3AG2C 5KLVH 3SDLA 2F66C 4FM2A 2HJDA 1YHQV 5IJ0A 1IZ3A 3ZMSA 4DW1A 3HKCA 2ZXWB 4IHJA 4FLWA 3APQA 3CX5F 4HBNA 5BR8O 3GWOA 4JI0B 3ETQA 2NLJC 4F6RA 1RPRA 3ABTA 4JI8B 2ZM6B 1H38A 1AP6A 5C93A 2KSDA 2ADQB 2WAMA 4OPHA 5JCOA 1XMOB 4ZKIA 5LMNO 4DR1O 2UXDO 2WLLB 4YY3O 1EN5A 1K4CC 2W0FC 4O4LB 1QR8A 4JTDB 3LNNA 4O2BB 1SQGA 4WBNB 3K59A 1OCOC 1Q81W 5EZYA 2MK3A 3J80N 4J7ZA 2EJRA 2ITDC 4ZHQB 3W7TA 2WSSG 4X1KB 3CCEV 2JVDA 4TV9A 3W7UA
chains in the Genus database with same CATH topology
2GUZA 2QWNB 2DN9A 3AG7A 2L6LA 2Y4TA 1IURA 1FPOA 2PF4E 2CTWA 2GUZB 3BVOA 2CTRA 1GH6A 2QWOB 2N04A 2QWRB 3UO2A 2OCHA 3APQA 2Y4UA 2LGWA 2LO1A 2QWPB 2YS8A 4RWUA 3APOA 3UCSC 2EJ7A 4IT5A 1WJZA 2M6YA 1XBLA 2CUGA 2KQXA 4J80A 2CTPA 1BQZA 2DMXA 1NZ6A 4J7ZA 1FAFA 1BQ0A 1HDJA 2QWQB 2QSAA 2N05A 2CTQA 1N4CA 2YUAA 3UO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUZ A;  2QWN B;  2DN9 A;  3AG7 A;  2L6L A;  2Y4T A;  1IUR A;  1FPO A;  2PF4 E;  2CTW A;  2GUZ B;  3BVO A;  2CTR A;  1GH6 A;  2QWO B;  2N04 A;  2QWR B;  3UO2 A;  2OCH A;  3APQ A;  2Y4U A;  2LGW A;  2LO1 A;  2QWP B;  2YS8 A;  4RWU A;  3APO A;  3UCS C;  2EJ7 A;  4IT5 A;  1WJZ A;  2M6Y A;  1XBL A;  2CUG A;  2KQX A;  4J80 A;  2CTP A;  1BQZ A;  2DMX A;  1NZ6 A;  4J7Z A;  1FAF A;  1BQ0 A;  1HDJ A;  2QWQ B;  2QSA A;  2N05 A;  2CTQ A;  1N4C A;  2YUA A;  3UO3 A; 
#chains in the Genus database with same CATH topology
 1KBH A;  3JAR B;  4UVC A;  3SJA C;  5FPR A;  4DV5 B;  1ZAU A;  2IJI A;  2JJ1 G;  1FKA O;  1NJI W;  3HKB A;  4LF6 B;  4LFA B;  1BZK A;  2CAZ C;  3OW2 U;  2WLH A;  1FXK C;  2FL4 A;  1O9H A;  5LOV A;  1N33 O;  3QG5 A;  4IL6 Z;  2JGD A;  1XRE A;  2IJH A;  4P9P A;  3U11 A;  1SZT A;  2ODM A;  4B3S B;  1IUR A;  2ZKO A;  1JFF B;  3JSL A;  3LDD A;  1GO3 F;  1EM1 A;  1JOY A;  4YIO A;  3CRC A;  2X6C A;  1VF6 A;  3BFR A;  3H1L H;  5IT9 N;  1MZE A;  4NYK A;  4XDJ A;  2YID A;  2LGQ A;  2YXL A;  1NTZ H;  3AG2 B;  4KUM A;  4IIJ B;  1NVP D;  3P3N A;  2Q73 A;  2WWW A;  2H8P C;  2A3Q A;  1YIJ V;  4X1Y A;  4WFE A;  1K92 A;  3ZIA G;  1Q6U A;  5B1N A;  3OR7 C;  1ZL8 A;  4I55 A;  2E5L O;  2QTO A;  1EN4 A;  3FAV A;  5B3S B;  4ASU G;  3HB3 B;  2G38 A;  1XHZ A;  3ZED A;  1WPX A;  4LR3 A;  1K5Q A;  2YUA A;  3ICX A;  2XT9 A;  2WPD G;  2P22 C;  3TK1 A;  4LFB B;  4OGQ B;  3KG2 A;  4J11 A;  1Y74 A;  4G28 B;  3QTC A;  5HFM A;  3CMA V;  4LFC B;  3AK2 A;  1GTO A;  2EIJ B;  2PTM A;  3IGA C;  3DXR A;  1O9G A;  1YJ9 V;  4FLV A;  3K0G A;  1L8D A;  1FPO A;  5EIB D;  3JCU Z;  1BHA A;  3EVK A;  4DK1 A;  3P30 A;  3E35 A;  4O4J B;  4X89 A;  2OCC B;  2ZNI A;  1VEW A;  2HKO A;  2P5O A;  1GAX A;  1U97 A;  4ZI7 B;  1PKX A;  5BMV B;  1GN2 A;  2EIN B;  3JAW A;  1ZWI C;  1OJH A;  3ZX6 A;  1SRY A;  1BE3 H;  2R9A A;  5L3D A;  1QVF U;  4PDL A;  4X1K A;  1F4N A;  2HVJ C;  4LNU A;  1I5X A;  1P84 F;  1BS3 A;  1ROP A;  1S76 D;  1CP9 A;  4MVO A;  3DTU B;  1GM9 A;  4UB8 Z;  2QEX V;  2X6A A;  1SET A;  4JI6 B;  3ZN0 A;  3R66 A;  1WA8 B;  4WFB V;  1MG1 A;  4NXN B;  4I50 A;  2PGG A;  4IGG A;  3SPC A;  2HEP A;  5A2Q N;  3T1H O;  2ETN A;  3OGC C;  1IDS A;  2AW9 A;  2EIL B;  3CRA A;  2N74 A;  2Q0O C;  1AB3 A;  3ASN C;  2BSK B;  5CB4 A;  1WP8 A;  4ZOL A;  3HKC B;  3I56 V;  2UXB B;  1XNQ B;  1HNW B;  1PNK A;  1VQK V;  2L6L A;  4GLX A;  3K03 A;  1AJP A;  4HNA A;  1A32 A;  1US6 A;  3FKS G;  4X88 A;  3AEI A;  4J10 A;  5KHG A;  4X66 B;  1G4Y B;  3CWB H;  1Q86 W;  4R50 A;  2XAQ A;  3J81 N;  4YIP A;  1OCR C;  4MVR A;  1FFX B;  1QNM A;  1JJ2 U;  4DV6 B;  1K8A W;  5JJN B;  5DM6 V;  3P3P A;  2CGN A;  2FML A;  3WG7 B;  4O4H A;  3A8T A;  4BR6 A;  4EEQ A;  3K5L A;  2NNU A;  1XHX A;  2EZP A;  5H9C A;  3H1I H;  2GTS A;  1THZ A;  5CA0 B;  5B1B B;  3OUS A;  1EZJ A;  1W0K G;  1H8E G;  2Q7H A;  1HNZ B;  4MS2 A;  3GVM A;  2ZD9 A;  1OCZ C;  1BQ0 A;  5KHJ A;  3CHX A;  3RVY A;  3ABK B;  4MTO A;  5C8Y B;  1S3J A;  3BRC A;  4I5S A;  1Z5W A;  4JZG A;  5CBF A;  2PI4 A;  3L71 H;  2UXC B;  4ZOL B;  3OT7 A;  1GKF A;  3BA8 A;  3BAA A;  1WJZ A;  5B1A B;  2PYJ A;  3U10 A;  3K57 A;  2QKA A;  4BIU A;  3L70 H;  2VS0 A;  1NR7 A;  1Q8I A;  2JJ2 G;  4DV2 B;  4DR3 O;  1PL4 A;  3OEE G;  3TGU H;  2OWO A;  1GH6 A;  2QJ1 A;  2QWO B;  2IU3 A;  4I0X A;  1PD3 A;  2EIM C;  2E76 B;  3OTF A;  3R65 A;  1V55 B;  2CUG A;  4DR6 O;  1TGO A;  1WPB A;  1ZX3 A;  3WB2 A;  1SS3 A;  2QGN A;  3T1Y B;  1D5N A;  2Q8V A;  1N34 B;  3LSS A;  1VP7 A;  3CJH A;  3N2K A;  3SJC C;  2ILM A;  4AHC A;  4NTX A;  3DC6 A;  4Q20 A;  2QKC A;  3JAW B;  4FLT A;  4O2A A;  2HR3 A;  3MHH C;  4DR2 O;  4U3J B;  2LFS A;  4C7U A;  2BTQ A;  4MVU A;  2YI8 A;  3T1Y O;  4X9Q A;  3CXH F;  4Z1V A;  1SA0 B;  4LP8 A;  2RNB A;  3ZHT A;  5AG2 A;  2VQE O;  2QTS A;  1XEQ A;  3KCY A;  1XL6 A;  3DGE A;  4GCZ A;  4GKK B;  2RN9 A;  4O4I B;  3BEH A;  1JJO A;  1FFT B;  4P30 A;  4UXN A;  1KUQ A;  1WB7 A;  3CCJ V;  3ABU A;  4JI5 O;  2ZDI A;  4JYA O;  3ZRW A;  4QPK A;  2Z5U A;  4LF4 O;  1OCZ B;  1LNQ A;  1IBK B;  1JCH A;  1FXK B;  2A7W A;  1N36 B;  1RFY A;  3T2M A;  4L87 A;  3FAV B;  1V9P A;  2YIB D;  4J7J A;  3SYO A;  2QWQ B;  2H94 A;  3ASO C;  3VQV A;  1NQT A;  1ZL8 B;  1S0V A;  1H8H G;  5DED A;  5HFL A;  3RYH B;  4B3S O;  4DV0 O;  4J42 A;  2OIG A;  3H1H H;  4RUF A;  1KC8 W;  4KP4 A;  5KA5 A;  1LUW A;  1Q3E A;  2H3O A;  2K9P A;  4YJ2 B;  4GKJ B;  3JAL B;  4LBE C;  4PA4 A;  3RWR D;  4F4L A;  2AZ2 A;  2BCC H;  5H6Q A;  1BCC H;  4Z2W A;  4JI4 O;  2Y4U A;  3SYC A;  3E83 A;  3QO5 A;  4CH4 A;  2LW1 A;  1PNL A;  4YHH B;  2WLI A;  4MW3 A;  4K8X A;  5J2T B;  1ARO P;  1P4R A;  3D3I A;  4UCS A;  3ZHR A;  1SKV A;  1M1K W;  4PJ0 Z;  1GK9 A;  2ZIM A;  1S5L Z;  4TUY A;  1NH2 B;  2QE7 G;  1ZLZ A;  1VQO V;  1IXB A;  4ZHQ A;  2WLM A;  5EZY B;  3T4Z A;  1I0H A;  1XQ8 A;  2AXT Z;  5LYJ A;  3MDS A;  5KAI Z;  1SQV H;  4MVZ A;  3UQ8 A;  1BL8 A;  5FLX N;  2JIZ G;  1HNZ O;  4LH6 A;  3RFR A;  1B6Q A;  1XL4 A;  1IBL O;  3ZN1 A;  3IAY A;  3KKY A;  4FJC C;  3HPL C;  1N33 B;  4PA9 A;  2E74 B;  2OCC C;  3W7W A;  5BR8 B;  4DR5 O;  1PM9 A;  3ML0 A;  4H37 A;  3OD4 A;  3B8N A;  2P6J A;  4DR7 B;  5CA0 A;  4KHP B;  2Q5Z A;  1BQZ A;  1J95 A;  5JVD A;  2RJZ A;  1K4D C;  3TXS A;  3K9A A;  3OTO B;  3VQY A;  2CGO A;  2EIJ C;  4FFB B;  4KXR A;  1IBL B;  1MA1 A;  4JYY A;  1YXB A;  3P32 A;  3JSN A;  3JYC A;  4G2K A;  2GSM B;  2UXD B;  2A79 B;  2Z3Y A;  4HZ3 A;  4RQE A;  1V54 C;  2QM8 A;  4JI7 O;  1N32 O;  3Q4H B;  2DQ3 A;  4D7S A;  3RYC A;  3ABM B;  4LH7 A;  2Q6A A;  4PA3 A;  1YJN V;  3FB5 C;  3WB0 A;  5LP6 B;  2JK5 C;  2Q0A A;  4O4I A;  4PV1 B;  4ZIB A;  4J80 A;  2P4K A;  4R7C A;  2M7W A;  1B3Q A;  1SF9 A;  3CS5 A;  4JI4 B;  1B06 A;  3ZMT A;  3AK3 A;  3UM7 A;  3F5T A;  2CK3 G;  5TIS Z;  3JD0 A;  1VQ7 V;  4RQF A;  4GX5 A;  1OZ0 A;  3CRQ A;  1XI1 A;  2UXX A;  1FYJ A;  3E8B A;  4FLU A;  1ENV A;  4QJF B;  1W2B U;  5KMG B;  3SJQ C;  3APO A;  2RQ6 A;  1Q6I A;  2BTQ B;  5CBG A;  4X66 O;  4OX9 O;  5KX5 B;  3OAA G;  3E8H A;  3LDE A;  5D5Q A;  1OHH G;  1L1F A;  5KHI A;  1NTK H;  2YIB A;  3F7V C;  3AK1 A;  1Y66 A;  2LJ2 A;  4X8A A;  1VF6 C;  2YS8 A;  4E2L A;  4UCR A;  1S72 V;  5LHG A;  1YCI A;  4DV3 B;  2XUM A;  3K79 A;  3ABL C;  3DSQ A;  4JI8 O;  1KEC A;  3RBZ A;  1H2K A;  4FIP C;  2YSU B;  5KHH A;  3S3X A;  3A0R A;  2IH1 C;  3K9S A;  1MZF A;  5IYC O;  3DXR B;  4W4L A;  2HJF C;  2Q67 A;  3UO2 A;  2D3O W;  3ZJZ A;  3ABK C;  2BOC C;  1SES A;  4W4K A;  2KG7 A;  4LC1 A;  1RM1 C;  3BA9 A;  1XDC A;  1OCC B;  3M8A A;  3H9V A;  4NTW A;  4U7N A;  1FAF A;  3CCL V;  2WA3 A;  3ZHS A;  4RWU A;  2RMK B;  3K58 A;  3D36 A;  1R1B A;  5B1B C;  1LR1 A;  4PA7 A;  4UV9 A;  4DR3 B;  2JS3 A;  4NR1 A;  5FNV A;  4MVQ A;  4JYC A;  1YJW V;  1SQX H;  2E5L B;  3OR6 C;  3RW0 A;  4AQY O;  1TA8 A;  2FYU H;  1KD1 W;  2ZDI C;  1H2S B;  2GV9 A;  5K1X A;  1P49 A;  1M9N A;  1OV9 A;  2RCV A;  1OCR B;  4FMT A;  4WFA V;  4X62 O;  5IY5 C;  1TUB A;  3CXC U;  1IBK O;  4NTY A;  4ZBM A;  5ITZ A;  1XMO O;  2Q9L A;  5GON A;  2QM4 A;  1VIB A;  3K04 A;  3I5D A;  1SQB H;  1M5I A;  1AI6 A;  1D2D A;  2EIK B;  4FM0 A;  2Q7G A;  5LA6 B;  4FFB A;  1MMM A;  4DRX A;  3BPZ A;  1X4T A;  1KKC A;  3TET A;  5LOV B;  1H2L A;  2R72 A;  5D5P A;  5BXZ A;  2D2C B;  4J41 A;  3U0Z A;  3N2G A;  4X65 O;  4TUY B;  2Y69 C;  4YY3 B;  5FPO A;  4BIO A;  4FZ1 A;  1N8R W;  2ZT9 B;  3JAT B;  2OIE A;  4LCU C;  2VWK A;  5L3G A;  3VQX A;  2JRI A;  4DV4 O;  4X1I B;  1ZSP A;  4CS3 A;  1EBO A;  4I4T B;  2WLI B;  1IX9 A;  1YF2 A;  5GTI Z;  4WBN A;  2PI5 A;  5LYJ B;  4UVB A;  1I08 A;  4GX0 A;  4YHH O;  1D5A A;  2YDE A;  5F2V O;  4LNU B;  3E8G A;  2PZS A;  2N05 A;  3J7A U;  3JAS B;  3K08 A;  3ABM C;  1GMG A;  2XND G;  1VQP V;  2PF4 E;  3JAT A;  1HR0 O;  2QM7 A;  2K1E A;  3K5O A;  3L75 H;  2IBZ H;  2ARH A;  2ZE8 A;  2DWE C;  2AHY A;  4H0L B;  1QVG U;  1I94 O;  1MSW D;  4FM1 A;  1XMQ O;  4NXM O;  4DR4 O;  4RAI A;  4JAU A;  1PP9 H;  1HR0 B;  3FB8 C;  2CTR A;  4YXW G;  3SPH A;  2UUB O;  1M93 A;  2LGW A;  4ICG A;  1IXM A;  2EUL A;  2DYS B;  2FKX A;  3RGB A;  1JR9 A;  1VQ8 V;  1TUE B;  3EHB B;  3JD3 A;  1R3J C;  2ZIO A;  1MAB G;  1M57 B;  3ZRW B;  4DV1 B;  4DR4 B;  2HLD G;  1N0N A;  4WF9 V;  2OTL V;  1PV0 A;  3W7X A;  3FB7 C;  1S77 D;  2HVK C;  3ETD A;  1BSM A;  4L8J A;  5L3F A;  4UCU A;  4UB6 Z;  3E89 A;  3CD6 V;  4R6Z A;  4XBF A;  4G27 B;  5FNV B;  4JYA B;  4B3R B;  3B77 A;  2Y4T A;  2L35 A;  3I55 V;  2Q4P A;  4X1Y B;  3WB1 A;  5JH7 A;  3KCX A;  3A0H Z;  5KA6 A;  2WLN A;  4JI1 B;  5LBQ A;  1MSD A;  2UU9 O;  2UUC O;  3G80 A;  4MW8 A;  4MVS A;  4CBC A;  2FTK A;  1EN6 A;  5L3C A;  2F95 B;  5CMU A;  2F43 G;  3JD1 A;  3VQW A;  1VQ6 V;  1JFF A;  1QLE C;  3JCZ A;  2JGD B;  3CE2 A;  1P7B A;  4YJ3 A;  2B9Z A;  1HNX B;  2O57 A;  1H2M A;  1Q6H A;  4JI1 O;  2R9I A;  4PEL A;  4PDR A;  5IWA B;  3BY6 A;  3CC2 V;  1Z2G A;  4EFE A;  2P7T C;  1UJW B;  2XAF A;  1G1X B;  2MW2 B;  3H1K H;  4AQY B;  3CRM A;  1NKD A;  2HHH O;  3F7Y C;  4DR7 O;  1WNS A;  3ABL B;  1YDX A;  2Y48 A;  4BWA A;  5LHI A;  3STL C;  4B3M O;  1PPJ H;  2X6B A;  2JEU A;  2QWP B;  4FFK A;  2A9H A;  2EJ7 A;  4JI3 B;  3QO8 A;  4LF8 B;  1N0J A;  4CC5 A;  2EBO A;  2HP8 A;  4U7O A;  3SJB C;  1R3L C;  5C8Y A;  4X1I A;  4JPR A;  5EBM C;  1IBM B;  3X2Q B;  4B3T B;  4PA6 A;  2XHB A;  2F1M A;  2RDC A;  4XDK A;  1YI2 V;  2QKS A;  2ZE7 A;  4IT5 A;  4JI2 B;  3THO A;  3B09 A;  3LSQ A;  3E8F A;  4WFF A;  5LMU B;  1VQN V;  3GB7 C;  1WAZ A;  3RN4 A;  5EYP B;  1I7F A;  4KFM A;  1HDJ A;  3NR7 A;  3W7S A;  5KAF Z;  1X59 A;  1FXV A;  4O4H B;  2R9R B;  1NR1 A;  1G6U A;  4LF4 B;  5IJ0 B;  3BVO A;  3RYC B;  2QWR B;  1Y76 A;  4TWK A;  1F7Y A;  4K0K O;  2X0L A;  3MAQ A;  3L72 H;  5BY1 A;  4K8Z A;  4B3R O;  4TQD A;  2KQX A;  4KHP O;  1M4U A;  3K3W A;  1ORQ C;  1Y76 B;  1KU9 A;  1VQ4 V;  4HNA B;  4MTF A;  2QWN B;  4PDV A;  2GUZ B;  1FJG B;  5CB4 B;  1RSO B;  5EC2 C;  4EKW A;  2ZE6 A;  2EIM B;  2P06 A;  2B5U A;  1M56 B;  1NH2 D;  3OFN G;  4DV7 O;  2HG5 C;  3FYI B;  5EK0 A;  4HYO A;  2KKW A;  4UCT A;  2CTP A;  5LGU A;  1FFX A;  1H2G A;  1VQM V;  1E1R G;  3RYF B;  4NKG B;  1WA8 A;  3MHS C;  4PHZ A;  1PNM A;  4N23 A;  1G8M A;  3EXA A;  4FPP A;  5LXT B;  4DV3 O;  1Q5O A;  3CRR A;  2XAJ A;  2ZM6 O;  1DLB A;  1K5S A;  4CS2 A;  1JMK C;  1KB9 F;  3VOU A;  3HR0 A;  4DR2 B;  2IJK A;  4JF3 A;  2BSK A;  4X65 B;  4K3A A;  2VQF O;  3WFV A;  2W0X A;  1QU7 A;  1VF7 A;  3CCQ V;  1IVS A;  1ZUQ A;  3UO3 A;  4B7E A;  4NVP A;  3SYA A;  2DN9 A;  1Q7Y W;  3JD2 A;  2UUA O;  1K7D A;  5B5E Z;  4FVM A;  3L74 H;  3ZMZ A;  3CB2 A;  1YEW A;  5BZB A;  1AI4 A;  2PYL A;  2YI9 A;  2P67 A;  2HFE C;  2Q69 A;  3N27 A;  4PI0 A;  3G67 A;  1VQ5 V;  2VRZ A;  2P4V A;  2ZNJ A;  2QDO A;  4FZ0 A;  3SGI A;  5L3B A;  1YTF B;  2V1D A;  2ITC C;  3JAL A;  3S3W A;  1N32 B;  3D3Q A;  3QO7 A;  4QE7 A;  3FD9 A;  3G6B A;  4CS4 A;  5BMV A;  1AP5 A;  1Y74 B;  4LFC O;  3LNM B;  5A9G A;  5H2F Z;  5JH7 B;  1DGS A;  2F4V O;  5KMG A;  4O4J A;  4NB5 A;  2IM9 A;  3TXQ A;  5CN0 A;  4DV4 B;  1DF5 A;  4A5U B;  1JA8 A;  3ZHV A;  2B1G A;  3ASN B;  3OMI B;  3K5M A;  4QGP A;  5IY5 B;  2DW4 A;  1SQQ H;  1R6N A;  3EFF K;  3SPJ A;  4DR6 B;  1OCO B;  1FJG O;  5J9P C;  2QSA A;  3O9O A;  3O65 A;  4JV5 B;  1SQP H;  4X64 O;  1GM7 A;  2UXC O;  1NS1 A;  1QBZ A;  1VAR A;  4FLY A;  2C2A A;  2ZQM A;  1RM1 B;  2OYQ A;  3SYP A;  4GX2 A;  4X62 B;  2ZE5 A;  4NXN O;  3DC5 A;  3HKD B;  4TV8 B;  3FFQ A;  2DYR C;  1R3I C;  3B40 A;  1SZX A;  3M7M X;  2LO1 A;  5LL6 Y;  4NXM B;  4B7K A;  4IIJ A;  3UCS C;  1VQL V;  4FLZ A;  5JVD B;  4Z1M G;  4QNH B;  1XBL A;  5J2U B;  4B3T O;  1YIT V;  2YXY A;  1XUQ A;  4X20 B;  1YZB A;  2LW7 A;  3E22 B;  1N34 O;  1ZTE A;  3BCC H;  3JAR A;  5DEC A;  4JI0 O;  1T5E A;  5E1A C;  2LQT A;  4TV9 B;  5IYZ B;  4CZZ A;  2YXH A;  2Z0A A;  4ABM A;  4BIZ A;  4GZR B;  3JAS A;  1SER A;  5JJE B;  1Q43 A;  2YEV A;  4O2B A;  3VBB A;  5B66 Z;  4WFG A;  4XDL A;  2R70 A;  4LF5 B;  4FK5 C;  2XAH A;  4IYI A;  2LP7 A;  4I4T A;  5E79 Z;  2DYS C;  1LUV A;  2ZCE A;  1NU1 H;  4E4E A;  3T1C A;  2JS5 A;  4H33 A;  1K97 A;  4LF9 O;  5FL7 G;  5IE9 A;  2N04 A;  4DYL A;  5B3S C;  1GN6 A;  3OEH G;  4JAA A;  5J2T A;  3JD4 A;  3N2G B;  3WU2 Z;  3CCM V;  3T4D A;  1QCE A;  2IU0 A;  3ZHQ A;  1H2N A;  1QLN A;  1HWY A;  4N21 A;  3PJS K;  4JAV A;  1NVP B;  4DRX B;  5IDJ A;  5LXT A;  5LA6 A;  1YSC A;  2WLL A;  1MOF A;  1IBM O;  5CBH A;  4LF9 B;  1KKD A;  3OMN B;  1RPO A;  4TSF G;  3TCU A;  4DR5 B;  4YJ2 A;  2DYR B;  4RUE A;  2M6Y A;  2UXN A;  5GON B;  2OTJ V;  4LF7 O;  4F6R B;  3AG1 C;  2Y0I A;  1CPY A;  2VQE B;  4DUY B;  3A2F A;  4HAM A;  1RSO A;  4IHJ B;  2GUZ A;  4H13 B;  2VQF B;  2Y0P A;  5JJJ B;  3RYH A;  2BOB C;  3H1J H;  3B4S A;  3SYQ A;  3BAB A;  2GBO A;  1CXZ B;  2B1I A;  1AR1 B;  1NI8 A;  1F23 A;  1JVM A;  4JI7 B;  2CTQ A;  3WG7 C;  4DV1 O;  2ATK C;  3E86 A;  4AIL C;  1AI7 A;  1YVW A;  3QF7 A;  4EB6 B;  3C3S A;  2IW5 A;  5EYP A;  3CPW U;  4JYB A;  2KG7 B;  3F5W C;  3LUT B;  5DN6 G;  2JEX A;  2P90 A;  3RYI B;  4QPJ A;  4J9Z B;  1UFI A;  2F93 B;  2YC0 A;  2DOS A;  4FLX A;  5H5N A;  5CA1 B;  2NN4 A;  2EIL C;  5LHH A;  3K5N A;  4LFA O;  3IJ4 A;  3ZCC A;  1KYO F;  2YEV B;  4GX1 A;  2ZXW C;  2UUA B;  4DV5 O;  1JPX A;  4GKJ O;  4U3J A;  4UUJ C;  3CEI A;  4RO2 A;  5JQG A;  4O2A B;  3LDC A;  3HKE A;  2X7R B;  3HKE B;  4X20 A;  1K33 A;  5KX5 A;  1E79 G;  4ZI7 A;  2GDS A;  4UV8 A;  5KHK A;  4GYC B;  2E75 B;  2QA4 V;  4BAY A;  3FYE B;  1MNG A;  4JGS A;  4MTX A;  3OM3 B;  1OCC C;  3ZMU A;  4I0X B;  3HKD A;  1EFR G;  4TV8 A;  1F4M A;  4YJ3 B;  5H6R A;  3B8M A;  2EIN C;  3MD0 A;  4CH3 A;  4K35 A;  5IYD O;  4J7K A;  1AIL A;  2WA4 A;  2IJJ A;  4I7Z B;  1VMG A;  4OX9 B;  4JI6 O;  4DUY O;  3RYI A;  2V4D A;  2GHY A;  4DK0 A;  5GW7 A;  1NBM G;  3ASO B;  4CH6 A;  1WLE A;  5EBL C;  4GKK O;  4LF5 O;  1Q90 D;  5LP6 A;  1XNR B;  3QNE A;  1BHB A;  1FD9 A;  3RT3 C;  2JGU A;  1AJQ A;  3AG4 B;  4EB6 A;  4TOI A;  4UFZ A;  1HP8 A;  4P2Z A;  4P9O A;  4WFH A;  5EC1 C;  1FS0 G;  3BHP A;  3AG3 C;  3Q4H A;  3FB6 C;  3CYO A;  4DXW A;  1W59 A;  3LSU A;  4DO2 A;  2W6J G;  2CDY A;  2WLK A;  1Y6X A;  3ZBH A;  4JI2 O;  3RVZ A;  3UT5 A;  3AG1 B;  2CH7 B;  1J5E O;  1GN4 A;  1NTM H;  4I55 B;  4PDM A;  1P7G A;  3ETG A;  2QR4 A;  1AI5 A;  2AHZ A;  2V7Q G;  1L0N H;  4DW0 A;  3K06 A;  4BW5 A;  1R6T A;  2A0L A;  3A0B Z;  3ETE A;  4D7T A;  5IYB O;  3OMA B;  1WB8 A;  2EZO A;  4AI8 A;  1HW7 A;  5LGN A;  1TVK A;  2W6I G;  2XOK G;  1XOU A;  2YIA A;  3TJT A;  1NT2 B;  5LP6 C;  1R6K A;  5EIB C;  1GRJ A;  4JTC B;  1WP7 A;  3JAM N;  1XIL A;  2Y69 B;  3C3T A;  4CH5 A;  3JAK B;  4I9W A;  3PN1 A;  3SR2 C;  5LGT A;  3X2Q C;  1V54 B;  4D6T H;  1V55 C;  4LWS B;  4R8C A;  4DV0 B;  2DWD C;  3G4S V;  1VQ9 V;  2DQ0 A;  4PD4 F;  4I50 B;  3CCR V;  4JZ2 A;  1SQF A;  1J5E B;  3T1H B;  2ZIN A;  5CA3 A;  4OXS A;  1I5Y A;  3AG4 C;  3STZ C;  3KZI Z;  3ZRV A;  2BTO A;  5B1A C;  1FXH A;  1JQ0 A;  1S5H C;  4LFB O;  3ZMV A;  1AJN A;  3H01 A;  2DJV A;  4QE9 A;  5IYZ A;  5KUK A;  4UCV A;  4UCO A;  1UPG A;  3E22 A;  4MTG A;  2OT5 A;  1Y4M A;  2XAS A;  4LWS A;  5J2U A;  4JTA B;  5EBW C;  1BMF G;  1KP2 A;  1B04 A;  3B2E E;  1XNR O;  3M99 B;  2GTA A;  1QLE B;  1U96 A;  3OE7 G;  5GTH Z;  5KUM A;  3IC9 A;  3JAK A;  1K3E A;  3IFX A;  2FB5 A;  5K1P A;  2CH7 A;  3C90 A;  1EZV H;  3UT5 B;  1R73 A;  2ZR3 A;  1KQS U;  3CP1 A;  1TVK B;  1GM8 A;  1YTF D;  4DUZ B;  1VF5 B;  1SC5 B;  5JWP A;  1DTO A;  2F4V B;  1FXK A;  1Z5V A;  2CE4 A;  4EFB A;  5ITZ B;  1JX9 A;  5LMN B;  4I9Q A;  1CEZ A;  1TUB B;  3ZRS A;  4F6E A;  3CCS V;  1E1Q G;  4JI5 B;  1N36 O;  3OGI B;  2A06 H;  3CME V;  3QVN A;  4MVM A;  4X64 B;  5IJ9 B;  5B1O A;  4LF6 O;  1M90 W;  1M57 C;  1KP3 A;  4DV2 O;  3L9D A;  4JV5 O;  1SA0 A;  3G6E V;  3G71 V;  4MSW C;  1AR5 A;  2VWJ A;  4DV6 O;  1COW G;  3ZRX A;  4B3M B;  1KMI Z;  4PI2 A;  1PL0 A;  3SPG A;  1XNQ O;  2HHH B;  3CCU V;  1URF A;  3ZS8 C;  4J9Y B;  1RP3 B;  4JAS A;  3L73 H;  3CCV V;  1QHT A;  2PY5 A;  1N4C A;  2UXB O;  1Y67 A;  3AG7 A;  4CC6 A;  3ZHU A;  3CJH B;  3N2K B;  5JQG B;  2ADP A;  5IWA O;  4DR1 B;  4QIW F;  3CSX A;  2AGA A;  2NR5 A;  4BW9 A;  1Q82 W;  1HNX O;  3OUF A;  3CC7 V;  2ZR2 A;  4TQF A;  4DV7 B;  4Q6G A;  5LMU O;  4TT3 G;  4B08 A;  5CA1 A;  1NZ6 A;  2Q7E A;  1I94 B;  3HKB B;  3OTO O;  3E2E A;  1R3K C;  3D36 C;  2UU9 B;  1GN3 A;  4MT8 A;  1WN7 A;  2CTW A;  1QQC A;  1DF4 A;  2IH3 C;  2OCH A;  2EX3 A;  1K73 W;  4U3F H;  4GT1 A;  1XMQ B;  4K0K B;  1L0L H;  3D8C A;  2JDI G;  3AG3 B;  1BGY H;  2DMX A;  3CC4 V;  3K0D A;  2XAG A;  1M56 C;  4O4L A;  2AZ0 A;  3UKM A;  1K34 A;  1W0J G;  4WCE V;  3NXS A;  4IYH A;  3RYF A;  5IJ9 A;  1K9M W;  2LFR A;  3IC7 A;  4OPA A;  2Q68 A;  1HNW O;  4GUN A;  2XTA A;  2WLJ A;  5JCO C;  4DUZ O;  2DE0 X;  3GWK C;  2E3C A;  1S5J A;  2UUB B;  2KB1 A;  3FX7 A;  5L3E A;  2EIK C;  2F23 A;  1DK1 A;  4KL1 A;  3SPI A;  2YIC A;  1QR9 A;  1AR4 A;  2BE3 A;  1TAE A;  1AVM A;  1BT8 A;  1F51 A;  4UVA A;  4JI3 O;  2PUS A;  4LF8 O;  4H44 B;  2UUC B;  4LF7 B;  3AG2 C;  5KLV H;  3SDL A;  2F66 C;  4FM2 A;  2HJD A;  1YHQ V;  5IJ0 A;  1IZ3 A;  3ZMS A;  4DW1 A;  3HKC A;  2ZXW B;  4IHJ A;  4FLW A;  3APQ A;  3CX5 F;  4HBN A;  5BR8 O;  3GWO A;  4JI0 B;  3ETQ A;  2NLJ C;  4F6R A;  1RPR A;  3ABT A;  4JI8 B;  2ZM6 B;  1H38 A;  1AP6 A;  5C93 A;  2KSD A;  2ADQ B;  2WAM A;  4OPH A;  5JCO A;  1XMO B;  4ZKI A;  5LMN O;  4DR1 O;  2UXD O;  2WLL B;  4YY3 O;  1EN5 A;  1K4C C;  2W0F C;  4O4L B;  1QR8 A;  4JTD B;  3LNN A;  4O2B B;  1SQG A;  4WBN B;  3K59 A;  1OCO C;  1Q81 W;  5EZY A;  2MK3 A;  3J80 N;  4J7Z A;  2EJR A;  2ITD C;  4ZHQ B;  3W7T A;  2WSS G;  4X1K B;  3CCE V;  2JVD A;  4TV9 A;  3W7U A; 
#chains in the Genus database with same CATH homology
 2GUZ A;  2QWN B;  2DN9 A;  3AG7 A;  2L6L A;  2Y4T A;  1IUR A;  1FPO A;  2PF4 E;  2CTW A;  2GUZ B;  3BVO A;  2CTR A;  1GH6 A;  2QWO B;  2N04 A;  2QWR B;  3UO2 A;  2OCH A;  3APQ A;  2Y4U A;  2LGW A;  2LO1 A;  2QWP B;  2YS8 A;  4RWU A;  3APO A;  3UCS C;  2EJ7 A;  4IT5 A;  1WJZ A;  2M6Y A;  1XBL A;  2CUG A;  2KQX A;  4J80 A;  2CTP A;  1BQZ A;  2DMX A;  1NZ6 A;  4J7Z A;  1FAF A;  1BQ0 A;  1HDJ A;  2QWQ B;  2QSA A;  2N05 A;  2CTQ A;  1N4C A;  2YUA A;  3UO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...