2LO1A

Nmr structure of the protein bc008182, a dnaj-like domain from homo sapiens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily A member 1
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lo1A00
2QWPB 2DMXA 1BQZA 4RWUA 2QSAA 2CUGA 2QWQB 2L6LA 2EJ7A 2N05A 2YS8A 3UO3A 3AG7A 1N4CA 4J80A 2LGWA 2CTPA 2YUAA 1IURA 1FPOA 2GUZB 1FAFA 2OCHA 1XBLA 3APOA 2Y4TA 2LO1A 1HDJA 1BQ0A 4J7ZA 2GUZA 2QWOB 1WJZA 2QWNB 3UCSC 3BVOA 4IT5A 2M6YA 2PF4E 2QWRB 1GH6A 2KQXA 3UO2A 2DN9A 3APQA 2Y4UA 2N04A 1NZ6A 2CTQA 2CTRA 2CTWA
chains in the Genus database with same CATH superfamily
1GN3A 2LJ2A 3ASOB 3SYAA 1BCCH 4P9OA 2P22C 4PDLA 4B3SB 1IURA 1IBLO 5J2TA 2LO1A 2B1GA 4O4IB 4GT1A 4RUFA 3E35A 2HVJC 4WFBV 2BOBC 1W2BU 2R72A 3TGUH 2XAFA 3DC5A 4DR6O 2RMKB 3GB7C 5B1AB 2CGNA 4I7ZB 1F23A 4I4TB 1SQPH 1YIJV 1VF6A 3CX5F 4DV1B 3AG2B 4DR1O 4EFBA 2EILB 3DXRB 1E1QG 3ABLC 3DC6A 3EFFK 4JAVA 3OAAG 4WFEA 5KHJA 3E8BA 3RYFB 1F51A 4FZ1A 5JH7A 4LFBB 5IJ0A 2P4KA 3X2QB 1OCCC 2IU0A 4P30A 1TGOA 4N21A 1XMOB 1HW7A 2UUAB 1M4UA 4KHPO 3HB3B 4O4JB 1PP9H 2EILC 4DW1A 4Q20A 4DR7O 2VQEO 3BVOA 3RYHA 2BTQB 5L3GA 4LF4O 1Y4MA 4PA3A 2QJ1A 1R3JC 1FXVA 4JTAB 2E5LB 4TV8A 3B2EE 2ZE6A 1DTOA 2ZD9A 3L71H 5KA6A 1BL8A 3A0BZ 1M93A 2UU9B 2LP7A 1M56C 4FLUA 4ZOLA 1N32B 4AQYO 2EINB 3N2KA 1SA0A 3JARA 4PA9A 1RP3B 4PA7A 4DV4O 4LF6B 3G71V 5IE9A 3X2QC 4B3TO 1KUQA 1KQSU 5JCOC 1DGSA 4NKGB 3OGIB 4DK0A 5D5QA 3E8GA 2Q5ZA 1ZL8A 1YVWA 1O9HA 5LP6C 1S5HC 4RO2A 3JD2A 2WLIA 1ROPA 2YXYA 2ZE7A 2KKWA 2FB5A 1JJOA 3OD4A 4GX0A 3K04A 1KYOF 5BY1A 3WG7B 3D3QA 2ZM6O 5LL6Y 1YDXA 2VWJA 5LA6A 1KKDA 2LGQA 1AI5A 5JH7B 4QGPA 1K97A 1AJPA 3LSQA 4MTXA 5LYJA 4X65O 5J2UA 4PDMA 1MMMA 1G1XB 2HHHB 2OCCC 2OYQA 1OZ0A 2IBZH 4UB8Z 2Q73A 3ASNC 3SJBC 3N2GA 3P32A 2ZXWC 3JALB 1IBMO 2P6JA 3E86A 3A0HZ 3JD4A 1AP5A 2GSMB 3ZRVA 3W7XA 1YCIA 3QF7A 3JD1A 1ZL8B 2XOKG 1TUBA 4B3RO 1XI1A 5IWAO 1IBKO 2HG5C 4BWAA 3H1KH 4FM1A 1AVMA 3B77A 4D7SA 1US6A 2UXBO 4ZI7B 2IJIA 1EN5A 4DV7O 2GDSA 5CMUA 2Q69A 2ETNA 1SZTA 4JI0O 3JAWB 4AILC 2CE4A 4YJ2B 4J9ZB 2F4VB 2DYRC 4ASUG 4YY3O 1VP7A 5KLVH 1AI4A 1GM9A 1JR9A 4K0KB 4TV9A 2B1IA 2NLJC 4DR4B 3CCUV 2LQTA 4JASA 4CBCA 2NR5A 2O57A 4JI1B 4G27B 1GKFA 4YHHO 3W7SA 2UXDB 3QTCA 1QHTA 5DECA 2EZOA 5KA5A 2IM9A 1XNQB 3C90A 1FS0G 4CZZA 5JWPA 3DTUB 1K33A 4YJ3A 2QDOA 2F43G 4OX9O 4X89A 1KC8W 3ZRSA 3ABKB 1VEWA 4EKWA 1D5NA 1YF2A 3QO7A 4RWUA 3AK3A 3LDDA 2H3OA 2OCCB 1NH2D 3HPLC 1FJGB 1Q82W 1KMIZ 4LFAO 1SQXH 2KG7A 4H44B 4JI6B 2Y0PA 3BA8A 2ZXWB 1BHAA 1BQ0A 3IC9A 4X62B 1AR4A 2HR3A 3B40A 1AR5A 3H1IH 1U96A 4I9QA 3RYCB 4QPKA 2QSAA 2GTAA 2YI9A 3CHXA 4AHCA 3CE2A 5EYPB 4FLVA 4DYLA 5LBQA 4JI6O 1XMQB 1PNLA 3JSNA 4LFAB 2QWOB 3IFXA 2JRIA 3CPWU 3CXCU 2RDCA 4YXWG 3AG3C 1B3QA 4UCVA 2XT9A 1PL0A 1BGYH 5FNVA 2AHZA 3G80A 3HKBB 4JYAO 3BCCH 2E3CA 3JAMN 2A9HA 2R70A 1RSOB 3JATA 4DUYO 5ITZB 4I55A 1AI6A 4HYOA 4ZBMA 3K58A 4DRXA 3ETGA 3S3WA 3K5LA 3SPJA 3ICXA 4NXNO 1B6QA 2ITCC 3EXAA 3JAWA 4K0KO 2Y69B 1WAZA 4LF7O 1X4TA 4U3JA 1XL4A 4KFMA 1L8DA 4IIJB 5FPOA 4YY3B 3ML0A 1I7FA 3CMAV 3IC7A 2YC0A 4X8AA 1COWG 3CCQV 2QM4A 4MTGA 4CC6A 5CN0A 4UCOA 2Q6AA 4DV7B 3OUSA 3WG7C 4MVSA 2JGUA 2PTMA 1K92A 4BAYA 3ZHRA 4FVMA 4F6RB 3SPHA 2WLLB 2Y69C 2X6AA 3JYCA 2R9RB 4MVQA 1S0VA 4B3RB 2F1MA 4LR3A 4XDKA 1W0JG 4FMTA 4J11A 1NS1A 4IYHA 4BW9A 4R6ZA 2EIJC 4PI0A 4IL6Z 2CTQA 4MVRA 4MTOA 4ABMA 4J7JA 1M57B 1NU1H 4LF8B 3JSLA 1H2MA 4YIPA 5BR8B 4KXRA 3G4SV 4FFBA 4U7OA 1W59A 1KBHA 3T4ZA 4MSWC 1YJWV 1OJHA 2L35A 4MW8A 1W0KG 3OTOB 3BEHA 1FXKC 5H2FZ 2WA4A 3RW0A 4JI8O 4MVMA 2CH7A 4FPPA 4IGGA 1LNQA 1NI8A 4J7ZA 3RT3C 2DOSA 1R3LC 1MOFA 4B7KA 4B08A 3K5MA 4DR5O 1SS3A 3UM7A 1WPXA 1ZX3A 4O2BA 3AK1A 4GYCB 4YIOA 3HKDB 3LNNA 3ZMTA 1WP7A 1SF9A 2AGAA 4HZ3A 2C2AA 4H37A 2H94A 1WJZA 1QCEA 4PA6A 2A0LA 3JAKB 4HBNA 5H6RA 4KL1A 1N32O 4OGQB 2L6LA 4JI4O 2UU9O 4TV9B 1VF7A 4JI7B 4O4LA 1ZAUA 3OEHG 4NXNB 3FD9A 3CCRV 3K9AA 4LF4B 3SJCC 5H9CA 3SPCA 1ORQC 2HVKC 1NTZH 3I55V 5JQGA 3G67A 1MZEA 2YIBD 2VQEB 2VWKA 1Q6HA 2Q7HA 2WA3A 1F7YA 4WCEV 2P5OA 5IJ0B 3ABLB 3A0RA 2YXHA 1V9PA 1RPRA 2FMLA 2OCHA 1E79G 4JYAB 2B9ZA 4LFBO 4JZGA 3VOUA 3VQWA 1OCZB 2M7WA 2UXXA 5CBFA 4K8ZA 1TUEB 2MK3A 5IJ9A 2P06A 3WB0A 4DV0B 3B8MA 4DR1B 2X6CA 1XMQO 4DV1O 1Q43A 5BMVA 1J5EB 2GUZB 3CMEV 1QLNA 2KB1A 1WLEA 1NTMH 3W7UA 2QE7G 3PN1A 1WN7A 5L3CA 1GK9A 2LFRA 4R7CA 5KX5B 2VRZA 4X62O 1QLEC 3ASNB 1K34A 1IVSA 3FFQA 1Q6IA 2FKXA 5IYBO 4JYYA 3GVMA 2W6JG 1YZBA 3BFRA 4FM2A 1JFFA 4X20A 1KU9A 1VQ5V 2UXCO 1R6TA 4QIWF 3WU2Z 2ILMA 1FFXA 1UJWB 2HP8A 1TVKA 1QVGU 2RJZA 5JJNB 1RM1B 1EFRG 2WSSG 5IYZA 3O9OA 1YTFD 3TXQA 5IJ9B 3D3IA 4YHHB 3ZHVA 3HKEA 1R3KC 2IW5A 1SETA 1XNRB 1VQKV 3AG4B 3LNMB 4N23A 3OT7A 4DR4O 3P3NA 2K9PA 1F4MA 4FJCC 5IY5B 5LOVB 5EC1C 4PA4A 3SYOA 3LSUA 4Z2WA 3ZRWA 2XAJA 1AI7A 2QR4A 2F4VO 2ADQB 5JVDA 1ZWIC 3CWBH 3CRRA 5LGTA 2HKOA 3LUTB 2ZQMA 3K08A 3R66A 3CCEV 3TK1A 2CTRA 2WWWA 1FFTB 5EZYA 4JF3A 2AXTZ 3ABMC 4OPAA 5KUKA 2EJ7A 4U7NA 5IWAB 1AP6A 1KP2A 5J2UB 3SJQC 3DSQA 2IJJA 2BSKB 3CJHB 1HNZB 3FKSG 1I08A 1GH6A 3OFNG 1G4YB 4MW3A 4DV6O 1YEWA 1WPBA 1XDCA 2PZSA 2CDYA 1H2LA 4LNUB 2QWPB 3SYCA 4ZKIA 2ZDIC 3AG2C 4GX5A 1QQCA 3H9VA 3T2MA 3UT5B 2IH1C 2PYJA 2DYSC 1J95A 3C3SA 4AI8A 1JMKC 3IJ4A 2ODMA 4DO2A 3OM3B 2A79B 4KP4A 2PI4A 2D3OW 1SQGA 2QKCA 2CAZC 1AB3A 2PYLA 5FL7G 2EZPA 2V4DA 3SYQA 2JDIG 4I0XB 1JFFB 3UT5A 1NR7A 1M57C 3QG5A 1KB9F 2GHYA 4JYBA 1Q86W 1Y66A 2WPDG 1XILA 1NZ6A 2LFSA 3K0DA 5KX5A 1H38A 4X1IA 3OMIB 2JJ2G 4PD4F 4X9QA 3N27A 4JGSA 4HNAA 5LXTB 2JEUA 1MNGA 3FYIB 2F66C 4NR1A 4LWSB 4JV5B 4K8XA 4TWKA 4DV4B 2QGNA 3EVKA 1AILA 1DLBA 1GM7A 1WP8A 1P49A 1EN6A 3UO2A 4H0LB 2OTJV 1P84F 4UCTA 2V7QG 5KHHA 2Q4PA 5KMGA 1YHQV 2YIAA 3ZMSA 4UUJC 3IAYA 1AJQA 1VF6C 3MDSA 3B09A 1SQQH 4J9YB 4TUYA 1ZSPA 1KP3A 1Y76B 4O2AB 2FYUH 4LWSA 2DQ0A 5L3EA 2JGDA 2PF4E 3SYPA 3VQYA 2ZKOA 2A3QA 4X64O 4Q6GA 4DV6B 2OTLV 5J2TB 1YTFB 4LCUC 5BMVB 5GTIZ 4LBEC 5JJJB 1NH2B 5B3SB 1QR9A 4MVOA 3F7VC 3AG3B 2YSUB 2YICA 3EHBB 5KMGB 5C8YB 1NBMG 2RNBA 3OMNB 4TSFG 1SKVA 1DF5A 1N8RW 2EBOA 1Y76A 3SR2C 2QA4V 4LNUA 3KKYA 2CUGA 3L9DA 3M7MX 4L87A 4F6EA 2XASA 1JJ2U 2ZIMA 3H1HH 4O4HA 3U11A 4LC1A 1QBZA 2JS5A 1I94B 5EK0A 2DN9A 3BABA 4NVPA 3HKCA 2DW4A 1GTOA 1QR8A 4ZI7A 3JCZA 4DRXB 1Q7YW 1I0HA 4B3SO 4NXMB 3OUFA 3CB2A 3K9SA 4DR2B 3ZRWB 3ZHSA 1VQPV 5DN6G 1YJNV 3M8AA 1A32A 4DR2O 1S76D 4MS2A 4NXMO 5LP6A 5LHGA 3WFVA 3FB6C 1YXBA 3D36A 1LR1A 5JVDB 4JI5O 4I0XA 2BCCH 4TOIA 4GKJB 3D36C 2ZNIA 4CC5A 1Z5WA 4HAMA 5K1XA 4JAAA 5LGNA 1VMGA 3TJTA 1TVKB 5HFLA 4CH4A 1JPXA 1UPGA 1YI2V 1FPOA 3CRQA 1J5EO 1XBLA 2QM7A 4RUEA 1Q8IA 3IGAC 3CCLV 4UB6Z 2VQFB 1PL4A 2E75B 4BW5A 2N04A 3AG1B 3JASB 4UV8A 1SESA 1E1RG 4ICGA 2YIBA 2XAHA 1R3IC 2ZINA 5KAIZ 3QNEA 1SERA 3P30A 2AZ2A 2AZ0A 1R1BA 4J7KA 4IIJA 4DV5B 5LGUA 4TUYB 5EC2C 1P4RA 4R50A 4B3MO 5LP6B 4EB6A 4I50A 3E83A 2Y48A 3HKEB 1Z5VA 3K0GA 1FD9A 1NT2B 3WB1A 3E2EA 5LMNB 2LW7A 4GLXA 1OCRB 1P7BA 3OMAB 5FPRA 1S5LZ 3JASA 4JI7O 3E89A 3OTFA 3T1CA 4JI4B 2IJHA 1TUBB 2QWRB 1RPOA 2HJFC 4X1KB 5H5NA 1JOYA 2QEXV 3CP1A 1QVFU 3VQXA 1PPJH 2UUBB 3ZIAG 4I50B 2Y0IA 2F95B 4W4LA 1M90W 1EBOA 5KHIA 1R6NA 2YI8A 4LF5O 1NR1A 2QTSA 3KCXA 1JQ0A 3UQ8A 3BA9A 1M56B 2ZR3A 2JIZG 4D7TA 3DGEA 2BTOA 5GW7A 5CB4A 4PDVA 4I55B 2P67A 1V54B 4EB6B 2F23A 2LGWA 3DXRA 5BZBA 3ZMUA 4X20B 1EZVH 4PHZA 5B66Z 3BPZA 3RN4A 2QTOA 5L3DA 5EBLC 1NTKH 3OTOO 1Q6UA 1TA8A 2RQ6A 1S77D 3SPGA 3K79A 2G38A 4K3AA 2W6IG 1XHZA 5BR8O 4BIUA 3JARB 4E2LA 4BIZA 5CA1B 3L75H 4GX1A 1YSCA 1T5EA 1S3JA 3K3WA 1XEQA 3ZRXA 4K35A 2E76B 1N33O 3K5NA 1WA8B 1Y6XA 3OEEG 5JCOA 2X0LA 3M99B 2LW1A 3LSSA 2YXLA 1BHBA 5GTHZ 2UUCB 3U0ZA 1PKXA 5DM6V 5J9PC 4LF9B 1V55C 4X1IB 3F5WC 1P7GA 5LHHA 3LDCA 2OT5A 2BTQA 2CH7B 3VBBA 3ETQA 1N36O 2YS8A 3T1HB 4R8CA 5LOVA 2JS3A 1IDSA 3CRCA 2XAQA 4IYIA 4FIPC 1JVMA 1Q90D 1U97A 4O4LB 3PJSK 3E8HA 3L73H 1JCHA 2YEVB 3ZHTA 1WNSA 1XNRO 3LDEA 2FL4A 2F93B 2OIEA 4WFFA 1HP8A 4QE7A 1OHHG 1WB7A 4Z1VA 4JI2O 3O65A 4DR3O 1SRYA 2GBOA 4JYCA 3MAQA 1YITV 5B1NA 5EZYB 4JTDB 4QJFB 2BOCC 4DUYB 2QKSA 5B1AC 3OR6C 3QO5A 2EJRA 2Z3YA 5KUMA 2IJKA 4LH6A 3GWKC 4UVAA 2UXCB 2WLKA 2EX3A 3NR7A 3G6EV 3H1LH 3OGCC 3J7AU 2ZCEA 3AG1C 3W7WA 3BY6A 3ZCCA 4P2ZA 3UCSC 1VARA 4YJ2A 2YIDA 4XBFA 2HEPA 1IZ3A 1D2DA 2KQXA 4FFBB 4DV2B 1UFIA 4DV2O 4D6TH 2UXNA 2WLIB 1GAXA 2X7RB 1FKAO 2YEVA 4W4KA 3MD0A 4CS3A 1Y74A 3ASOC 4DV0O 5A2QN 1FJGO 3CC4V 2ITDC 1FXHA 3SJAC 3JAKA 1G6UA 3RYIA 2AHYA 1OV9A 4H13B 4RQFA 2Q67A 4IHJA 4WBNA 2V1DA 3T1YO 4FFKA 1JA8A 1DF4A 2DMXA 1K73W 1GRJA 4OX9B 4X1YB 1RFYA 2E74B 2WLNA 4O2BB 5KHKA 1VQNV 1VF5B 2XHBA 5EBWC 1HNWB 4L8JA 1ZUQA 4UVBA 1URFA 1VQMV 4DR3B 4JI2B 4E4EA 1VQ7V 2UXDO 1GMGA 4TQDA 4XDLA 3E8FA 3RFRA 1FYJA 4FLXA 1BQZA 3RBZA 3BRCA 4DV3B 4ZHQA 1VQ9V 2BE3A 3ZEDA 3B8NA 2CTPA 1MSDA 2NNUA 4FM0A 2Q9LA 4CH5A 1FXKA 5CB4B 1K4DC 4GUNA 1V54C 4CS4A 1N34O 4UCRA 1VQ6V 4H33A 1MZFA 2A7WA 3ABUA 1N36B 1KECA 1GO3F 1VQ4V 1B06A 2P4VA 1Z2GA 1PNKA 3AK2A 3VQVA 1M5IA 3AG4C 1VQ8V 1QNMA 1WA8A 1R73A 1IBKB 1LUVA 4TQFA 4LF9O 1H2NA 1JX9A 5JJEB 4PI2A 3RYCA 2UUCO 3A8TA 5E1AC 4DR5B 1S72V 1VIBA 1H2GA 1OCZC 4QNHB 3STZC 2B5UA 3ZBHA 1FAFA 3N2KB 3CXHF 1IBMB 1NKDA 5EYPA 3CRMA 5EIBC 2DWDC 3ZMVA 3MHSC 1CPYA 3RYIB 5TISZ 3CS5A 2WLLA 2PGGA 1L0NH 3RYFA 4JI8B 4C7UA 4EFEA 2EIKC 1CXZB 1QU7A 3K06A 4WFGA 1S5JA 2ZIOA 5CA3A 4X65B 4MTFA 2DJVA 2Y4UA 3NXSA 5AG2A 3P3PA 2HLDG 2Q68A 1XREA 3HKCB 1G8MA 2CK3G 5DEDA 3RYHB 3OW2U 2ZR2A 1BMFG 2ZM6B 5EBMC 4LF8O 4PJ0Z 1CP9A 4DXWA 1K4CC 3ZN1A 4FLTA 1SQVH 4UV9A 2FTKA 2WAMA 5LA6B 5K1PA 2VS0A 3K57A 5D5PA 1GN6A 1NVPB 4NYKA 4WFHA 4NB5A 5KHGA 4X1YA 2JVDA 1RSOA 3JATB 5C8YA 3CCMV 2R9IA 4B3TB 3D8CA 1R6KA 4I4TA 5IYZB 5C93A 4CH6A 3BHPA 1YJ9V 3CYOA 1F4NA 2YDEA 5IDJA 3JD0A 4O4IA 3H01A 1N34B 3QO8A 4AQYB 1EN4A 3ZJZA 3OR7C 4J10A 3UO3A 4JZ2A 4LF7B 3FX7A 4DV3O 3BAAA 2Y4TA 1BT8A 5ITZA 4IT5A 1K9MW 2P90A 4FZ0A 4GZRB 1VQOV 3SGIA 5HFMA 1Q3EA 2Q0AA 4IHJB 3ZHQA 4WBNB 4B3MB 4DR7B 2Q7GA 1HNWO 3AG7A 4UXNA 4KHPB 3K59A 1KKCA 1XMOO 3T4DA 3HR0A 1AR1B 3T1YB 1H8HG 2PY5A 3APQA 2K1EA 2VQFO 1SA0B 2CGOA 4MVZA 5H6QA 5CA0A 1XUQA 1NJIW 1I5YA 2WLJA 2ATKC 1K7DA 1KD1W 4GCZA 3ZS8C 4QPJA 1IXBA 4I9WA 4FLZA 2ZT9B 3ZMZA 4DK1A 1BZKA 3S3XA 1ZTEA 4A5UB 3G6BA 4DR6B 3E22A 3KZIZ 3TCUA 1NQTA 3E22B 1PD3A 4WF9V 2ZNJA 1Q81W 4UFZA 4GKJO 2QWQB 3CD6V 1ENVA 4J80A 3AEIA 2MW2B 3UKMA 4JI5B 2R9AA 3N2GB 4FK5C 1SZXA 1VQLV 3APOA 1LUWA 4NTXA 3ZHUA 2P7TC 1GN2A 3CRAA 1V55B 3JCUZ 1HR0B 3H1JH 3I5DA 1I5XA 4DW0A 2EIMC 5LXTA 5GONA 1N4CA 4FLYA 2XTAA 1XNQO 5LHIA 1HNXO 4O2AA 1NVPD 3QVNA 4UCUA 3CCJV 1N0NA 4JI1O 3R65A 1WB8A 2GTSA 5KAFZ 3RVZA 1OCCB 1XL6A 4DUZO 4RAIA 3GWOA 1TAEA 3CCVV 4I5SA 1I94O 2A06H 4X88A 5EIBD 4GX2A 3ABMB 5GONB 3U10A 3THOA 4BIOA 4FLWA 3TETA 2BSKA 3CJHA 1ZLZA 2PI5A 5L3BA 4JI0B 1BSMA 1HDJA 4JI3O 5E79Z 5FLXN 3C3TA 2Z5UA 3T1HO 3FB7C 3CC7V 3JALA 5JQGB 3RWRD 2UXBB 3TXSA 5CA1A 2ZE5A 4WFAV 4KUMA 2PUSA 4QE9A 3KG2A 2KG7B 2Q8VA 2XNDG 3CSXA 3ABKC 3B4SA 2EIMB 2XAGA 4ZHQB 1RM1C 4G2KA 3OE7G 1N33B 3J81N 4LP8A 4PV1B 3WB2A 4HNAB 2JGDB 2ZDIA 1OCOB 4G28B 3W7TA 1PM9A 2AW9A 4X64B 1SC5B 1EZJA 5B1OA 1HWYA 2IU3A 4OPHA 2HHHO 3CEIA 5F2VO 1PNMA 3RVYA 1Q5OA 3FAVB 3Q4HA 2ARHA 5CBHA 3CCSV 1AROP 2OWOA 1L0LH 1GN4A 5CBGA 5IYCO 2WLHA 3ZX6A 2RCVA 2EIJB 5CA0B 3ETDA 2JEXA 5BXZA 4JV5O 1PV0A 1SQFA 1K3EA 2GUZA 4XDJA 4TT3G 4UVCA 4GKKO 2EULA 3K03A 5LMUB 1OCRC 4X66O 3HKBA 3L72H 2EIKB 4X66B 5LMUO 1H8EG 1XHXA 1THZA 2DWEC 2ZE8A 4J42A 1MA1A 3FB8C 5B3SC 4LF5B 4GKKB 4U3FH 1BS3A 1N0JA 3K5OA 4EEQA 4LF6O 5B5EZ 5IYDO 1CEZA 2W0XA 1Y74B 3RGBA 2UUBO 2Q7EA 5B1BC 4B7EA 3JD3A 4Z1MG 3MHHC 4JAUA 2H8PC 4F4LA 5IT9N 5A9GA 5FNVB 5IY5C 3CC2V 4MVUA 4CH3A 2W0FC 1AJNA 1XOUA 3ZN0A 4JPRA 1B04A 3STLC 4OXSA 5L3FA 2E5LO 2XUMA 4LH7A 5LYJB 1H2SB 1K8AW 1GM8A 4BR6A 5B1BB 4RQEA 3L74H 5LMNO 1SQBH 1EM1A 1D5AA 2HFEC 2DYRB 2QKAA 2WLMA 4F6RA 2DE0X 2QM8A 2CTWA 3F7YC 1Y67A 4ZIBA 1K5SA 2OIGA 1H2KA 1HNZO 4DV5O 1IX9A 2N05A 2DQ3A 3L70H 2UUAO 3ETEA 3A2FA 2JK5C 4JTCB 2N74A 3I56V 1QLEB 4O4JA 1X59A 2GV9A 2Z0AA 2QWNB 4ZOLB 3ABTA 1M1KW 2JJ1G 4UCSA 1OCOC 1L1FA 1K5QA 4MT8A 1MABG 4PDRA 2Q0OC 2X6BA 1XQ8A 1MG1A 1IXMA 1O9GA 4PELA 4JI3B 4P9PA 1FFXB 2ADPA 2YUAA 3J80N 2IH3C 2D2CB 3FYEB 1FXKB 2RN9A 1MSWD 4U3JB 3HKDA 3FB5C 2M6YA 4X1KA 2DYSB 2EINC 3SPIA 3F5TA 4J41A 4DUZB 2KSDA 1M9NA 1IBLB 4NTYA 3SDLA 1BE3H 1HNXB 4CS2A 4TV8B 1DK1A 2HJDA 4LFCO 2NN4A 3FAVA 3Q4HB 4LFCB 4O4HB 3KCYA 4YJ3B 4NTWA 1HR0O
chains in the Genus database with same CATH topology
2QWPB 2DMXA 1BQZA 4RWUA 2QSAA 2CUGA 2QWQB 2L6LA 2EJ7A 2N05A 2YS8A 3UO3A 3AG7A 1N4CA 4J80A 2LGWA 2CTPA 2YUAA 1IURA 1FPOA 2GUZB 1FAFA 2OCHA 1XBLA 3APOA 2Y4TA 2LO1A 1HDJA 1BQ0A 4J7ZA 2GUZA 2QWOB 1WJZA 2QWNB 3UCSC 3BVOA 4IT5A 2M6YA 2PF4E 2QWRB 1GH6A 2KQXA 3UO2A 2DN9A 3APQA 2Y4UA 2N04A 1NZ6A 2CTQA 2CTRA 2CTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2DMX A;  1BQZ A;  4RWU A;  2QSA A;  2CUG A;  2QWQ B;  2L6L A;  2EJ7 A;  2N05 A;  2YS8 A;  3UO3 A;  3AG7 A;  1N4C A;  4J80 A;  2LGW A;  2CTP A;  2YUA A;  1IUR A;  1FPO A;  2GUZ B;  1FAF A;  2OCH A;  1XBL A;  3APO A;  2Y4T A;  2LO1 A;  1HDJ A;  1BQ0 A;  4J7Z A;  2GUZ A;  2QWO B;  1WJZ A;  2QWN B;  3UCS C;  3BVO A;  4IT5 A;  2M6Y A;  2PF4 E;  2QWR B;  1GH6 A;  2KQX A;  3UO2 A;  2DN9 A;  3APQ A;  2Y4U A;  2N04 A;  1NZ6 A;  2CTQ A;  2CTR A;  2CTW A; 
#chains in the Genus database with same CATH topology
 1GN3 A;  2LJ2 A;  3ASO B;  3SYA A;  1BCC H;  4P9O A;  2P22 C;  4PDL A;  4B3S B;  1IUR A;  1IBL O;  5J2T A;  2LO1 A;  2B1G A;  4O4I B;  4GT1 A;  4RUF A;  3E35 A;  2HVJ C;  4WFB V;  2BOB C;  1W2B U;  2R72 A;  3TGU H;  2XAF A;  3DC5 A;  4DR6 O;  2RMK B;  3GB7 C;  5B1A B;  2CGN A;  4I7Z B;  1F23 A;  4I4T B;  1SQP H;  1YIJ V;  1VF6 A;  3CX5 F;  4DV1 B;  3AG2 B;  4DR1 O;  4EFB A;  2EIL B;  3DXR B;  1E1Q G;  3ABL C;  3DC6 A;  3EFF K;  4JAV A;  3OAA G;  4WFE A;  5KHJ A;  3E8B A;  3RYF B;  1F51 A;  4FZ1 A;  5JH7 A;  4LFB B;  5IJ0 A;  2P4K A;  3X2Q B;  1OCC C;  2IU0 A;  4P30 A;  1TGO A;  4N21 A;  1XMO B;  1HW7 A;  2UUA B;  1M4U A;  4KHP O;  3HB3 B;  4O4J B;  1PP9 H;  2EIL C;  4DW1 A;  4Q20 A;  4DR7 O;  2VQE O;  3BVO A;  3RYH A;  2BTQ B;  5L3G A;  4LF4 O;  1Y4M A;  4PA3 A;  2QJ1 A;  1R3J C;  1FXV A;  4JTA B;  2E5L B;  4TV8 A;  3B2E E;  2ZE6 A;  1DTO A;  2ZD9 A;  3L71 H;  5KA6 A;  1BL8 A;  3A0B Z;  1M93 A;  2UU9 B;  2LP7 A;  1M56 C;  4FLU A;  4ZOL A;  1N32 B;  4AQY O;  2EIN B;  3N2K A;  1SA0 A;  3JAR A;  4PA9 A;  1RP3 B;  4PA7 A;  4DV4 O;  4LF6 B;  3G71 V;  5IE9 A;  3X2Q C;  4B3T O;  1KUQ A;  1KQS U;  5JCO C;  1DGS A;  4NKG B;  3OGI B;  4DK0 A;  5D5Q A;  3E8G A;  2Q5Z A;  1ZL8 A;  1YVW A;  1O9H A;  5LP6 C;  1S5H C;  4RO2 A;  3JD2 A;  2WLI A;  1ROP A;  2YXY A;  2ZE7 A;  2KKW A;  2FB5 A;  1JJO A;  3OD4 A;  4GX0 A;  3K04 A;  1KYO F;  5BY1 A;  3WG7 B;  3D3Q A;  2ZM6 O;  5LL6 Y;  1YDX A;  2VWJ A;  5LA6 A;  1KKD A;  2LGQ A;  1AI5 A;  5JH7 B;  4QGP A;  1K97 A;  1AJP A;  3LSQ A;  4MTX A;  5LYJ A;  4X65 O;  5J2U A;  4PDM A;  1MMM A;  1G1X B;  2HHH B;  2OCC C;  2OYQ A;  1OZ0 A;  2IBZ H;  4UB8 Z;  2Q73 A;  3ASN C;  3SJB C;  3N2G A;  3P32 A;  2ZXW C;  3JAL B;  1IBM O;  2P6J A;  3E86 A;  3A0H Z;  3JD4 A;  1AP5 A;  2GSM B;  3ZRV A;  3W7X A;  1YCI A;  3QF7 A;  3JD1 A;  1ZL8 B;  2XOK G;  1TUB A;  4B3R O;  1XI1 A;  5IWA O;  1IBK O;  2HG5 C;  4BWA A;  3H1K H;  4FM1 A;  1AVM A;  3B77 A;  4D7S A;  1US6 A;  2UXB O;  4ZI7 B;  2IJI A;  1EN5 A;  4DV7 O;  2GDS A;  5CMU A;  2Q69 A;  2ETN A;  1SZT A;  4JI0 O;  3JAW B;  4AIL C;  2CE4 A;  4YJ2 B;  4J9Z B;  2F4V B;  2DYR C;  4ASU G;  4YY3 O;  1VP7 A;  5KLV H;  1AI4 A;  1GM9 A;  1JR9 A;  4K0K B;  4TV9 A;  2B1I A;  2NLJ C;  4DR4 B;  3CCU V;  2LQT A;  4JAS A;  4CBC A;  2NR5 A;  2O57 A;  4JI1 B;  4G27 B;  1GKF A;  4YHH O;  3W7S A;  2UXD B;  3QTC A;  1QHT A;  5DEC A;  2EZO A;  5KA5 A;  2IM9 A;  1XNQ B;  3C90 A;  1FS0 G;  4CZZ A;  5JWP A;  3DTU B;  1K33 A;  4YJ3 A;  2QDO A;  2F43 G;  4OX9 O;  4X89 A;  1KC8 W;  3ZRS A;  3ABK B;  1VEW A;  4EKW A;  1D5N A;  1YF2 A;  3QO7 A;  4RWU A;  3AK3 A;  3LDD A;  2H3O A;  2OCC B;  1NH2 D;  3HPL C;  1FJG B;  1Q82 W;  1KMI Z;  4LFA O;  1SQX H;  2KG7 A;  4H44 B;  4JI6 B;  2Y0P A;  3BA8 A;  2ZXW B;  1BHA A;  1BQ0 A;  3IC9 A;  4X62 B;  1AR4 A;  2HR3 A;  3B40 A;  1AR5 A;  3H1I H;  1U96 A;  4I9Q A;  3RYC B;  4QPK A;  2QSA A;  2GTA A;  2YI9 A;  3CHX A;  4AHC A;  3CE2 A;  5EYP B;  4FLV A;  4DYL A;  5LBQ A;  4JI6 O;  1XMQ B;  1PNL A;  3JSN A;  4LFA B;  2QWO B;  3IFX A;  2JRI A;  3CPW U;  3CXC U;  2RDC A;  4YXW G;  3AG3 C;  1B3Q A;  4UCV A;  2XT9 A;  1PL0 A;  1BGY H;  5FNV A;  2AHZ A;  3G80 A;  3HKB B;  4JYA O;  3BCC H;  2E3C A;  3JAM N;  2A9H A;  2R70 A;  1RSO B;  3JAT A;  4DUY O;  5ITZ B;  4I55 A;  1AI6 A;  4HYO A;  4ZBM A;  3K58 A;  4DRX A;  3ETG A;  3S3W A;  3K5L A;  3SPJ A;  3ICX A;  4NXN O;  1B6Q A;  2ITC C;  3EXA A;  3JAW A;  4K0K O;  2Y69 B;  1WAZ A;  4LF7 O;  1X4T A;  4U3J A;  1XL4 A;  4KFM A;  1L8D A;  4IIJ B;  5FPO A;  4YY3 B;  3ML0 A;  1I7F A;  3CMA V;  3IC7 A;  2YC0 A;  4X8A A;  1COW G;  3CCQ V;  2QM4 A;  4MTG A;  4CC6 A;  5CN0 A;  4UCO A;  2Q6A A;  4DV7 B;  3OUS A;  3WG7 C;  4MVS A;  2JGU A;  2PTM A;  1K92 A;  4BAY A;  3ZHR A;  4FVM A;  4F6R B;  3SPH A;  2WLL B;  2Y69 C;  2X6A A;  3JYC A;  2R9R B;  4MVQ A;  1S0V A;  4B3R B;  2F1M A;  4LR3 A;  4XDK A;  1W0J G;  4FMT A;  4J11 A;  1NS1 A;  4IYH A;  4BW9 A;  4R6Z A;  2EIJ C;  4PI0 A;  4IL6 Z;  2CTQ A;  4MVR A;  4MTO A;  4ABM A;  4J7J A;  1M57 B;  1NU1 H;  4LF8 B;  3JSL A;  1H2M A;  4YIP A;  5BR8 B;  4KXR A;  3G4S V;  4FFB A;  4U7O A;  1W59 A;  1KBH A;  3T4Z A;  4MSW C;  1YJW V;  1OJH A;  2L35 A;  4MW8 A;  1W0K G;  3OTO B;  3BEH A;  1FXK C;  5H2F Z;  2WA4 A;  3RW0 A;  4JI8 O;  4MVM A;  2CH7 A;  4FPP A;  4IGG A;  1LNQ A;  1NI8 A;  4J7Z A;  3RT3 C;  2DOS A;  1R3L C;  1MOF A;  4B7K A;  4B08 A;  3K5M A;  4DR5 O;  1SS3 A;  3UM7 A;  1WPX A;  1ZX3 A;  4O2B A;  3AK1 A;  4GYC B;  4YIO A;  3HKD B;  3LNN A;  3ZMT A;  1WP7 A;  1SF9 A;  2AGA A;  4HZ3 A;  2C2A A;  4H37 A;  2H94 A;  1WJZ A;  1QCE A;  4PA6 A;  2A0L A;  3JAK B;  4HBN A;  5H6R A;  4KL1 A;  1N32 O;  4OGQ B;  2L6L A;  4JI4 O;  2UU9 O;  4TV9 B;  1VF7 A;  4JI7 B;  4O4L A;  1ZAU A;  3OEH G;  4NXN B;  3FD9 A;  3CCR V;  3K9A A;  4LF4 B;  3SJC C;  5H9C A;  3SPC A;  1ORQ C;  2HVK C;  1NTZ H;  3I55 V;  5JQG A;  3G67 A;  1MZE A;  2YIB D;  2VQE B;  2VWK A;  1Q6H A;  2Q7H A;  2WA3 A;  1F7Y A;  4WCE V;  2P5O A;  5IJ0 B;  3ABL B;  3A0R A;  2YXH A;  1V9P A;  1RPR A;  2FML A;  2OCH A;  1E79 G;  4JYA B;  2B9Z A;  4LFB O;  4JZG A;  3VOU A;  3VQW A;  1OCZ B;  2M7W A;  2UXX A;  5CBF A;  4K8Z A;  1TUE B;  2MK3 A;  5IJ9 A;  2P06 A;  3WB0 A;  4DV0 B;  3B8M A;  4DR1 B;  2X6C A;  1XMQ O;  4DV1 O;  1Q43 A;  5BMV A;  1J5E B;  2GUZ B;  3CME V;  1QLN A;  2KB1 A;  1WLE A;  1NTM H;  3W7U A;  2QE7 G;  3PN1 A;  1WN7 A;  5L3C A;  1GK9 A;  2LFR A;  4R7C A;  5KX5 B;  2VRZ A;  4X62 O;  1QLE C;  3ASN B;  1K34 A;  1IVS A;  3FFQ A;  1Q6I A;  2FKX A;  5IYB O;  4JYY A;  3GVM A;  2W6J G;  1YZB A;  3BFR A;  4FM2 A;  1JFF A;  4X20 A;  1KU9 A;  1VQ5 V;  2UXC O;  1R6T A;  4QIW F;  3WU2 Z;  2ILM A;  1FFX A;  1UJW B;  2HP8 A;  1TVK A;  1QVG U;  2RJZ A;  5JJN B;  1RM1 B;  1EFR G;  2WSS G;  5IYZ A;  3O9O A;  1YTF D;  3TXQ A;  5IJ9 B;  3D3I A;  4YHH B;  3ZHV A;  3HKE A;  1R3K C;  2IW5 A;  1SET A;  1XNR B;  1VQK V;  3AG4 B;  3LNM B;  4N23 A;  3OT7 A;  4DR4 O;  3P3N A;  2K9P A;  1F4M A;  4FJC C;  5IY5 B;  5LOV B;  5EC1 C;  4PA4 A;  3SYO A;  3LSU A;  4Z2W A;  3ZRW A;  2XAJ A;  1AI7 A;  2QR4 A;  2F4V O;  2ADQ B;  5JVD A;  1ZWI C;  3CWB H;  3CRR A;  5LGT A;  2HKO A;  3LUT B;  2ZQM A;  3K08 A;  3R66 A;  3CCE V;  3TK1 A;  2CTR A;  2WWW A;  1FFT B;  5EZY A;  4JF3 A;  2AXT Z;  3ABM C;  4OPA A;  5KUK A;  2EJ7 A;  4U7N A;  5IWA B;  1AP6 A;  1KP2 A;  5J2U B;  3SJQ C;  3DSQ A;  2IJJ A;  2BSK B;  3CJH B;  1HNZ B;  3FKS G;  1I08 A;  1GH6 A;  3OFN G;  1G4Y B;  4MW3 A;  4DV6 O;  1YEW A;  1WPB A;  1XDC A;  2PZS A;  2CDY A;  1H2L A;  4LNU B;  2QWP B;  3SYC A;  4ZKI A;  2ZDI C;  3AG2 C;  4GX5 A;  1QQC A;  3H9V A;  3T2M A;  3UT5 B;  2IH1 C;  2PYJ A;  2DYS C;  1J95 A;  3C3S A;  4AI8 A;  1JMK C;  3IJ4 A;  2ODM A;  4DO2 A;  3OM3 B;  2A79 B;  4KP4 A;  2PI4 A;  2D3O W;  1SQG A;  2QKC A;  2CAZ C;  1AB3 A;  2PYL A;  5FL7 G;  2EZP A;  2V4D A;  3SYQ A;  2JDI G;  4I0X B;  1JFF B;  3UT5 A;  1NR7 A;  1M57 C;  3QG5 A;  1KB9 F;  2GHY A;  4JYB A;  1Q86 W;  1Y66 A;  2WPD G;  1XIL A;  1NZ6 A;  2LFS A;  3K0D A;  5KX5 A;  1H38 A;  4X1I A;  3OMI B;  2JJ2 G;  4PD4 F;  4X9Q A;  3N27 A;  4JGS A;  4HNA A;  5LXT B;  2JEU A;  1MNG A;  3FYI B;  2F66 C;  4NR1 A;  4LWS B;  4JV5 B;  4K8X A;  4TWK A;  4DV4 B;  2QGN A;  3EVK A;  1AIL A;  1DLB A;  1GM7 A;  1WP8 A;  1P49 A;  1EN6 A;  3UO2 A;  4H0L B;  2OTJ V;  1P84 F;  4UCT A;  2V7Q G;  5KHH A;  2Q4P A;  5KMG A;  1YHQ V;  2YIA A;  3ZMS A;  4UUJ C;  3IAY A;  1AJQ A;  1VF6 C;  3MDS A;  3B09 A;  1SQQ H;  4J9Y B;  4TUY A;  1ZSP A;  1KP3 A;  1Y76 B;  4O2A B;  2FYU H;  4LWS A;  2DQ0 A;  5L3E A;  2JGD A;  2PF4 E;  3SYP A;  3VQY A;  2ZKO A;  2A3Q A;  4X64 O;  4Q6G A;  4DV6 B;  2OTL V;  5J2T B;  1YTF B;  4LCU C;  5BMV B;  5GTI Z;  4LBE C;  5JJJ B;  1NH2 B;  5B3S B;  1QR9 A;  4MVO A;  3F7V C;  3AG3 B;  2YSU B;  2YIC A;  3EHB B;  5KMG B;  5C8Y B;  1NBM G;  2RNB A;  3OMN B;  4TSF G;  1SKV A;  1DF5 A;  1N8R W;  2EBO A;  1Y76 A;  3SR2 C;  2QA4 V;  4LNU A;  3KKY A;  2CUG A;  3L9D A;  3M7M X;  4L87 A;  4F6E A;  2XAS A;  1JJ2 U;  2ZIM A;  3H1H H;  4O4H A;  3U11 A;  4LC1 A;  1QBZ A;  2JS5 A;  1I94 B;  5EK0 A;  2DN9 A;  3BAB A;  4NVP A;  3HKC A;  2DW4 A;  1GTO A;  1QR8 A;  4ZI7 A;  3JCZ A;  4DRX B;  1Q7Y W;  1I0H A;  4B3S O;  4NXM B;  3OUF A;  3CB2 A;  3K9S A;  4DR2 B;  3ZRW B;  3ZHS A;  1VQP V;  5DN6 G;  1YJN V;  3M8A A;  1A32 A;  4DR2 O;  1S76 D;  4MS2 A;  4NXM O;  5LP6 A;  5LHG A;  3WFV A;  3FB6 C;  1YXB A;  3D36 A;  1LR1 A;  5JVD B;  4JI5 O;  4I0X A;  2BCC H;  4TOI A;  4GKJ B;  3D36 C;  2ZNI A;  4CC5 A;  1Z5W A;  4HAM A;  5K1X A;  4JAA A;  5LGN A;  1VMG A;  3TJT A;  1TVK B;  5HFL A;  4CH4 A;  1JPX A;  1UPG A;  1YI2 V;  1FPO A;  3CRQ A;  1J5E O;  1XBL A;  2QM7 A;  4RUE A;  1Q8I A;  3IGA C;  3CCL V;  4UB6 Z;  2VQF B;  1PL4 A;  2E75 B;  4BW5 A;  2N04 A;  3AG1 B;  3JAS B;  4UV8 A;  1SES A;  1E1R G;  4ICG A;  2YIB A;  2XAH A;  1R3I C;  2ZIN A;  5KAI Z;  3QNE A;  1SER A;  3P30 A;  2AZ2 A;  2AZ0 A;  1R1B A;  4J7K A;  4IIJ A;  4DV5 B;  5LGU A;  4TUY B;  5EC2 C;  1P4R A;  4R50 A;  4B3M O;  5LP6 B;  4EB6 A;  4I50 A;  3E83 A;  2Y48 A;  3HKE B;  1Z5V A;  3K0G A;  1FD9 A;  1NT2 B;  3WB1 A;  3E2E A;  5LMN B;  2LW7 A;  4GLX A;  1OCR B;  1P7B A;  3OMA B;  5FPR A;  1S5L Z;  3JAS A;  4JI7 O;  3E89 A;  3OTF A;  3T1C A;  4JI4 B;  2IJH A;  1TUB B;  2QWR B;  1RPO A;  2HJF C;  4X1K B;  5H5N A;  1JOY A;  2QEX V;  3CP1 A;  1QVF U;  3VQX A;  1PPJ H;  2UUB B;  3ZIA G;  4I50 B;  2Y0I A;  2F95 B;  4W4L A;  1M90 W;  1EBO A;  5KHI A;  1R6N A;  2YI8 A;  4LF5 O;  1NR1 A;  2QTS A;  3KCX A;  1JQ0 A;  3UQ8 A;  3BA9 A;  1M56 B;  2ZR3 A;  2JIZ G;  4D7T A;  3DGE A;  2BTO A;  5GW7 A;  5CB4 A;  4PDV A;  4I55 B;  2P67 A;  1V54 B;  4EB6 B;  2F23 A;  2LGW A;  3DXR A;  5BZB A;  3ZMU A;  4X20 B;  1EZV H;  4PHZ A;  5B66 Z;  3BPZ A;  3RN4 A;  2QTO A;  5L3D A;  5EBL C;  1NTK H;  3OTO O;  1Q6U A;  1TA8 A;  2RQ6 A;  1S77 D;  3SPG A;  3K79 A;  2G38 A;  4K3A A;  2W6I G;  1XHZ A;  5BR8 O;  4BIU A;  3JAR B;  4E2L A;  4BIZ A;  5CA1 B;  3L75 H;  4GX1 A;  1YSC A;  1T5E A;  1S3J A;  3K3W A;  1XEQ A;  3ZRX A;  4K35 A;  2E76 B;  1N33 O;  3K5N A;  1WA8 B;  1Y6X A;  3OEE G;  5JCO A;  2X0L A;  3M99 B;  2LW1 A;  3LSS A;  2YXL A;  1BHB A;  5GTH Z;  2UUC B;  3U0Z A;  1PKX A;  5DM6 V;  5J9P C;  4LF9 B;  1V55 C;  4X1I B;  3F5W C;  1P7G A;  5LHH A;  3LDC A;  2OT5 A;  2BTQ A;  2CH7 B;  3VBB A;  3ETQ A;  1N36 O;  2YS8 A;  3T1H B;  4R8C A;  5LOV A;  2JS3 A;  1IDS A;  3CRC A;  2XAQ A;  4IYI A;  4FIP C;  1JVM A;  1Q90 D;  1U97 A;  4O4L B;  3PJS K;  3E8H A;  3L73 H;  1JCH A;  2YEV B;  3ZHT A;  1WNS A;  1XNR O;  3LDE A;  2FL4 A;  2F93 B;  2OIE A;  4WFF A;  1HP8 A;  4QE7 A;  1OHH G;  1WB7 A;  4Z1V A;  4JI2 O;  3O65 A;  4DR3 O;  1SRY A;  2GBO A;  4JYC A;  3MAQ A;  1YIT V;  5B1N A;  5EZY B;  4JTD B;  4QJF B;  2BOC C;  4DUY B;  2QKS A;  5B1A C;  3OR6 C;  3QO5 A;  2EJR A;  2Z3Y A;  5KUM A;  2IJK A;  4LH6 A;  3GWK C;  4UVA A;  2UXC B;  2WLK A;  2EX3 A;  3NR7 A;  3G6E V;  3H1L H;  3OGC C;  3J7A U;  2ZCE A;  3AG1 C;  3W7W A;  3BY6 A;  3ZCC A;  4P2Z A;  3UCS C;  1VAR A;  4YJ2 A;  2YID A;  4XBF A;  2HEP A;  1IZ3 A;  1D2D A;  2KQX A;  4FFB B;  4DV2 B;  1UFI A;  4DV2 O;  4D6T H;  2UXN A;  2WLI B;  1GAX A;  2X7R B;  1FKA O;  2YEV A;  4W4K A;  3MD0 A;  4CS3 A;  1Y74 A;  3ASO C;  4DV0 O;  5A2Q N;  1FJG O;  3CC4 V;  2ITD C;  1FXH A;  3SJA C;  3JAK A;  1G6U A;  3RYI A;  2AHY A;  1OV9 A;  4H13 B;  4RQF A;  2Q67 A;  4IHJ A;  4WBN A;  2V1D A;  3T1Y O;  4FFK A;  1JA8 A;  1DF4 A;  2DMX A;  1K73 W;  1GRJ A;  4OX9 B;  4X1Y B;  1RFY A;  2E74 B;  2WLN A;  4O2B B;  5KHK A;  1VQN V;  1VF5 B;  2XHB A;  5EBW C;  1HNW B;  4L8J A;  1ZUQ A;  4UVB A;  1URF A;  1VQM V;  4DR3 B;  4JI2 B;  4E4E A;  1VQ7 V;  2UXD O;  1GMG A;  4TQD A;  4XDL A;  3E8F A;  3RFR A;  1FYJ A;  4FLX A;  1BQZ A;  3RBZ A;  3BRC A;  4DV3 B;  4ZHQ A;  1VQ9 V;  2BE3 A;  3ZED A;  3B8N A;  2CTP A;  1MSD A;  2NNU A;  4FM0 A;  2Q9L A;  4CH5 A;  1FXK A;  5CB4 B;  1K4D C;  4GUN A;  1V54 C;  4CS4 A;  1N34 O;  4UCR A;  1VQ6 V;  4H33 A;  1MZF A;  2A7W A;  3ABU A;  1N36 B;  1KEC A;  1GO3 F;  1VQ4 V;  1B06 A;  2P4V A;  1Z2G A;  1PNK A;  3AK2 A;  3VQV A;  1M5I A;  3AG4 C;  1VQ8 V;  1QNM A;  1WA8 A;  1R73 A;  1IBK B;  1LUV A;  4TQF A;  4LF9 O;  1H2N A;  1JX9 A;  5JJE B;  4PI2 A;  3RYC A;  2UUC O;  3A8T A;  5E1A C;  4DR5 B;  1S72 V;  1VIB A;  1H2G A;  1OCZ C;  4QNH B;  3STZ C;  2B5U A;  3ZBH A;  1FAF A;  3N2K B;  3CXH F;  1IBM B;  1NKD A;  5EYP A;  3CRM A;  5EIB C;  2DWD C;  3ZMV A;  3MHS C;  1CPY A;  3RYI B;  5TIS Z;  3CS5 A;  2WLL A;  2PGG A;  1L0N H;  3RYF A;  4JI8 B;  4C7U A;  4EFE A;  2EIK C;  1CXZ B;  1QU7 A;  3K06 A;  4WFG A;  1S5J A;  2ZIO A;  5CA3 A;  4X65 B;  4MTF A;  2DJV A;  2Y4U A;  3NXS A;  5AG2 A;  3P3P A;  2HLD G;  2Q68 A;  1XRE A;  3HKC B;  1G8M A;  2CK3 G;  5DED A;  3RYH B;  3OW2 U;  2ZR2 A;  1BMF G;  2ZM6 B;  5EBM C;  4LF8 O;  4PJ0 Z;  1CP9 A;  4DXW A;  1K4C C;  3ZN1 A;  4FLT A;  1SQV H;  4UV9 A;  2FTK A;  2WAM A;  5LA6 B;  5K1P A;  2VS0 A;  3K57 A;  5D5P A;  1GN6 A;  1NVP B;  4NYK A;  4WFH A;  4NB5 A;  5KHG A;  4X1Y A;  2JVD A;  1RSO A;  3JAT B;  5C8Y A;  3CCM V;  2R9I A;  4B3T B;  3D8C A;  1R6K A;  4I4T A;  5IYZ B;  5C93 A;  4CH6 A;  3BHP A;  1YJ9 V;  3CYO A;  1F4N A;  2YDE A;  5IDJ A;  3JD0 A;  4O4I A;  3H01 A;  1N34 B;  3QO8 A;  4AQY B;  1EN4 A;  3ZJZ A;  3OR7 C;  4J10 A;  3UO3 A;  4JZ2 A;  4LF7 B;  3FX7 A;  4DV3 O;  3BAA A;  2Y4T A;  1BT8 A;  5ITZ A;  4IT5 A;  1K9M W;  2P90 A;  4FZ0 A;  4GZR B;  1VQO V;  3SGI A;  5HFM A;  1Q3E A;  2Q0A A;  4IHJ B;  3ZHQ A;  4WBN B;  4B3M B;  4DR7 B;  2Q7G A;  1HNW O;  3AG7 A;  4UXN A;  4KHP B;  3K59 A;  1KKC A;  1XMO O;  3T4D A;  3HR0 A;  1AR1 B;  3T1Y B;  1H8H G;  2PY5 A;  3APQ A;  2K1E A;  2VQF O;  1SA0 B;  2CGO A;  4MVZ A;  5H6Q A;  5CA0 A;  1XUQ A;  1NJI W;  1I5Y A;  2WLJ A;  2ATK C;  1K7D A;  1KD1 W;  4GCZ A;  3ZS8 C;  4QPJ A;  1IXB A;  4I9W A;  4FLZ A;  2ZT9 B;  3ZMZ A;  4DK1 A;  1BZK A;  3S3X A;  1ZTE A;  4A5U B;  3G6B A;  4DR6 B;  3E22 A;  3KZI Z;  3TCU A;  1NQT A;  3E22 B;  1PD3 A;  4WF9 V;  2ZNJ A;  1Q81 W;  4UFZ A;  4GKJ O;  2QWQ B;  3CD6 V;  1ENV A;  4J80 A;  3AEI A;  2MW2 B;  3UKM A;  4JI5 B;  2R9A A;  3N2G B;  4FK5 C;  1SZX A;  1VQL V;  3APO A;  1LUW A;  4NTX A;  3ZHU A;  2P7T C;  1GN2 A;  3CRA A;  1V55 B;  3JCU Z;  1HR0 B;  3H1J H;  3I5D A;  1I5X A;  4DW0 A;  2EIM C;  5LXT A;  5GON A;  1N4C A;  4FLY A;  2XTA A;  1XNQ O;  5LHI A;  1HNX O;  4O2A A;  1NVP D;  3QVN A;  4UCU A;  3CCJ V;  1N0N A;  4JI1 O;  3R65 A;  1WB8 A;  2GTS A;  5KAF Z;  3RVZ A;  1OCC B;  1XL6 A;  4DUZ O;  4RAI A;  3GWO A;  1TAE A;  3CCV V;  4I5S A;  1I94 O;  2A06 H;  4X88 A;  5EIB D;  4GX2 A;  3ABM B;  5GON B;  3U10 A;  3THO A;  4BIO A;  4FLW A;  3TET A;  2BSK A;  3CJH A;  1ZLZ A;  2PI5 A;  5L3B A;  4JI0 B;  1BSM A;  1HDJ A;  4JI3 O;  5E79 Z;  5FLX N;  3C3T A;  2Z5U A;  3T1H O;  3FB7 C;  3CC7 V;  3JAL A;  5JQG B;  3RWR D;  2UXB B;  3TXS A;  5CA1 A;  2ZE5 A;  4WFA V;  4KUM A;  2PUS A;  4QE9 A;  3KG2 A;  2KG7 B;  2Q8V A;  2XND G;  3CSX A;  3ABK C;  3B4S A;  2EIM B;  2XAG A;  4ZHQ B;  1RM1 C;  4G2K A;  3OE7 G;  1N33 B;  3J81 N;  4LP8 A;  4PV1 B;  3WB2 A;  4HNA B;  2JGD B;  2ZDI A;  1OCO B;  4G28 B;  3W7T A;  1PM9 A;  2AW9 A;  4X64 B;  1SC5 B;  1EZJ A;  5B1O A;  1HWY A;  2IU3 A;  4OPH A;  2HHH O;  3CEI A;  5F2V O;  1PNM A;  3RVY A;  1Q5O A;  3FAV B;  3Q4H A;  2ARH A;  5CBH A;  3CCS V;  1ARO P;  2OWO A;  1L0L H;  1GN4 A;  5CBG A;  5IYC O;  2WLH A;  3ZX6 A;  2RCV A;  2EIJ B;  5CA0 B;  3ETD A;  2JEX A;  5BXZ A;  4JV5 O;  1PV0 A;  1SQF A;  1K3E A;  2GUZ A;  4XDJ A;  4TT3 G;  4UVC A;  4GKK O;  2EUL A;  3K03 A;  5LMU B;  1OCR C;  4X66 O;  3HKB A;  3L72 H;  2EIK B;  4X66 B;  5LMU O;  1H8E G;  1XHX A;  1THZ A;  2DWE C;  2ZE8 A;  4J42 A;  1MA1 A;  3FB8 C;  5B3S C;  4LF5 B;  4GKK B;  4U3F H;  1BS3 A;  1N0J A;  3K5O A;  4EEQ A;  4LF6 O;  5B5E Z;  5IYD O;  1CEZ A;  2W0X A;  1Y74 B;  3RGB A;  2UUB O;  2Q7E A;  5B1B C;  4B7E A;  3JD3 A;  4Z1M G;  3MHH C;  4JAU A;  2H8P C;  4F4L A;  5IT9 N;  5A9G A;  5FNV B;  5IY5 C;  3CC2 V;  4MVU A;  4CH3 A;  2W0F C;  1AJN A;  1XOU A;  3ZN0 A;  4JPR A;  1B04 A;  3STL C;  4OXS A;  5L3F A;  2E5L O;  2XUM A;  4LH7 A;  5LYJ B;  1H2S B;  1K8A W;  1GM8 A;  4BR6 A;  5B1B B;  4RQE A;  3L74 H;  5LMN O;  1SQB H;  1EM1 A;  1D5A A;  2HFE C;  2DYR B;  2QKA A;  2WLM A;  4F6R A;  2DE0 X;  2QM8 A;  2CTW A;  3F7Y C;  1Y67 A;  4ZIB A;  1K5S A;  2OIG A;  1H2K A;  1HNZ O;  4DV5 O;  1IX9 A;  2N05 A;  2DQ3 A;  3L70 H;  2UUA O;  3ETE A;  3A2F A;  2JK5 C;  4JTC B;  2N74 A;  3I56 V;  1QLE B;  4O4J A;  1X59 A;  2GV9 A;  2Z0A A;  2QWN B;  4ZOL B;  3ABT A;  1M1K W;  2JJ1 G;  4UCS A;  1OCO C;  1L1F A;  1K5Q A;  4MT8 A;  1MAB G;  4PDR A;  2Q0O C;  2X6B A;  1XQ8 A;  1MG1 A;  1IXM A;  1O9G A;  4PEL A;  4JI3 B;  4P9P A;  1FFX B;  2ADP A;  2YUA A;  3J80 N;  2IH3 C;  2D2C B;  3FYE B;  1FXK B;  2RN9 A;  1MSW D;  4U3J B;  3HKD A;  3FB5 C;  2M6Y A;  4X1K A;  2DYS B;  2EIN C;  3SPI A;  3F5T A;  4J41 A;  4DUZ B;  2KSD A;  1M9N A;  1IBL B;  4NTY A;  3SDL A;  1BE3 H;  1HNX B;  4CS2 A;  4TV8 B;  1DK1 A;  2HJD A;  4LFC O;  2NN4 A;  3FAV A;  3Q4H B;  4LFC B;  4O4H B;  3KCY A;  4YJ3 B;  4NTW A;  1HR0 O; 
#chains in the Genus database with same CATH homology
 2QWP B;  2DMX A;  1BQZ A;  4RWU A;  2QSA A;  2CUG A;  2QWQ B;  2L6L A;  2EJ7 A;  2N05 A;  2YS8 A;  3UO3 A;  3AG7 A;  1N4C A;  4J80 A;  2LGW A;  2CTP A;  2YUA A;  1IUR A;  1FPO A;  2GUZ B;  1FAF A;  2OCH A;  1XBL A;  3APO A;  2Y4T A;  2LO1 A;  1HDJ A;  1BQ0 A;  4J7Z A;  2GUZ A;  2QWO B;  1WJZ A;  2QWN B;  3UCS C;  3BVO A;  4IT5 A;  2M6Y A;  2PF4 E;  2QWR B;  1GH6 A;  2KQX A;  3UO2 A;  2DN9 A;  3APQ A;  2Y4U A;  2N04 A;  1NZ6 A;  2CTQ A;  2CTR A;  2CTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...