2LO1A

Nmr structure of the protein bc008182, a dnaj-like domain from homo sapiens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
GMVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily A member 1
publication title NMR structure of the protein BC008182, DNAJ homolog from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2lo1A00
3APOA 2LGWA 3BVOA 2QSAA 2GUZB 2DMXA 2DN9A 3APQA 4IT5A 1N4CA 2N05A 2CTWA 2L6LA 4J7ZA 2OCHA 1WJZA 2PF4E 1GH6A 3UO3A 1XBLA 1BQ0A 2QWOB 2N04A 1NZ6A 2QWRB 1BQZA 4J80A 2QWQB 2Y4UA 3UCSC 4RWUA 1IURA 2CTQA 2QWNB 2YS8A 2EJ7A 2M6YA 1FPOA 2KQXA 2CTRA 2CTPA 3AG7A 1FAFA 2LO1A 2QWPB 3UO2A 2YUAA 2GUZA 2Y4TA 1HDJA 2CUGA
chains in the Genus database with same CATH superfamily
1NH2D 2RCVA 1B6QA 3G67A 2GV9A 1JJOA 2Q67A 4UVAA 2OT5A 2LGQA 2JGUA 4H13B 4MTXA 3RFRA 3CC4V 2HR3A 3OUFA 3IGAC 1NR7A 1JMKC 2C2AA 4MTGA 4F6RA 2V1DA 1BL8A 1R3LC 3ETQA 4BIUA 4X62B 5C93A 1EM1A 2DQ3A 2WLNA 4GLXA 4JTAB 1AILA 4LCUC 2E75B 2OCCC 5IDJA 5LL6Y 5JCOA 4TV9A 3SYOA 4JYAO 3DXRA 1PNLA 4FM0A 1BZKA 5GTHZ 5IJ9A 2QKSA 5EIBC 4AI8A 5K1PA 4O4HA 4DR6O 1NZ6A 1AJQA 5KAFZ 1FJGO 3JALB 3ZRWA 2FMLA 4JZGA 4MVQA 2YIAA 3ZHTA 3OW2U 3B09A 1U96A 2QM7A 4BW9A 1XOUA 3ZMVA 4KXRA 5CA1A 2L35A 2P4VA 3D3IA 5J2UA 2P6JA 4P30A 3JD1A 1N4CA 4RQFA 1IXBA 4FLZA 1W0KG 4LF7B 4MS2A 3CCQV 1N36B 3WB1A 3FB5C 2EINB 4UVCA 2QDOA 2JRIA 5L3DA 3FKSG 4TQFA 1SA0B 1M9NA 2PI4A 1VQ4V 1FYJA 3D3QA 3JYCA 4XDKA 4GKJB 1N32O 2YI8A 4GX0A 4L87A 2Q0OC 3DTUB 1N34B 4JI2B 4JAAA 4CH5A 1P4RA 4JI1B 2HVKC 4WFBV 3CEIA 1SQXH 2UXBB 5L3BA 1XL4A 2ZM6B 1AB3A 2HHHO 2E74B 3S3XA 5FNVB 4O2AA 2P22C 1KD1W 4MVRA 2ZR3A 4NVPA 4W4LA 4GKKO 1JCHA 2VWKA 1NTMH 2ARHA 4I0XB 3ZEDA 4NXNB 4MVMA 3QTCA 4Z1VA 4H0LB 4HNAA 4A5UB 3RYCA 2CAZC 5KUKA 2YIBA 2Y4TA 4LF5O 3G4SV 1AP6A 4X1IA 3APQA 4HYOA 1XEQA 3R65A 3I56V 4G2KA 4O4LA 1FXHA 1F7YA 4HAMA 1S5HC 1MSWD 3ASNB 2P4KA 1Q5OA 1K4CC 1OV9A 1O9HA 1S77D 3HKDB 1ZL8A 3MHSC 3N27A 4LFCO 3CRRA 3W7XA 5CB4A 2E3CA 3ABKB 1K97A 1VMGA 3TCUA 3B8MA 2WA3A 2YDEA 5FL7G 4X20A 4OX9O 3CRCA 5JQGA 2ATKC 2JGDB 2QM4A 1YVWA 2UXCO 3SPHA 1N0NA 1VQMV 3K5LA 2DE0X 5CA0A 4DV6B 3ZHVA 4X1KA 3W7TA 4YJ3A 2L6LA 2AHZA 2Y0IA 4RO2A 2F4VO 2XT9A 3K79A 2OIEA 4NB5A 3K3WA 3I5DA 1M93A 4F6EA 3H1HH 4YHHB 1E1RG 4O4JA 4JI4B 2A79B 3D36C 3U10A 4TQDA 3IC9A 3DC5A 3WG7B 5JWPA 2BTQA 2UU9B 5LGUA 2WLKA 4O4IB 3TXSA 4NYKA 3ASNC 5DEDA 4I9QA 3AG1B 1BMFG 2LW1A 3QO7A 4H44B 4LFAB 3ZHQA 5LMUB 1KBHA 3CSXA 1SESA 1K5QA 4UCTA 4QGPA 3SDLA 4X62O 3CB2A 1I08A 2W0XA 3Q4HB 1R3KC 2JDIG 3LSSA 4J41A 3OFNG 3P3NA 4J80A 3UKMA 5BR8O 2ETNA 4J9YB 3K5NA 3VBBA 1LNQA 1K3EA 1K92A 2GUZA 4B3TB 3LSUA 1XMQB 1Q82W 1GM7A 2M7WA 3W7SA 1JFFB 1RPRA 1OHHG 4IHJB 2DQ0A 3AK1A 1M57C 4EB6A 3GB7C 3SYPA 2F66C 1N36O 3ABUA 1KYOF 5JVDA 3CPWU 5EBWC 4PDLA 2EIJB 4D7SA 4CH6A 2LGWA 2BOCC 5IYZB 1T5EA 2PI5A 2CK3G 4FFBA 1PKXA 4JAVA 3J7AU 1R6TA 3WG7C 4GKJO 1B06A 1NT2B 5JJJB 4YJ2A 2FL4A 3RWRD 2QWQB 2ZXWB 1N34O 3K5OA 4RQEA 1VQOV 4C7UA 4JI2O 3H1KH 3SGIA 5CBHA 3AG1C 3FFQA 3APOA 1W2BU 2GHYA 2UXBO 2NLJC 2DYRB 2ZM6O 2WAMA 2HJFC 2Z0AA 4IGGA 4OPHA 2X6BA 3JCUZ 4DV7B 4DR4B 2PGGA 1JX9A 1M90W 2YIDA 3K59A 1KKDA 2P67A 4JGSA 4NXNO 3T1CA 4ZI7B 2X6CA 4I9WA 2Q7HA 3P3PA 5CMUA 1Y4MA 2CTWA 3B77A 4DR7B 3B40A 3K57A 3J81N 1XQ8A 2XAGA 2ZR2A 3BABA 5BMVA 3CXCU 4I55A 5D5QA 3ZBHA 1AI4A 3ML0A 2RNBA 1Q6HA 4QE7A 2CTRA 3K08A 5KMGA 5TISZ 4PDVA 4PA7A 3ZJZA 3F7VC 3U0ZA 1Y6XA 2QWRB 1GN2A 2DW4A 2P5OA 2JK5C 4LF8B 4ZOLB 3ABLB 2ZXWC 1YI2V 1MZEA 3AG2B 3JD3A 5IJ0A 3JATB 1NQTA 4PELA 3EXAA 1R3IC 4AQYO 1GN3A 2R9AA 5JH7A 2DYRC 3L74H 4O2BB 5LOVA 4DV6O 3IAYA 2ADQB 1H2KA 3K9SA 4RUFA 4DV1B 1R6KA 2W6IG 4FJCC 3AG4B 4LF9B 2KSDA 4RWUA 2F23A 1H2GA 3JARA 1N8RW 1CXZB 5LHHA 3P30A 4PI0A 1GMGA 4F6RB 2EIMB 1Z5VA 1WN7A 2BSKA 4YHHO 3RBZA 3STLC 5E1AC 4JI4O 1TUBB 4U7OA 4F4LA 2JS5A 4X89A 1WA8A 2WLIA 3EFFK 4YY3B 1S5LZ 3BAAA 4JI0B 3QNEA 1KC8W 4EEQA 2FTKA 2UU9O 4I5SA 1FXVA 3E22B 4JI6B 4Z2WA 5B5EZ 1XHXA 3LNMB 4LFAO 5CA1B 2PYLA 2N05A 5LMUO 4JI7B 1G6UA 3JASA 4U3FH 1IVSA 3ZHSA 3SYQA 1YHQV 4QNHB 2ZINA 2B9ZA 2Z5UA 5DM6V 1UFIA 4PA4A 1J5EB 4B3SB 5CBFA 5LYJB 2QGNA 1PPJH 3JAKA 4LWSA 3AG2C 3ZN0A 5LP6C 1YITV 5EIBD 1XNQO 2Q0AA 4MT8A 3A0BZ 3VQVA 4B3TO 1SZTA 5D5PA 1XMQO 3O65A 4BW5A 3ZRXA 2F1MA 1LUVA 5A9GA 4DV3B 4B7KA 4JYCA 3RYIB 2Q69A 4WCEV 3AG4C 4D7TA 4JTCB 3UO2A 3M7MX 1GO3F 5LBQA 2IH1C 1MABG 3W7WA 1H8HG 2PYJA 5IT9N 1WJZA 3BY6A 4X9QA 1ZLZA 1BHAA 1ORQC 2YEVA 2MW2B 2DYSC 1BGYH 4TV8B 1IBKB 5HFMA 2ZDIC 2VQEB 1GM8A 5B1OA 1WB7A 1Y76B 4DRXA 1PV0A 3OT7A 2ODMA 4X1IB 1VQPV 2XNDG 1MSDA 4LF6O 2XAQA 1EZJA 4U3JA 4IIJB 4DK1A 4UCUA 4GX2A 3UT5A 1AVMA 2HKOA 2GSMB 3CRQA 1QQCA 3MHHC 4LNUA 2R9RB 1S5JA 4DYLA 1TUEB 4FMTA 2IJJA 3T2MA 4WBNA 4DV7O 1M4UA 1CEZA 1HDJA 2CGNA 1NTZH 5ITZA 4FLUA 2EJRA 2FYUH 1RP3B 1ZL8B 4DV2O 2WWWA 4MW3A 2EBOA 2LFSA 1W0JG 1VF6A 1VQ9V 4DUYO 3OEEG 3OR7C 4DR7O 4NTWA 1VF7A 4X20B 1D5AA 3RVYA 3RYHA 3ZMSA 2IH3C 2ZIMA 2JS3A 2KKWA 3CCLV 3HKEB 3T1YB 2V4DA 3T1HB 5K1XA 1LR1A 1HNZB 4UVBA 3UM7A 2CH7A 4R8CA 2ZD9A 3OGIB 5KX5B 4B3MB 3ZMZA 1NI8A 3C3TA 5J2TB 4X1YB 1GN4A 3E8FA 4O4JB 5KHHA 3CJHA 4LF8O 5EBLC 1KB9F 1VQKV 3DSQA 1DGSA 2K9PA 2BTQB 2EX3A 1OCCB 4QE9A 3ETEA 4P2ZA 2ZCEA 3CS5A 3E8HA 4NTYA 5KA6A 4DV1O 2ZT9B 4JF3A 1WP8A 3NR7A 4TT3G 4FIPC 4DV4O 2Q7GA 1X59A 3U11A 1MMMA 4DUZB 1EN5A 4FM2A 2A3QA 5DECA 4LF4B 2A7WA 1Q8IA 3TXQA 1BQZA 4W4KA 1E79G 2Y4UA 4MSWC 4XDJA 3E2EA 4FZ1A 4D6TH 3BCCH 1M56B 4JI0O 2GUZB 4B08A 4GUNA 4JYBA 2GBOA 3S3WA 1SZXA 4JI6O 1XMOB 4K8XA 3HKBA 1Q90D 4LH6A 4MTOA 1V54B 1S3JA 4JI7O 4EB6B 2KB1A 4CH3A 2WLJA 1MZFA 4DR5B 1V55B 5FPRA 4B3SO 2ZE8A 5GTIZ 2YICA 3BA9A 4KFMA 4R6ZA 3QF7A 4CS4A 2UUBO 4X64B 5KHGA 1VF5B 3OGCC 5LXTB 2WLLB 3OE7G 2WSSG 4CS2A 3CMAV 1NBMG 4BIOA 2XTAA 4I4TB 4UCVA 4YJ2B 2WLHA 2EINC 3FYEB 3ZIAG 3SJBC 1AI5A 4JI3B 2M6YA 1OCCC 2JVDA 1VQLV 4DV3O 1QLEB 3HKCB 5H6QA 1GRJA 5EZYA 2GDSA 3GWOA 1M1KW 4NKGB 4DR2B 3JCZA 3DGEA 1SQPH 1YZBA 1FXKB 5LA6B 1L0LH 2ITDC 2EJ7A 4UCRA 2QJ1A 1QU7A 2YUAA 3CC7V 1Y74B 3JAMN 1M56C 4JI5B 2QTSA 1SETA 3D8CA 1IBKO 2ADPA 1SKVA 1SQFA 1QVGU 3VQYA 2VQEO 1AI6A 1ZX3A 5CN0A 4GX1A 4PD4F 3RW0A 1ROPA 3MD0A 5FLXN 3H1IH 4DW0A 1SQQH 5EYPA 5BMVB 1YJ9V 1IBMB 2E5LO 4BR6A 2XAHA 3ZCCA 5JJEB 2PY5A 1YTFB 1V55C 5KMGB 4IT5A 2NN4A 2E76B 2OIGA 1JOYA 1I5YA 3K58A 4EKWA 3FX7A 1AP5A 3CHXA 1P7BA 2QWOB 3JALA 3SJQC 3RGBA 1Y67A 5LGTA 3JD0A 1TVKA 2B1IA 3G71V 5BXZA 2YSUB 5EK0A 4K8ZA 3A8TA 2ZE5A 1QLEC 3H1JH 3RN4A 1VP7A 2AGAA 4JYYA 5F2VO 2IBZH 1WNSA 3N2GB 4FZ0A 2XOKG 1R73A 3T1YO 3RYFB 3T1HO 3ABKC 3SPGA 1HNZO 2Q9LA 5LMNB 3CCSV 4X65B 1UJWB 3JAWA 1R1BA 1FXKC 1DF5A 1PNKA 1HR0B 2D2CB 4LP8A 1Q86W 4B3MO 5EC1C 1SC5B 3OTOB 2PZSA 2BSKB 2ZNJA 1Z5WA 3KCYA 3CD6V 1HNXB 1XHZA 4GX5A 1VARA 2WLIB 3I55V 1MA1A 3GVMA 1QCEA 3TJTA 3OR6C 4LF7O 1SRYA 1SQVH 5B1NA 1L1FA 1RSOB 1QBZA 1JR9A 2VRZA 5H6RA 3BFRA 3SJAC 2V7QG 4OGQB 1YDXA 1MG1A 4DUZO 1GKFA 1K9MW 1U97A 4PA9A 3D36A 3B4SA 1X4TA 4LF4O 1FAFA 4JI1O 3A2FA 5B66Z 3OMNB 3FB8C 2OYQA 4NR1A 2JJ2G 4DR1B 4LWSB 4DK0A 1CPYA 3QO5A 1IXMA 1HNWB 3ASOB 4DR3B 4I50A 5H5NA 2XUMA 2Z3YA 1XMOO 4UXNA 1WPBA 3VQXA 3LDEA 3CYOA 1GK9A 1H2MA 3AG3B 2Q73A 3HKDA 3ZHRA 2W0FC 5IE9A 2DN9A 4X66B 4X8AA 2ZNIA 3QVNA 4DR5O 5AG2A 4GT1A 4GYCB 1G8MA 5GONB 3M99B 5H2FZ 4X64O 4JAUA 2X7RB 3N2KB 4FLXA 1J95A 1Q3EA 3ZMUA 1YXBA 2UXXA 3MDSA 1K7DA 2LJ2A 1G1XB 1WPXA 4JI3O 2EIJC 1E1QG 2QM8A 3HPLC 1ENVA 4TUYB 4J11A 4ZHQB 2B1GA 4RUEA 3L75H 1IX9A 2DWEC 1VQ8V 5IYDO 3C3SA 2YI9A 3ICXA 3CXHF 1TAEA 2IJKA 4DR2O 1EN6A 3CX5F 4LNUB 2QKAA 3AG7A 4XDLA 2LO1A 1S72V 3ZRSA 4PDRA 4TWKA 4O4IA 3KKYA 4JI5O 1CP9A 3AK2A 4QJFB 3ASOC 3WB2A 3SPCA 4JZ2A 3CCEV 4H37A 4H33A 1XI1A 1OCRB 3RYHB 1NU1H 4UFZA 3P32A 1IBMO 5LGNA 4WFAV 1PP9H 1AR1B 4TV9B 2UXNA 3JD2A 3DXRB 3E8GA 3W7UA 3SJCC 4CC5A 5IJ9B 2CH7B 4PA3A 1IBLB 3LDCA 3EHBB 5IYBO 4O4HB 4Q6GA 4K0KB 4YIPA 1N32B 4YXWG 1D5NA 4K35A 3L72H 2ZIOA 3ZRWB 2AXTZ 1ZAUA 1IDSA 1EFRG 1JFFA 2HFEC 4G27B 2VWJA 3SYCA 1AJPA 5J2UB 3ZS8C 5LHIA 4FLYA 2HHHB 2CE4A 2Y69B 2HP8A 3IFXA 1DF4A 1Z2GA 1FPOA 4OPAA 4QIWF 5IYZA 3CRAA 3K03A 3ABLC 3E35A 3ZRVA 5LMNO 4X65O 5KLVH 1VQ5V 2QSAA 2DMXA 1HR0O 4U7NA 1YF2A 4MVZA 2PF4E 3OTOO 2N04A 3BRCA 2UUCB 1KUQA 2OTLV 4JPRA 4LF5B 1H2SB 1S0VA 3ZHUA 1HNXO 3CMEV 4DV5B 2AHYA 1OCRC 3CC2V 1HWYA 2A06H 2EIMC 3F5WC 4Z1MG 3JSLA 3K9AA 1RPOA 2NNUA 4O2AB 1I94B 3CRMA 4E2LA 1O9GA 4E4EA 2O57A 4I7ZB 5JCOC 2ZE7A 3HKBB 1OCOB 3K0DA 1P49A 4ZI7A 3OMAB 1FD9A 4LFCB 1PL4A 4HNAB 1Q43A 3RYCB 2ILMA 3R66A 3X2QB 4FK5C 3L9DA 5HFLA 2XASA 3ZMTA 4WF9V 1ZSPA 1TGOA 4O4LB 1NTKH 1K4DC 2Y69C 4PI2A 1HNWO 3FB6C 4FFKA 4DR3O 5A2QN 2QTOA 2CTPA 3L71H 4DR4O 2YC0A 4JV5B 4WFFA 4MW8A 4J10A 2F95B 1SQBH 5E79Z 2QA4V 4ZOLA 5CB4B 2JEUA 1Q6UA 1NVPB 2CTQA 2YXLA 1HP8A 2VS0A 4LBEC 5LP6A 5JQGB 3CE2A 1F51A 3JATA 4AHCA 3WFVA 2A0LA 2OTJV 1KMIZ 1GM9A 4O2BA 1QNMA 3E89A 5CA0B 4FM1A 4JTDB 4X1KB 4YJ3B 2UXDB 5LHGA 1R3JC 2R72A 1V9PA 5B3SB 4MVOA 2OWOA 5L3CA 3LDDA 2Y0PA 2QWNB 4AILC 1OCOC 5EYPB 3F7YC 1RFYA 3FD9A 3PJSK 1TUBA 3IJ4A 3G6EV 4BAYA 5KHIA 3VQWA 1NH2B 3K06A 3BPZA 5BR8B 4N21A 3X2QC 5BY1A 3E83A 5KAIZ 4TSFG 2H3OA 5BZBA 1P84F 2BOBC 2ZDIA 1F4NA 5KUMA 2HEPA 4DV0B 3E22A 2EIKB 5DN6G 1THZA 2P7TC 4IYIA 1TVKB 3STZC 1QHTA 4LF9O 3H1LH 3F5TA 4PHZA 1G4YB 2Q7EA 3FYIB 1AR4A 2LP7A 3WB0A 2PTMA 3ZN1A 2RMKB 1K5SA 3T4DA 3NXSA 5LYJA 1BS3A 1FFTB 2VQFB 1SS3A 3GWKC 4YY3O 3JAWB 2N74A 4PJ0Z 1FS0G 2R70A 1IBLO 2QKCA 2XAJA 4RAIA 5FPOA 4K0KO 1WLEA 2ZE6A 3CCRV 1GAXA 2ZKOA 4LC1A 3CCVV 3TK1A 2OCHA 1XDCA 3OAAG 5EC2C 3RYIA 1KP3A 2XHBA 3O9OA 3E86A 5B3SC 2YXYA 1DK1A 4FLVA 3RVZA 4R50A 4UCOA 4J9ZB 5JVDB 2HLDG 2DWDC 1LUWA 2RN9A 1FFXA 1J5EO 3ZX6A 5CA3A 2KG7A 4DXWA 2IU0A 2IJHA 1B04A 4PDMA 4FFBB 1GN6A 4KUMA 3JD4A 1TA8A 1NJIW 4FLTA 4TV8A 1BSMA 3BA8A 2P90A 1SF9A 2UUCO 1A32A 1Y76A 3KG2A 2EIKC 1MNGA 2WPDG 1L0NH 4IIJA 5C8YA 4DV5O 4UB6Z 1KU9A 5EBMC 2MK3A 4GCZA 3UO3A 4FVMA 2BE3A 4QPJA 2YXHA 5CBGA 1YJWV 4I50B 1I94O 1IURA 3CWBH 3FAVA 1BT8A 3CCUV 3G80A 4PV1B 3J80N 1I5XA 4ZBMA 5GW7A 4KHPB 2QE7G 1YTFD 3TETA 4X88A 3ABMB 3H9VA 1PD3A 4LH7A 1AJNA 2QR4A 2EILB 2F93B 1K33A 2Q8VA 1EN4A 3AEIA 4B7EA 1V54C 4WFEA 4AQYB 1B3QA 4I55B 4MVUA 3HKEA 1MOFA 4PA6A 3WU2Z 5L3GA 1K73W 3B8NA 4R7CA 2GTAA 1K34A 1VEWA 3LNNA 2G38A 1ZUQA 5IWAB 1M57B 4B3RB 3CP1A 2GTSA 4P9OA 5KX5A 4JV5O 1JQ0A 5J2TA 4X1YA 4CBCA 3ETDA 2Q6AA 5B1BB 1GH6A 4J7KA 5IJ0B 4P9PA 2BCCH 1EBOA 1SA0A 5JH7B 5LOVB 4HBNA 3CCMV 2B5UA 1YEWA 2UXDO 3G6BA 2Q5ZA 3JARB 3T4ZA 2Q68A 5J9PC 4UCSA 1VQNV 3BEHA 3ABMC 1EZVH 3SYAA 2EILC 3A0HZ 1WA8B 1Y66A 1YCIA 1OZ0A 1I7FA 2ZQMA 1XNQB 4BWAA 4GZRB 1WP7A 5FNVA 2FB5A 4DV0O 3KZIZ 3HR0A 1ZTEA 4UB8Z 4LFBB 1XREA 4I0XA 4NXMB 4JI8B 4J7JA 1RM1B 2CDYA 3JASB 1BHBA 2H8PC 1F4MA 2AW9A 2RQ6A 3ABTA 2K1EA 3IC7A 1US6A 5B1BC 3EVKA 2VQFO 4YIOA 4CH4A 3JAKB 5B1AB 5LXTA 2WLLA 4Q20A 1NS1A 2P06A 1M5IA 1XNRB 1PNMA 4I4TA 1DLBA 1N0JA 2RDCA 2HVJC 3HKCA 1YIJV 3ETGA 4K3AA 1Q6IA 1DTOA 2ITCC 4LF6B 1COWG 4ABMA 2EZPA 5KA5A 1GTOA 1KKCA 1N33B 3LUTB 1K8AW 2UUAB 4WFGA 3KCXA 4UV8A 1FXKA 2JGDA 5H9CA 5LA6A 3OUSA 3HB3B 1H2LA 1Y74A 2AZ2A 2YEVB 4FLWA 4ZKIA 3OD4A 4DV2B 1H8EG 4BIZA 3RT3C 3JSNA 1I0HA 3E8BA 3CCJV 4DUYB 2IU3A 3K0GA 3C90A 4MTFA 4DRXB 2A9HA 1JA8A 3M8AA 1QLNA 3FB7C 3QG5A 4U3JB 3SR2C 4MVSA 1RM1C 3UT5B 4JYAB 4ZIBA 3AK3A 4DW1A 2QWPB 1NKDA 3TGUH 2CUGA 3QO8A 3BVOA 4WBNB 2JJ1G 5L3EA 4DR6B 1WAZA 4KHPO 5ITZB 2R9IA 5B1AC 1FJGB 1VQ6V 5IY5B 4CZZA 2IM9A 3UCSC 5JJNB 1ZWIC 2KQXA 4N23A 1AROP 5LP6B 4J42A 1OCZB 3OEHG 3K5MA 3AG3C 1QR8A 3N2GA 1P7GA 1PL0A 3Q4HA 1JPXA 3K04A 2LFRA 4UUJC 4J7ZA 3THOA 3RYFA 4TOIA 2QEXV 5IWAO 1Q81W 4DV4B 4B3RO 4CS3A 2YS8A 1H38A 1FKAO 4UV9A 2X0LA 2EZOA 4FPPA 4IHJA 3CJHB 1AI7A 1D2DA 1NR1A 1KP2A 2DYSB 3DC6A 1RSOA 3SPJA 3OTFA 3OM3B 4GKKB 3H01A 4KP4A 1QR9A 1IZ3A 3L70H 1URFA 1XILA 4EFBA 2WA4A 2HG5C 1XBLA 3LSQA 1XL6A 2NR5A 1KQSU 4JASA 4ASUG 1Q7YW 5IY5C 5KHJA 3B2EE 3BHPA 1XUQA 2JIZG 2Q4PA 2PUSA 1VF6C 3PN1A 2UUBB 4ICGA 1YJNV 4KL1A 2YIBD 3UQ8A 1OCZC 4G28B 1BE3H 2D3OW 1WB8A 1QVFU 2LW7A 1BQ0A 2JEXA 2AZ0A 1W59A 1SERA 2X6AA 4L8JA 3SPIA 2CGOA 2IJIA 4LFBO 2DJVA 1L8DA 3L73H 2RJZA 4DO2A 4NXMO 4LR3A 2Y48A 4JI8O 2WLMA 2OCCB 3MAQA 1VIBA 2HJDA 2LQTA 2H94A 4QPKA 1VQ7V 1FFXB 4OX9B 5GONA 1KECA 2KG7B 2F43G 2UXCB 2IW5A 3N2KA 4DR1O 1NVPD 4WFHA 3VOUA 1JJ2U 4XBFA 1XNRO 2XAFA 2DOSA 4IL6Z 1S76D 4IYHA 1YSCA 1H2NA 1BCCH 5L3FA 2F4VB 1JVMA 1F23A 4TUYA 4EFEA 1HW7A 2W6JG 2EULA 4HZ3A 3OMIB 1PM9A 4ZHQA 5C8YB 1UPGA 5EZYB 1AR5A 2E5LB 1SQGA 4NTXA 1N33O 5KHKA 2FKXA 4X66O 2UUAO 3A0RA 4CC6A 1R6NA 4OXSA 3FAVB 5IYCO 2BTOA 1OJHA
chains in the Genus database with same CATH topology
3APOA 2LGWA 3BVOA 2QSAA 2GUZB 2DMXA 2DN9A 3APQA 4IT5A 1N4CA 2N05A 2CTWA 2L6LA 4J7ZA 2OCHA 1WJZA 2PF4E 1GH6A 3UO3A 1XBLA 1BQ0A 2QWOB 2N04A 1NZ6A 2QWRB 1BQZA 4J80A 2QWQB 2Y4UA 3UCSC 4RWUA 1IURA 2CTQA 2QWNB 2YS8A 2EJ7A 2M6YA 1FPOA 2KQXA 2CTRA 2CTPA 3AG7A 1FAFA 2LO1A 2QWPB 3UO2A 2YUAA 2GUZA 2Y4TA 1HDJA 2CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APO A;  2LGW A;  3BVO A;  2QSA A;  2GUZ B;  2DMX A;  2DN9 A;  3APQ A;  4IT5 A;  1N4C A;  2N05 A;  2CTW A;  2L6L A;  4J7Z A;  2OCH A;  1WJZ A;  2PF4 E;  1GH6 A;  3UO3 A;  1XBL A;  1BQ0 A;  2QWO B;  2N04 A;  1NZ6 A;  2QWR B;  1BQZ A;  4J80 A;  2QWQ B;  2Y4U A;  3UCS C;  4RWU A;  1IUR A;  2CTQ A;  2QWN B;  2YS8 A;  2EJ7 A;  2M6Y A;  1FPO A;  2KQX A;  2CTR A;  2CTP A;  3AG7 A;  1FAF A;  2LO1 A;  2QWP B;  3UO2 A;  2YUA A;  2GUZ A;  2Y4T A;  1HDJ A;  2CUG A; 
#chains in the Genus database with same CATH topology
 1NH2 D;  2RCV A;  1B6Q A;  3G67 A;  2GV9 A;  1JJO A;  2Q67 A;  4UVA A;  2OT5 A;  2LGQ A;  2JGU A;  4H13 B;  4MTX A;  3RFR A;  3CC4 V;  2HR3 A;  3OUF A;  3IGA C;  1NR7 A;  1JMK C;  2C2A A;  4MTG A;  4F6R A;  2V1D A;  1BL8 A;  1R3L C;  3ETQ A;  4BIU A;  4X62 B;  5C93 A;  1EM1 A;  2DQ3 A;  2WLN A;  4GLX A;  4JTA B;  1AIL A;  4LCU C;  2E75 B;  2OCC C;  5IDJ A;  5LL6 Y;  5JCO A;  4TV9 A;  3SYO A;  4JYA O;  3DXR A;  1PNL A;  4FM0 A;  1BZK A;  5GTH Z;  5IJ9 A;  2QKS A;  5EIB C;  4AI8 A;  5K1P A;  4O4H A;  4DR6 O;  1NZ6 A;  1AJQ A;  5KAF Z;  1FJG O;  3JAL B;  3ZRW A;  2FML A;  4JZG A;  4MVQ A;  2YIA A;  3ZHT A;  3OW2 U;  3B09 A;  1U96 A;  2QM7 A;  4BW9 A;  1XOU A;  3ZMV A;  4KXR A;  5CA1 A;  2L35 A;  2P4V A;  3D3I A;  5J2U A;  2P6J A;  4P30 A;  3JD1 A;  1N4C A;  4RQF A;  1IXB A;  4FLZ A;  1W0K G;  4LF7 B;  4MS2 A;  3CCQ V;  1N36 B;  3WB1 A;  3FB5 C;  2EIN B;  4UVC A;  2QDO A;  2JRI A;  5L3D A;  3FKS G;  4TQF A;  1SA0 B;  1M9N A;  2PI4 A;  1VQ4 V;  1FYJ A;  3D3Q A;  3JYC A;  4XDK A;  4GKJ B;  1N32 O;  2YI8 A;  4GX0 A;  4L87 A;  2Q0O C;  3DTU B;  1N34 B;  4JI2 B;  4JAA A;  4CH5 A;  1P4R A;  4JI1 B;  2HVK C;  4WFB V;  3CEI A;  1SQX H;  2UXB B;  5L3B A;  1XL4 A;  2ZM6 B;  1AB3 A;  2HHH O;  2E74 B;  3S3X A;  5FNV B;  4O2A A;  2P22 C;  1KD1 W;  4MVR A;  2ZR3 A;  4NVP A;  4W4L A;  4GKK O;  1JCH A;  2VWK A;  1NTM H;  2ARH A;  4I0X B;  3ZED A;  4NXN B;  4MVM A;  3QTC A;  4Z1V A;  4H0L B;  4HNA A;  4A5U B;  3RYC A;  2CAZ C;  5KUK A;  2YIB A;  2Y4T A;  4LF5 O;  3G4S V;  1AP6 A;  4X1I A;  3APQ A;  4HYO A;  1XEQ A;  3R65 A;  3I56 V;  4G2K A;  4O4L A;  1FXH A;  1F7Y A;  4HAM A;  1S5H C;  1MSW D;  3ASN B;  2P4K A;  1Q5O A;  1K4C C;  1OV9 A;  1O9H A;  1S77 D;  3HKD B;  1ZL8 A;  3MHS C;  3N27 A;  4LFC O;  3CRR A;  3W7X A;  5CB4 A;  2E3C A;  3ABK B;  1K97 A;  1VMG A;  3TCU A;  3B8M A;  2WA3 A;  2YDE A;  5FL7 G;  4X20 A;  4OX9 O;  3CRC A;  5JQG A;  2ATK C;  2JGD B;  2QM4 A;  1YVW A;  2UXC O;  3SPH A;  1N0N A;  1VQM V;  3K5L A;  2DE0 X;  5CA0 A;  4DV6 B;  3ZHV A;  4X1K A;  3W7T A;  4YJ3 A;  2L6L A;  2AHZ A;  2Y0I A;  4RO2 A;  2F4V O;  2XT9 A;  3K79 A;  2OIE A;  4NB5 A;  3K3W A;  3I5D A;  1M93 A;  4F6E A;  3H1H H;  4YHH B;  1E1R G;  4O4J A;  4JI4 B;  2A79 B;  3D36 C;  3U10 A;  4TQD A;  3IC9 A;  3DC5 A;  3WG7 B;  5JWP A;  2BTQ A;  2UU9 B;  5LGU A;  2WLK A;  4O4I B;  3TXS A;  4NYK A;  3ASN C;  5DED A;  4I9Q A;  3AG1 B;  1BMF G;  2LW1 A;  3QO7 A;  4H44 B;  4LFA B;  3ZHQ A;  5LMU B;  1KBH A;  3CSX A;  1SES A;  1K5Q A;  4UCT A;  4QGP A;  3SDL A;  4X62 O;  3CB2 A;  1I08 A;  2W0X A;  3Q4H B;  1R3K C;  2JDI G;  3LSS A;  4J41 A;  3OFN G;  3P3N A;  4J80 A;  3UKM A;  5BR8 O;  2ETN A;  4J9Y B;  3K5N A;  3VBB A;  1LNQ A;  1K3E A;  1K92 A;  2GUZ A;  4B3T B;  3LSU A;  1XMQ B;  1Q82 W;  1GM7 A;  2M7W A;  3W7S A;  1JFF B;  1RPR A;  1OHH G;  4IHJ B;  2DQ0 A;  3AK1 A;  1M57 C;  4EB6 A;  3GB7 C;  3SYP A;  2F66 C;  1N36 O;  3ABU A;  1KYO F;  5JVD A;  3CPW U;  5EBW C;  4PDL A;  2EIJ B;  4D7S A;  4CH6 A;  2LGW A;  2BOC C;  5IYZ B;  1T5E A;  2PI5 A;  2CK3 G;  4FFB A;  1PKX A;  4JAV A;  3J7A U;  1R6T A;  3WG7 C;  4GKJ O;  1B06 A;  1NT2 B;  5JJJ B;  4YJ2 A;  2FL4 A;  3RWR D;  2QWQ B;  2ZXW B;  1N34 O;  3K5O A;  4RQE A;  1VQO V;  4C7U A;  4JI2 O;  3H1K H;  3SGI A;  5CBH A;  3AG1 C;  3FFQ A;  3APO A;  1W2B U;  2GHY A;  2UXB O;  2NLJ C;  2DYR B;  2ZM6 O;  2WAM A;  2HJF C;  2Z0A A;  4IGG A;  4OPH A;  2X6B A;  3JCU Z;  4DV7 B;  4DR4 B;  2PGG A;  1JX9 A;  1M90 W;  2YID A;  3K59 A;  1KKD A;  2P67 A;  4JGS A;  4NXN O;  3T1C A;  4ZI7 B;  2X6C A;  4I9W A;  2Q7H A;  3P3P A;  5CMU A;  1Y4M A;  2CTW A;  3B77 A;  4DR7 B;  3B40 A;  3K57 A;  3J81 N;  1XQ8 A;  2XAG A;  2ZR2 A;  3BAB A;  5BMV A;  3CXC U;  4I55 A;  5D5Q A;  3ZBH A;  1AI4 A;  3ML0 A;  2RNB A;  1Q6H A;  4QE7 A;  2CTR A;  3K08 A;  5KMG A;  5TIS Z;  4PDV A;  4PA7 A;  3ZJZ A;  3F7V C;  3U0Z A;  1Y6X A;  2QWR B;  1GN2 A;  2DW4 A;  2P5O A;  2JK5 C;  4LF8 B;  4ZOL B;  3ABL B;  2ZXW C;  1YI2 V;  1MZE A;  3AG2 B;  3JD3 A;  5IJ0 A;  3JAT B;  1NQT A;  4PEL A;  3EXA A;  1R3I C;  4AQY O;  1GN3 A;  2R9A A;  5JH7 A;  2DYR C;  3L74 H;  4O2B B;  5LOV A;  4DV6 O;  3IAY A;  2ADQ B;  1H2K A;  3K9S A;  4RUF A;  4DV1 B;  1R6K A;  2W6I G;  4FJC C;  3AG4 B;  4LF9 B;  2KSD A;  4RWU A;  2F23 A;  1H2G A;  3JAR A;  1N8R W;  1CXZ B;  5LHH A;  3P30 A;  4PI0 A;  1GMG A;  4F6R B;  2EIM B;  1Z5V A;  1WN7 A;  2BSK A;  4YHH O;  3RBZ A;  3STL C;  5E1A C;  4JI4 O;  1TUB B;  4U7O A;  4F4L A;  2JS5 A;  4X89 A;  1WA8 A;  2WLI A;  3EFF K;  4YY3 B;  1S5L Z;  3BAA A;  4JI0 B;  3QNE A;  1KC8 W;  4EEQ A;  2FTK A;  2UU9 O;  4I5S A;  1FXV A;  3E22 B;  4JI6 B;  4Z2W A;  5B5E Z;  1XHX A;  3LNM B;  4LFA O;  5CA1 B;  2PYL A;  2N05 A;  5LMU O;  4JI7 B;  1G6U A;  3JAS A;  4U3F H;  1IVS A;  3ZHS A;  3SYQ A;  1YHQ V;  4QNH B;  2ZIN A;  2B9Z A;  2Z5U A;  5DM6 V;  1UFI A;  4PA4 A;  1J5E B;  4B3S B;  5CBF A;  5LYJ B;  2QGN A;  1PPJ H;  3JAK A;  4LWS A;  3AG2 C;  3ZN0 A;  5LP6 C;  1YIT V;  5EIB D;  1XNQ O;  2Q0A A;  4MT8 A;  3A0B Z;  3VQV A;  4B3T O;  1SZT A;  5D5P A;  1XMQ O;  3O65 A;  4BW5 A;  3ZRX A;  2F1M A;  1LUV A;  5A9G A;  4DV3 B;  4B7K A;  4JYC A;  3RYI B;  2Q69 A;  4WCE V;  3AG4 C;  4D7T A;  4JTC B;  3UO2 A;  3M7M X;  1GO3 F;  5LBQ A;  2IH1 C;  1MAB G;  3W7W A;  1H8H G;  2PYJ A;  5IT9 N;  1WJZ A;  3BY6 A;  4X9Q A;  1ZLZ A;  1BHA A;  1ORQ C;  2YEV A;  2MW2 B;  2DYS C;  1BGY H;  4TV8 B;  1IBK B;  5HFM A;  2ZDI C;  2VQE B;  1GM8 A;  5B1O A;  1WB7 A;  1Y76 B;  4DRX A;  1PV0 A;  3OT7 A;  2ODM A;  4X1I B;  1VQP V;  2XND G;  1MSD A;  4LF6 O;  2XAQ A;  1EZJ A;  4U3J A;  4IIJ B;  4DK1 A;  4UCU A;  4GX2 A;  3UT5 A;  1AVM A;  2HKO A;  2GSM B;  3CRQ A;  1QQC A;  3MHH C;  4LNU A;  2R9R B;  1S5J A;  4DYL A;  1TUE B;  4FMT A;  2IJJ A;  3T2M A;  4WBN A;  4DV7 O;  1M4U A;  1CEZ A;  1HDJ A;  2CGN A;  1NTZ H;  5ITZ A;  4FLU A;  2EJR A;  2FYU H;  1RP3 B;  1ZL8 B;  4DV2 O;  2WWW A;  4MW3 A;  2EBO A;  2LFS A;  1W0J G;  1VF6 A;  1VQ9 V;  4DUY O;  3OEE G;  3OR7 C;  4DR7 O;  4NTW A;  1VF7 A;  4X20 B;  1D5A A;  3RVY A;  3RYH A;  3ZMS A;  2IH3 C;  2ZIM A;  2JS3 A;  2KKW A;  3CCL V;  3HKE B;  3T1Y B;  2V4D A;  3T1H B;  5K1X A;  1LR1 A;  1HNZ B;  4UVB A;  3UM7 A;  2CH7 A;  4R8C A;  2ZD9 A;  3OGI B;  5KX5 B;  4B3M B;  3ZMZ A;  1NI8 A;  3C3T A;  5J2T B;  4X1Y B;  1GN4 A;  3E8F A;  4O4J B;  5KHH A;  3CJH A;  4LF8 O;  5EBL C;  1KB9 F;  1VQK V;  3DSQ A;  1DGS A;  2K9P A;  2BTQ B;  2EX3 A;  1OCC B;  4QE9 A;  3ETE A;  4P2Z A;  2ZCE A;  3CS5 A;  3E8H A;  4NTY A;  5KA6 A;  4DV1 O;  2ZT9 B;  4JF3 A;  1WP8 A;  3NR7 A;  4TT3 G;  4FIP C;  4DV4 O;  2Q7G A;  1X59 A;  3U11 A;  1MMM A;  4DUZ B;  1EN5 A;  4FM2 A;  2A3Q A;  5DEC A;  4LF4 B;  2A7W A;  1Q8I A;  3TXQ A;  1BQZ A;  4W4K A;  1E79 G;  2Y4U A;  4MSW C;  4XDJ A;  3E2E A;  4FZ1 A;  4D6T H;  3BCC H;  1M56 B;  4JI0 O;  2GUZ B;  4B08 A;  4GUN A;  4JYB A;  2GBO A;  3S3W A;  1SZX A;  4JI6 O;  1XMO B;  4K8X A;  3HKB A;  1Q90 D;  4LH6 A;  4MTO A;  1V54 B;  1S3J A;  4JI7 O;  4EB6 B;  2KB1 A;  4CH3 A;  2WLJ A;  1MZF A;  4DR5 B;  1V55 B;  5FPR A;  4B3S O;  2ZE8 A;  5GTI Z;  2YIC A;  3BA9 A;  4KFM A;  4R6Z A;  3QF7 A;  4CS4 A;  2UUB O;  4X64 B;  5KHG A;  1VF5 B;  3OGC C;  5LXT B;  2WLL B;  3OE7 G;  2WSS G;  4CS2 A;  3CMA V;  1NBM G;  4BIO A;  2XTA A;  4I4T B;  4UCV A;  4YJ2 B;  2WLH A;  2EIN C;  3FYE B;  3ZIA G;  3SJB C;  1AI5 A;  4JI3 B;  2M6Y A;  1OCC C;  2JVD A;  1VQL V;  4DV3 O;  1QLE B;  3HKC B;  5H6Q A;  1GRJ A;  5EZY A;  2GDS A;  3GWO A;  1M1K W;  4NKG B;  4DR2 B;  3JCZ A;  3DGE A;  1SQP H;  1YZB A;  1FXK B;  5LA6 B;  1L0L H;  2ITD C;  2EJ7 A;  4UCR A;  2QJ1 A;  1QU7 A;  2YUA A;  3CC7 V;  1Y74 B;  3JAM N;  1M56 C;  4JI5 B;  2QTS A;  1SET A;  3D8C A;  1IBK O;  2ADP A;  1SKV A;  1SQF A;  1QVG U;  3VQY A;  2VQE O;  1AI6 A;  1ZX3 A;  5CN0 A;  4GX1 A;  4PD4 F;  3RW0 A;  1ROP A;  3MD0 A;  5FLX N;  3H1I H;  4DW0 A;  1SQQ H;  5EYP A;  5BMV B;  1YJ9 V;  1IBM B;  2E5L O;  4BR6 A;  2XAH A;  3ZCC A;  5JJE B;  2PY5 A;  1YTF B;  1V55 C;  5KMG B;  4IT5 A;  2NN4 A;  2E76 B;  2OIG A;  1JOY A;  1I5Y A;  3K58 A;  4EKW A;  3FX7 A;  1AP5 A;  3CHX A;  1P7B A;  2QWO B;  3JAL A;  3SJQ C;  3RGB A;  1Y67 A;  5LGT A;  3JD0 A;  1TVK A;  2B1I A;  3G71 V;  5BXZ A;  2YSU B;  5EK0 A;  4K8Z A;  3A8T A;  2ZE5 A;  1QLE C;  3H1J H;  3RN4 A;  1VP7 A;  2AGA A;  4JYY A;  5F2V O;  2IBZ H;  1WNS A;  3N2G B;  4FZ0 A;  2XOK G;  1R73 A;  3T1Y O;  3RYF B;  3T1H O;  3ABK C;  3SPG A;  1HNZ O;  2Q9L A;  5LMN B;  3CCS V;  4X65 B;  1UJW B;  3JAW A;  1R1B A;  1FXK C;  1DF5 A;  1PNK A;  1HR0 B;  2D2C B;  4LP8 A;  1Q86 W;  4B3M O;  5EC1 C;  1SC5 B;  3OTO B;  2PZS A;  2BSK B;  2ZNJ A;  1Z5W A;  3KCY A;  3CD6 V;  1HNX B;  1XHZ A;  4GX5 A;  1VAR A;  2WLI B;  3I55 V;  1MA1 A;  3GVM A;  1QCE A;  3TJT A;  3OR6 C;  4LF7 O;  1SRY A;  1SQV H;  5B1N A;  1L1F A;  1RSO B;  1QBZ A;  1JR9 A;  2VRZ A;  5H6R A;  3BFR A;  3SJA C;  2V7Q G;  4OGQ B;  1YDX A;  1MG1 A;  4DUZ O;  1GKF A;  1K9M W;  1U97 A;  4PA9 A;  3D36 A;  3B4S A;  1X4T A;  4LF4 O;  1FAF A;  4JI1 O;  3A2F A;  5B66 Z;  3OMN B;  3FB8 C;  2OYQ A;  4NR1 A;  2JJ2 G;  4DR1 B;  4LWS B;  4DK0 A;  1CPY A;  3QO5 A;  1IXM A;  1HNW B;  3ASO B;  4DR3 B;  4I50 A;  5H5N A;  2XUM A;  2Z3Y A;  1XMO O;  4UXN A;  1WPB A;  3VQX A;  3LDE A;  3CYO A;  1GK9 A;  1H2M A;  3AG3 B;  2Q73 A;  3HKD A;  3ZHR A;  2W0F C;  5IE9 A;  2DN9 A;  4X66 B;  4X8A A;  2ZNI A;  3QVN A;  4DR5 O;  5AG2 A;  4GT1 A;  4GYC B;  1G8M A;  5GON B;  3M99 B;  5H2F Z;  4X64 O;  4JAU A;  2X7R B;  3N2K B;  4FLX A;  1J95 A;  1Q3E A;  3ZMU A;  1YXB A;  2UXX A;  3MDS A;  1K7D A;  2LJ2 A;  1G1X B;  1WPX A;  4JI3 O;  2EIJ C;  1E1Q G;  2QM8 A;  3HPL C;  1ENV A;  4TUY B;  4J11 A;  4ZHQ B;  2B1G A;  4RUE A;  3L75 H;  1IX9 A;  2DWE C;  1VQ8 V;  5IYD O;  3C3S A;  2YI9 A;  3ICX A;  3CXH F;  1TAE A;  2IJK A;  4DR2 O;  1EN6 A;  3CX5 F;  4LNU B;  2QKA A;  3AG7 A;  4XDL A;  2LO1 A;  1S72 V;  3ZRS A;  4PDR A;  4TWK A;  4O4I A;  3KKY A;  4JI5 O;  1CP9 A;  3AK2 A;  4QJF B;  3ASO C;  3WB2 A;  3SPC A;  4JZ2 A;  3CCE V;  4H37 A;  4H33 A;  1XI1 A;  1OCR B;  3RYH B;  1NU1 H;  4UFZ A;  3P32 A;  1IBM O;  5LGN A;  4WFA V;  1PP9 H;  1AR1 B;  4TV9 B;  2UXN A;  3JD2 A;  3DXR B;  3E8G A;  3W7U A;  3SJC C;  4CC5 A;  5IJ9 B;  2CH7 B;  4PA3 A;  1IBL B;  3LDC A;  3EHB B;  5IYB O;  4O4H B;  4Q6G A;  4K0K B;  4YIP A;  1N32 B;  4YXW G;  1D5N A;  4K35 A;  3L72 H;  2ZIO A;  3ZRW B;  2AXT Z;  1ZAU A;  1IDS A;  1EFR G;  1JFF A;  2HFE C;  4G27 B;  2VWJ A;  3SYC A;  1AJP A;  5J2U B;  3ZS8 C;  5LHI A;  4FLY A;  2HHH B;  2CE4 A;  2Y69 B;  2HP8 A;  3IFX A;  1DF4 A;  1Z2G A;  1FPO A;  4OPA A;  4QIW F;  5IYZ A;  3CRA A;  3K03 A;  3ABL C;  3E35 A;  3ZRV A;  5LMN O;  4X65 O;  5KLV H;  1VQ5 V;  2QSA A;  2DMX A;  1HR0 O;  4U7N A;  1YF2 A;  4MVZ A;  2PF4 E;  3OTO O;  2N04 A;  3BRC A;  2UUC B;  1KUQ A;  2OTL V;  4JPR A;  4LF5 B;  1H2S B;  1S0V A;  3ZHU A;  1HNX O;  3CME V;  4DV5 B;  2AHY A;  1OCR C;  3CC2 V;  1HWY A;  2A06 H;  2EIM C;  3F5W C;  4Z1M G;  3JSL A;  3K9A A;  1RPO A;  2NNU A;  4O2A B;  1I94 B;  3CRM A;  4E2L A;  1O9G A;  4E4E A;  2O57 A;  4I7Z B;  5JCO C;  2ZE7 A;  3HKB B;  1OCO B;  3K0D A;  1P49 A;  4ZI7 A;  3OMA B;  1FD9 A;  4LFC B;  1PL4 A;  4HNA B;  1Q43 A;  3RYC B;  2ILM A;  3R66 A;  3X2Q B;  4FK5 C;  3L9D A;  5HFL A;  2XAS A;  3ZMT A;  4WF9 V;  1ZSP A;  1TGO A;  4O4L B;  1NTK H;  1K4D C;  2Y69 C;  4PI2 A;  1HNW O;  3FB6 C;  4FFK A;  4DR3 O;  5A2Q N;  2QTO A;  2CTP A;  3L71 H;  4DR4 O;  2YC0 A;  4JV5 B;  4WFF A;  4MW8 A;  4J10 A;  2F95 B;  1SQB H;  5E79 Z;  2QA4 V;  4ZOL A;  5CB4 B;  2JEU A;  1Q6U A;  1NVP B;  2CTQ A;  2YXL A;  1HP8 A;  2VS0 A;  4LBE C;  5LP6 A;  5JQG B;  3CE2 A;  1F51 A;  3JAT A;  4AHC A;  3WFV A;  2A0L A;  2OTJ V;  1KMI Z;  1GM9 A;  4O2B A;  1QNM A;  3E89 A;  5CA0 B;  4FM1 A;  4JTD B;  4X1K B;  4YJ3 B;  2UXD B;  5LHG A;  1R3J C;  2R72 A;  1V9P A;  5B3S B;  4MVO A;  2OWO A;  5L3C A;  3LDD A;  2Y0P A;  2QWN B;  4AIL C;  1OCO C;  5EYP B;  3F7Y C;  1RFY A;  3FD9 A;  3PJS K;  1TUB A;  3IJ4 A;  3G6E V;  4BAY A;  5KHI A;  3VQW A;  1NH2 B;  3K06 A;  3BPZ A;  5BR8 B;  4N21 A;  3X2Q C;  5BY1 A;  3E83 A;  5KAI Z;  4TSF G;  2H3O A;  5BZB A;  1P84 F;  2BOB C;  2ZDI A;  1F4N A;  5KUM A;  2HEP A;  4DV0 B;  3E22 A;  2EIK B;  5DN6 G;  1THZ A;  2P7T C;  4IYI A;  1TVK B;  3STZ C;  1QHT A;  4LF9 O;  3H1L H;  3F5T A;  4PHZ A;  1G4Y B;  2Q7E A;  3FYI B;  1AR4 A;  2LP7 A;  3WB0 A;  2PTM A;  3ZN1 A;  2RMK B;  1K5S A;  3T4D A;  3NXS A;  5LYJ A;  1BS3 A;  1FFT B;  2VQF B;  1SS3 A;  3GWK C;  4YY3 O;  3JAW B;  2N74 A;  4PJ0 Z;  1FS0 G;  2R70 A;  1IBL O;  2QKC A;  2XAJ A;  4RAI A;  5FPO A;  4K0K O;  1WLE A;  2ZE6 A;  3CCR V;  1GAX A;  2ZKO A;  4LC1 A;  3CCV V;  3TK1 A;  2OCH A;  1XDC A;  3OAA G;  5EC2 C;  3RYI A;  1KP3 A;  2XHB A;  3O9O A;  3E86 A;  5B3S C;  2YXY A;  1DK1 A;  4FLV A;  3RVZ A;  4R50 A;  4UCO A;  4J9Z B;  5JVD B;  2HLD G;  2DWD C;  1LUW A;  2RN9 A;  1FFX A;  1J5E O;  3ZX6 A;  5CA3 A;  2KG7 A;  4DXW A;  2IU0 A;  2IJH A;  1B04 A;  4PDM A;  4FFB B;  1GN6 A;  4KUM A;  3JD4 A;  1TA8 A;  1NJI W;  4FLT A;  4TV8 A;  1BSM A;  3BA8 A;  2P90 A;  1SF9 A;  2UUC O;  1A32 A;  1Y76 A;  3KG2 A;  2EIK C;  1MNG A;  2WPD G;  1L0N H;  4IIJ A;  5C8Y A;  4DV5 O;  4UB6 Z;  1KU9 A;  5EBM C;  2MK3 A;  4GCZ A;  3UO3 A;  4FVM A;  2BE3 A;  4QPJ A;  2YXH A;  5CBG A;  1YJW V;  4I50 B;  1I94 O;  1IUR A;  3CWB H;  3FAV A;  1BT8 A;  3CCU V;  3G80 A;  4PV1 B;  3J80 N;  1I5X A;  4ZBM A;  5GW7 A;  4KHP B;  2QE7 G;  1YTF D;  3TET A;  4X88 A;  3ABM B;  3H9V A;  1PD3 A;  4LH7 A;  1AJN A;  2QR4 A;  2EIL B;  2F93 B;  1K33 A;  2Q8V A;  1EN4 A;  3AEI A;  4B7E A;  1V54 C;  4WFE A;  4AQY B;  1B3Q A;  4I55 B;  4MVU A;  3HKE A;  1MOF A;  4PA6 A;  3WU2 Z;  5L3G A;  1K73 W;  3B8N A;  4R7C A;  2GTA A;  1K34 A;  1VEW A;  3LNN A;  2G38 A;  1ZUQ A;  5IWA B;  1M57 B;  4B3R B;  3CP1 A;  2GTS A;  4P9O A;  5KX5 A;  4JV5 O;  1JQ0 A;  5J2T A;  4X1Y A;  4CBC A;  3ETD A;  2Q6A A;  5B1B B;  1GH6 A;  4J7K A;  5IJ0 B;  4P9P A;  2BCC H;  1EBO A;  1SA0 A;  5JH7 B;  5LOV B;  4HBN A;  3CCM V;  2B5U A;  1YEW A;  2UXD O;  3G6B A;  2Q5Z A;  3JAR B;  3T4Z A;  2Q68 A;  5J9P C;  4UCS A;  1VQN V;  3BEH A;  3ABM C;  1EZV H;  3SYA A;  2EIL C;  3A0H Z;  1WA8 B;  1Y66 A;  1YCI A;  1OZ0 A;  1I7F A;  2ZQM A;  1XNQ B;  4BWA A;  4GZR B;  1WP7 A;  5FNV A;  2FB5 A;  4DV0 O;  3KZI Z;  3HR0 A;  1ZTE A;  4UB8 Z;  4LFB B;  1XRE A;  4I0X A;  4NXM B;  4JI8 B;  4J7J A;  1RM1 B;  2CDY A;  3JAS B;  1BHB A;  2H8P C;  1F4M A;  2AW9 A;  2RQ6 A;  3ABT A;  2K1E A;  3IC7 A;  1US6 A;  5B1B C;  3EVK A;  2VQF O;  4YIO A;  4CH4 A;  3JAK B;  5B1A B;  5LXT A;  2WLL A;  4Q20 A;  1NS1 A;  2P06 A;  1M5I A;  1XNR B;  1PNM A;  4I4T A;  1DLB A;  1N0J A;  2RDC A;  2HVJ C;  3HKC A;  1YIJ V;  3ETG A;  4K3A A;  1Q6I A;  1DTO A;  2ITC C;  4LF6 B;  1COW G;  4ABM A;  2EZP A;  5KA5 A;  1GTO A;  1KKC A;  1N33 B;  3LUT B;  1K8A W;  2UUA B;  4WFG A;  3KCX A;  4UV8 A;  1FXK A;  2JGD A;  5H9C A;  5LA6 A;  3OUS A;  3HB3 B;  1H2L A;  1Y74 A;  2AZ2 A;  2YEV B;  4FLW A;  4ZKI A;  3OD4 A;  4DV2 B;  1H8E G;  4BIZ A;  3RT3 C;  3JSN A;  1I0H A;  3E8B A;  3CCJ V;  4DUY B;  2IU3 A;  3K0G A;  3C90 A;  4MTF A;  4DRX B;  2A9H A;  1JA8 A;  3M8A A;  1QLN A;  3FB7 C;  3QG5 A;  4U3J B;  3SR2 C;  4MVS A;  1RM1 C;  3UT5 B;  4JYA B;  4ZIB A;  3AK3 A;  4DW1 A;  2QWP B;  1NKD A;  3TGU H;  2CUG A;  3QO8 A;  3BVO A;  4WBN B;  2JJ1 G;  5L3E A;  4DR6 B;  1WAZ A;  4KHP O;  5ITZ B;  2R9I A;  5B1A C;  1FJG B;  1VQ6 V;  5IY5 B;  4CZZ A;  2IM9 A;  3UCS C;  5JJN B;  1ZWI C;  2KQX A;  4N23 A;  1ARO P;  5LP6 B;  4J42 A;  1OCZ B;  3OEH G;  3K5M A;  3AG3 C;  1QR8 A;  3N2G A;  1P7G A;  1PL0 A;  3Q4H A;  1JPX A;  3K04 A;  2LFR A;  4UUJ C;  4J7Z A;  3THO A;  3RYF A;  4TOI A;  2QEX V;  5IWA O;  1Q81 W;  4DV4 B;  4B3R O;  4CS3 A;  2YS8 A;  1H38 A;  1FKA O;  4UV9 A;  2X0L A;  2EZO A;  4FPP A;  4IHJ A;  3CJH B;  1AI7 A;  1D2D A;  1NR1 A;  1KP2 A;  2DYS B;  3DC6 A;  1RSO A;  3SPJ A;  3OTF A;  3OM3 B;  4GKK B;  3H01 A;  4KP4 A;  1QR9 A;  1IZ3 A;  3L70 H;  1URF A;  1XIL A;  4EFB A;  2WA4 A;  2HG5 C;  1XBL A;  3LSQ A;  1XL6 A;  2NR5 A;  1KQS U;  4JAS A;  4ASU G;  1Q7Y W;  5IY5 C;  5KHJ A;  3B2E E;  3BHP A;  1XUQ A;  2JIZ G;  2Q4P A;  2PUS A;  1VF6 C;  3PN1 A;  2UUB B;  4ICG A;  1YJN V;  4KL1 A;  2YIB D;  3UQ8 A;  1OCZ C;  4G28 B;  1BE3 H;  2D3O W;  1WB8 A;  1QVF U;  2LW7 A;  1BQ0 A;  2JEX A;  2AZ0 A;  1W59 A;  1SER A;  2X6A A;  4L8J A;  3SPI A;  2CGO A;  2IJI A;  4LFB O;  2DJV A;  1L8D A;  3L73 H;  2RJZ A;  4DO2 A;  4NXM O;  4LR3 A;  2Y48 A;  4JI8 O;  2WLM A;  2OCC B;  3MAQ A;  1VIB A;  2HJD A;  2LQT A;  2H94 A;  4QPK A;  1VQ7 V;  1FFX B;  4OX9 B;  5GON A;  1KEC A;  2KG7 B;  2F43 G;  2UXC B;  2IW5 A;  3N2K A;  4DR1 O;  1NVP D;  4WFH A;  3VOU A;  1JJ2 U;  4XBF A;  1XNR O;  2XAF A;  2DOS A;  4IL6 Z;  1S76 D;  4IYH A;  1YSC A;  1H2N A;  1BCC H;  5L3F A;  2F4V B;  1JVM A;  1F23 A;  4TUY A;  4EFE A;  1HW7 A;  2W6J G;  2EUL A;  4HZ3 A;  3OMI B;  1PM9 A;  4ZHQ A;  5C8Y B;  1UPG A;  5EZY B;  1AR5 A;  2E5L B;  1SQG A;  4NTX A;  1N33 O;  5KHK A;  2FKX A;  4X66 O;  2UUA O;  3A0R A;  4CC6 A;  1R6N A;  4OXS A;  3FAV B;  5IYC O;  2BTO A;  1OJH A; 
#chains in the Genus database with same CATH homology
 3APO A;  2LGW A;  3BVO A;  2QSA A;  2GUZ B;  2DMX A;  2DN9 A;  3APQ A;  4IT5 A;  1N4C A;  2N05 A;  2CTW A;  2L6L A;  4J7Z A;  2OCH A;  1WJZ A;  2PF4 E;  1GH6 A;  3UO3 A;  1XBL A;  1BQ0 A;  2QWO B;  2N04 A;  1NZ6 A;  2QWR B;  1BQZ A;  4J80 A;  2QWQ B;  2Y4U A;  3UCS C;  4RWU A;  1IUR A;  2CTQ A;  2QWN B;  2YS8 A;  2EJ7 A;  2M6Y A;  1FPO A;  2KQX A;  2CTR A;  2CTP A;  3AG7 A;  1FAF A;  2LO1 A;  2QWP B;  3UO2 A;  2YUA A;  2GUZ A;  2Y4T A;  1HDJ A;  2CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...