2LO3A

Solution structure of sgf73(59-102) zinc finger domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
NPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 73
publication title Insights into the role of SGF11 and SGF73 for the interaction between SAGA and nucleosomes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18508 zf_C2H2_13 Zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lo3A01
1Z1BA 2ELYA 2YSOA 2EM0A 1TN9A 4R2EA 2EPXA 1BB8A 2EOJA 4IS1C 2YU8A 4R2CA 2YTGA 4F6NA 1UN6B 2EMBA 2EM6A 2EQ0A 2BB8A 2YTOA 4WSGA 2CTDA 2J7JA 2LO3A 2LVHA 2EM3A 2YTJA 2A25A 2EN1A 1P47A 2EOOA 1MEYC 2EORA 2EPAA 2DGCA 2YTPA 2YTFA 1A1LA 2EOSA 2MKDA 2RSIA 2EN2A 2EL6A 2MDGA 2EOYA 2YTNA 2DRPA 2EPCA 2ADRA 2WCC3 2CSHA 2ENAA 1A1HA 2NABA 2YTEA 1ZAAC 2EM7A 1NCSA 3MHSC 2EM2A 2WBTA 4M9VC 1YUIA 1X3CA 1YUJA 2EM8A 4IJDA 1JK2A 5KL3A 2EOFA 2EMLA 2DLKA 3EPLA 1YSAC 3M99B 1A1FA 2JP9A 3EPHA 2EMHA 1X6FA 4R2DA 3MHHC 1X5WA 2YTQA 4R2PA 3EPKA 2EM5A 2M9AA 5KL7A 1JK1A 1A1IA 4FK5C 2EOXA 1BBOA 2EM4A 2YRKA 2D9HA 2DLQA 2EOMA 2WBSA 2JPAA 2EMFA 1A1JA 2LCEA 4R2SA 3UK3C 2EN6A 2LV2A 2YTIA 3VHTB 4R2RA 1B69A 2I13A 2EN7A 1F2IG 2EMCA 2E72A 2EN8A 2YU5A 2EPUA 2EMKA 1X6EA 2ELZA 2HGHA 2LT7A 1ZU1A 3EPJA 2YTDA 2EJ4A 2GHFA 2EMXA 4R2QA 5KL6A 2EL4A 1DGCA 1AAYA 4F6MA 2YRHA 4GZNC 2YSPA 1TF3A 2EE8A 4X9JA 4R2AA 2EMZA 2EOQA 2EMWA 2RPCA 2EN3A 2PRTA 2EMAA 2GLIA 2ENHA 1TF6A 2EPZA 1ZR9A 1RMDA 1X6HA 2EOEA 1G2DC 4F2JC 2MKNA 2YRMA 2ENCA 1A1KA 1WJPA 2VRDA 1G2FC 2EMYA 2EP3A 2EN4A 5KL2A 2EQ1A 1LLMC 1KJKA 2R1FA 5KL5A 2EOHA 5KL4A 2DMIA 2WBUA 2EOZA 1UBDC 2EQ3A 2EL5A 2EM9A 2EPRA 2EOIA 2CT1A 2EPPA 1A1GA 2EMIA 2EMGA
chains in the Genus database with same CATH superfamily
1Z1BA 2ELYA 2YSOA 1TN9A 4DR2E 2Q8UA 4DR3E 2DB2A 4WX9A 4DV5E 2ZM6E 5A6BA 2LBSB 4Q35B 1STUA 3T1YE 2YTGA 3J81C 1RQ0A 2N3GA 4KWYA 4WXCA 1UN6B 4GKJE 1YPNA 1WXRA 4YHHE 4F9AB 2CTDA 4WPYA 2EM3A 2YTJA 5T6JA 4DUZE 4DV7E 2V85A 4J8ZA 2YTPA 1J5EE 2VF1A 2ODRC 1PJSA 2EN2A 2EL6A 4JYAE 4DR1E 1X49A 3LMLA 1X48A 2I9IA 2ENAA 2EM7A 2LJHA 4WXDA 2EPMX 1T38A 5DNYA 5TSEA 2E1MA 4IJDA 1JK2A 2UXDE 4DV6E 2EOFA 2V8QB 3M99B 2UXBE 1A1FA 5FLXC 2EMHA 4F9BB 3ZOQB 2YTQA 4O5GA 4P78A 4BC9A 3EPKA 3HTXA 4LU9A 1JK1A 2BBGA 2JWOA 4RH8A 2NUGA 4DV2E 2EOXA 5AE2A 1AH5A 2EM4A 2YRKA 1DI2A 2WBSA 1IBLE 4B3SE 1L4SA 1A1JA 5AE3A 2L2NA 1I94E 2EPOA 1EH6A 2L3JA 2EWLA 1F2IG 2EMCA 2EMKA 2HGHA 1ZU1A 1FKAE 2EJ4A 3L00A 5A6KA 1QU6A 2L2KB 2YRHA 2YSPA 3IWDA 5A6AA 4LTYA 3DJWA 4BHBA 5LL6R 2DIXA 4JV5E 2EZ6A 1QNTA 5LLQA 3BGHA 4X64E 5F3WA 3KWRA 1MGTA 1HNWE 2R76A 4F2JC 3C6MA 1EKZA 2LUPB 2GPIA 3K6QA 3J80C 2UXCE 1EH8A 3ADIA 2EQ1A 1LLMC 5A2QC 2R1FA 4NXNE 4DR4E 5KL5A 2EQ3A 4BS9A 2LTSA 2EL5A 2EPRA 2CT1A 4WYQB 4JI5E 1YYOA 2B7VA 3BBGA 1GTKA 4LF8E 3EQ1A 4X8WA 2EM0A 1HR0E 5IXMB 1NEIA 2UUCE 1BB8A 1BBGA 4IS1C 2YU8A 3IWCA 4R2CA 4KHPE 3J7AG 5A6JA 4DR7E 2L92A 1N36E 4TUIA 2UUAE 1WHNA 2K4VA 4DR6E 4AQYE 4DV0E 2V83A 2EN1A 5AE1A 1PDAA 2EPAA 2DGCA 3HPZA 2K7IA 1YYWA 2EOSA 2MKDA 2RSIA 1XMQE 4ZYGA 4I8OA 2EOYA 2JOXA 2YTNA 1J26A 1ZAAC 2NABA 1RC7A 4R03A 3MHSC 4JI8E 4LFAE 3AUZA 4JI0E 4M9VC 1YUIA 1X3CA 4DUYE 1YFHA 1XNQE 2LMZA 2JP9A 3EPHA 1EH7A 4M30A 4R2DA 1IQSA 3MHHC 4RHBB 4R2PA 2VQFE 5AC5A 2ODRD 4FK5C 4OX9E 4L5NC 4GKKE 2JPAA 2M1SA 2B7TA 2EMFA 3ADJA 4DKKA 4ZYHA 2YTIA 1N34E 1B69A 2EN7A 2RSMA 3ECRA 2EPUA 1X6EA 2UU9E 1N3GA 2GHFA 2EMXA 4R2QA 2B9DA 5KL6A 3OMLA 2JYAA 2EE8A 4X9JA 2EOQA 3HPSA 3RMPA 1ZBTA 1IQOA 2EN3A 2GLIA 4BCAA 2EPZA 1ZR9A 2LE2A 2N8XA 3H09A 2YRMA 4DV4E 1FJGE 2ENCA 2EP3A 2LJUA 2EN4A 4BBYA 3LLHA 2WBUA 2DMIA 3KZZA 4JI6E 2JXPA 2MC5A 2HJJA 3C6KA 2EOIA 2EPPA 5IWAE 4N4RB 2EMGA 2MC6A 2FV4B 5BR8E 2H36X 4KZSA 4HTGA 4DV3E 4B3TE 4BC7A 1SR9A 4MLVA 2EMBA 3ADLA 2L6MA 2EQ0A 2WZOA 1N33E 4F54A 4GEQB 3C4TA 4YY3E 2LO3A 3QG5C 4NZVA 1DQ3A 2F8BA 4F9CB 1P47A 2EOOA 1MEYC 3JAMC 2EPNA 3J7Yp 2YPNA 3BIDA 2NUEA 5AASA 5LMNE 1T39A 3VYYA 4DR5E 2EPCA 2RS7A 4P7DA 2CSHA 2RQLA 2YTEA 3VK6A 2LTRA 4LFCE 2JVAA 2V89A 3IWBA 2L8TA 2WBTA 2NUFA 2V86A 3F6GA 2EM8A 2B3TB 2DLKA 2N3HA 2KHXA 2L33A 2FTXB 1X5WA 5ADZA 4O24A 2JOBA 4LF6E 4MLQA 1A1IA 2LRSA 1BBOA 2DLQA 4TUGA 4X65E 2LCEA 2FGGA 4LF5E 2F4VE 2EN6A 2LV2A 3VHTB 2EPLX 4R2RA 1YYKA 3THNA 2EN8A 2YU5A 5IT9C 4NHRA 1UHZA 3ADGA 3EPJA 3F6HA 1T4LB 2IHR1 2V88A 5IV8B 1ZBQA 4B3ME 4JI1E 5A6BD 2EL4A 4F6MA 4GZNC 4DV1E 3DF6A 3P1XA 3C4BA 4JI2E 4ZYEA 2EMWA 1XNRE 2PRTA 1N32E 2ENHA 2RTXA 4LFBE 1T4OA 2VQEE 1X6HA 1G2DC 1IBME 4JI4E 1A1KA 1WJPA 1G2FC 3THOB 5KL2A 1KJKA 2EOHA 5KL4A 4LF7E 2EOZA 1UBDC 2DSYA 4DMIA 3HQ1A 4X66E 3JU0A 1A1GA 5CFFE 2EPKX 2EMIA 4R2EA 1PJTA 2EPXA 3AV0A 2EOJA 4M0VA 4R8OA 3TQMA 4F6NA 2EM6A 4HEIA 2BB8A 2YTOA 4WSGA 2J7JA 2LVHA 3T1HE 2UUBE 4K0KE 4O4KA 2A25A 3OTOE 2EORA 2YTFA 1A1LA 2CPNA 4B3RE 4BHCA 4ZYDA 2MDGA 2DRPA 2WCC3 2ADRA 3JTZA 1X47A 2RS6A 2YT4A 1A1HA 1NCSA 2KOUA 2V87A 4OOGC 1KYQA 2EM2A 2M4IA 1YUJA 3BF2A 3VYXA 5KL3A 2EMLA 3HXLA 2L3CA 3EPLA 1YSAC 1X6FA 2MDRA 2L2MA 2NA2A 2EM5A 2M9AA 2M7QA 5KL7A 1UILA 1XMOE 5LMUE 3FIGA 2D9HA 2YWQA 2EOMA 2LUQA 2VE7C 1PKPA 5A69A 4R2SA 3UK3C 4L8NA 2I13A 1GQEA 1WHQA 2E72A 4X62E 2ELZA 2LT7A 4Q28A 4LF4E 2JY9A 2HC5A 2YTDA 3KZYA 2YZTA 4JI7E 4M2ZA 1DGCA 1AAYA 1TF3A 4NXME 3MSWA 2JR1A 4R2AA 2EMZA 2KONA 4JI3E 2RPCA 2EMAA 1TF6A 4WFTA 1SFEA 1RMDA 4WSPA 5AC4A 2EOEA 2DMYA 2MKNA 2G7HA 1T4NA 1PJQA 1HNZE 2VRDA 2HHHE 1YZ9A 2EMYA 1IMUA 1GZ6A 1IBKE 2EM9A 1WRJA 1O0WA 4LF9E 2E5LE 1HNXE 4BMJA 4O43A
chains in the Genus database with same CATH topology
1Z1BA 2ELYA 2YSOA 2EM0A 1TN9A 4R2EA 2EPXA 1BB8A 2EOJA 4IS1C 2YU8A 4R2CA 2YTGA 4F6NA 1UN6B 2EMBA 2EM6A 2EQ0A 2BB8A 2YTOA 4WSGA 2CTDA 2J7JA 2LO3A 2LVHA 2EM3A 2YTJA 2A25A 2EN1A 1P47A 2EOOA 1MEYC 2EORA 2EPAA 2DGCA 2YTPA 2YTFA 1A1LA 2EOSA 2MKDA 2RSIA 2EN2A 2EL6A 2MDGA 2EOYA 2YTNA 2DRPA 2EPCA 2ADRA 2WCC3 2CSHA 2ENAA 1A1HA 2NABA 2YTEA 1ZAAC 2EM7A 1NCSA 3MHSC 2EM2A 2WBTA 4M9VC 1YUIA 1X3CA 1YUJA 2EM8A 4IJDA 1JK2A 5KL3A 2EOFA 2EMLA 2DLKA 3EPLA 1YSAC 3M99B 1A1FA 2JP9A 3EPHA 2EMHA 1X6FA 4R2DA 3MHHC 1X5WA 2YTQA 4R2PA 3EPKA 2EM5A 2M9AA 5KL7A 1JK1A 1A1IA 4FK5C 2EOXA 1BBOA 2EM4A 2YRKA 2D9HA 2DLQA 2EOMA 2WBSA 2JPAA 2EMFA 1A1JA 2LCEA 4R2SA 3UK3C 2EN6A 2LV2A 2YTIA 3VHTB 4R2RA 1B69A 2I13A 2EN7A 1F2IG 2EMCA 2E72A 2EN8A 2YU5A 2EPUA 2EMKA 1X6EA 2ELZA 2HGHA 2LT7A 1ZU1A 3EPJA 2YTDA 2EJ4A 2GHFA 2EMXA 4R2QA 5KL6A 2EL4A 1DGCA 1AAYA 4F6MA 2YRHA 4GZNC 2YSPA 1TF3A 2EE8A 4X9JA 4R2AA 2EMZA 2EOQA 2EMWA 2RPCA 2EN3A 2PRTA 2EMAA 2GLIA 2ENHA 1TF6A 2EPZA 1ZR9A 1RMDA 1X6HA 2EOEA 1G2DC 4F2JC 2MKNA 2YRMA 2ENCA 1A1KA 1WJPA 2VRDA 1G2FC 2EMYA 2EP3A 2EN4A 5KL2A 2EQ1A 1LLMC 1KJKA 2R1FA 5KL5A 2EOHA 5KL4A 2DMIA 2WBUA 2EOZA 1UBDC 2EQ3A 2EL5A 2EM9A 2EPRA 2EOIA 2CT1A 2EPPA 1A1GA 2EMIA 2EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  2ELY A;  2YSO A;  2EM0 A;  1TN9 A;  4R2E A;  2EPX A;  1BB8 A;  2EOJ A;  4IS1 C;  2YU8 A;  4R2C A;  2YTG A;  4F6N A;  1UN6 B;  2EMB A;  2EM6 A;  2EQ0 A;  2BB8 A;  2YTO A;  4WSG A;  2CTD A;  2J7J A;  2LO3 A;  2LVH A;  2EM3 A;  2YTJ A;  2A25 A;  2EN1 A;  1P47 A;  2EOO A;  1MEY C;  2EOR A;  2EPA A;  2DGC A;  2YTP A;  2YTF A;  1A1L A;  2EOS A;  2MKD A;  2RSI A;  2EN2 A;  2EL6 A;  2MDG A;  2EOY A;  2YTN A;  2DRP A;  2EPC A;  2ADR A;  2WCC 3;  2CSH A;  2ENA A;  1A1H A;  2NAB A;  2YTE A;  1ZAA C;  2EM7 A;  1NCS A;  3MHS C;  2EM2 A;  2WBT A;  4M9V C;  1YUI A;  1X3C A;  1YUJ A;  2EM8 A;  4IJD A;  1JK2 A;  5KL3 A;  2EOF A;  2EML A;  2DLK A;  3EPL A;  1YSA C;  3M99 B;  1A1F A;  2JP9 A;  3EPH A;  2EMH A;  1X6F A;  4R2D A;  3MHH C;  1X5W A;  2YTQ A;  4R2P A;  3EPK A;  2EM5 A;  2M9A A;  5KL7 A;  1JK1 A;  1A1I A;  4FK5 C;  2EOX A;  1BBO A;  2EM4 A;  2YRK A;  2D9H A;  2DLQ A;  2EOM A;  2WBS A;  2JPA A;  2EMF A;  1A1J A;  2LCE A;  4R2S A;  3UK3 C;  2EN6 A;  2LV2 A;  2YTI A;  3VHT B;  4R2R A;  1B69 A;  2I13 A;  2EN7 A;  1F2I G;  2EMC A;  2E72 A;  2EN8 A;  2YU5 A;  2EPU A;  2EMK A;  1X6E A;  2ELZ A;  2HGH A;  2LT7 A;  1ZU1 A;  3EPJ A;  2YTD A;  2EJ4 A;  2GHF A;  2EMX A;  4R2Q A;  5KL6 A;  2EL4 A;  1DGC A;  1AAY A;  4F6M A;  2YRH A;  4GZN C;  2YSP A;  1TF3 A;  2EE8 A;  4X9J A;  4R2A A;  2EMZ A;  2EOQ A;  2EMW A;  2RPC A;  2EN3 A;  2PRT A;  2EMA A;  2GLI A;  2ENH A;  1TF6 A;  2EPZ A;  1ZR9 A;  1RMD A;  1X6H A;  2EOE A;  1G2D C;  4F2J C;  2MKN A;  2YRM A;  2ENC A;  1A1K A;  1WJP A;  2VRD A;  1G2F C;  2EMY A;  2EP3 A;  2EN4 A;  5KL2 A;  2EQ1 A;  1LLM C;  1KJK A;  2R1F A;  5KL5 A;  2EOH A;  5KL4 A;  2DMI A;  2WBU A;  2EOZ A;  1UBD C;  2EQ3 A;  2EL5 A;  2EM9 A;  2EPR A;  2EOI A;  2CT1 A;  2EPP A;  1A1G A;  2EMI A;  2EMG A; 
#chains in the Genus database with same CATH topology
 1Z1B A;  2ELY A;  2YSO A;  1TN9 A;  4DR2 E;  2Q8U A;  4DR3 E;  2DB2 A;  4WX9 A;  4DV5 E;  2ZM6 E;  5A6B A;  2LBS B;  4Q35 B;  1STU A;  3T1Y E;  2YTG A;  3J81 C;  1RQ0 A;  2N3G A;  4KWY A;  4WXC A;  1UN6 B;  4GKJ E;  1YPN A;  1WXR A;  4YHH E;  4F9A B;  2CTD A;  4WPY A;  2EM3 A;  2YTJ A;  5T6J A;  4DUZ E;  4DV7 E;  2V85 A;  4J8Z A;  2YTP A;  1J5E E;  2VF1 A;  2ODR C;  1PJS A;  2EN2 A;  2EL6 A;  4JYA E;  4DR1 E;  1X49 A;  3LML A;  1X48 A;  2I9I A;  2ENA A;  2EM7 A;  2LJH A;  4WXD A;  2EPM X;  1T38 A;  5DNY A;  5TSE A;  2E1M A;  4IJD A;  1JK2 A;  2UXD E;  4DV6 E;  2EOF A;  2V8Q B;  3M99 B;  2UXB E;  1A1F A;  5FLX C;  2EMH A;  4F9B B;  3ZOQ B;  2YTQ A;  4O5G A;  4P78 A;  4BC9 A;  3EPK A;  3HTX A;  4LU9 A;  1JK1 A;  2BBG A;  2JWO A;  4RH8 A;  2NUG A;  4DV2 E;  2EOX A;  5AE2 A;  1AH5 A;  2EM4 A;  2YRK A;  1DI2 A;  2WBS A;  1IBL E;  4B3S E;  1L4S A;  1A1J A;  5AE3 A;  2L2N A;  1I94 E;  2EPO A;  1EH6 A;  2L3J A;  2EWL A;  1F2I G;  2EMC A;  2EMK A;  2HGH A;  1ZU1 A;  1FKA E;  2EJ4 A;  3L00 A;  5A6K A;  1QU6 A;  2L2K B;  2YRH A;  2YSP A;  3IWD A;  5A6A A;  4LTY A;  3DJW A;  4BHB A;  5LL6 R;  2DIX A;  4JV5 E;  2EZ6 A;  1QNT A;  5LLQ A;  3BGH A;  4X64 E;  5F3W A;  3KWR A;  1MGT A;  1HNW E;  2R76 A;  4F2J C;  3C6M A;  1EKZ A;  2LUP B;  2GPI A;  3K6Q A;  3J80 C;  2UXC E;  1EH8 A;  3ADI A;  2EQ1 A;  1LLM C;  5A2Q C;  2R1F A;  4NXN E;  4DR4 E;  5KL5 A;  2EQ3 A;  4BS9 A;  2LTS A;  2EL5 A;  2EPR A;  2CT1 A;  4WYQ B;  4JI5 E;  1YYO A;  2B7V A;  3BBG A;  1GTK A;  4LF8 E;  3EQ1 A;  4X8W A;  2EM0 A;  1HR0 E;  5IXM B;  1NEI A;  2UUC E;  1BB8 A;  1BBG A;  4IS1 C;  2YU8 A;  3IWC A;  4R2C A;  4KHP E;  3J7A G;  5A6J A;  4DR7 E;  2L92 A;  1N36 E;  4TUI A;  2UUA E;  1WHN A;  2K4V A;  4DR6 E;  4AQY E;  4DV0 E;  2V83 A;  2EN1 A;  5AE1 A;  1PDA A;  2EPA A;  2DGC A;  3HPZ A;  2K7I A;  1YYW A;  2EOS A;  2MKD A;  2RSI A;  1XMQ E;  4ZYG A;  4I8O A;  2EOY A;  2JOX A;  2YTN A;  1J26 A;  1ZAA C;  2NAB A;  1RC7 A;  4R03 A;  3MHS C;  4JI8 E;  4LFA E;  3AUZ A;  4JI0 E;  4M9V C;  1YUI A;  1X3C A;  4DUY E;  1YFH A;  1XNQ E;  2LMZ A;  2JP9 A;  3EPH A;  1EH7 A;  4M30 A;  4R2D A;  1IQS A;  3MHH C;  4RHB B;  4R2P A;  2VQF E;  5AC5 A;  2ODR D;  4FK5 C;  4OX9 E;  4L5N C;  4GKK E;  2JPA A;  2M1S A;  2B7T A;  2EMF A;  3ADJ A;  4DKK A;  4ZYH A;  2YTI A;  1N34 E;  1B69 A;  2EN7 A;  2RSM A;  3ECR A;  2EPU A;  1X6E A;  2UU9 E;  1N3G A;  2GHF A;  2EMX A;  4R2Q A;  2B9D A;  5KL6 A;  3OML A;  2JYA A;  2EE8 A;  4X9J A;  2EOQ A;  3HPS A;  3RMP A;  1ZBT A;  1IQO A;  2EN3 A;  2GLI A;  4BCA A;  2EPZ A;  1ZR9 A;  2LE2 A;  2N8X A;  3H09 A;  2YRM A;  4DV4 E;  1FJG E;  2ENC A;  2EP3 A;  2LJU A;  2EN4 A;  4BBY A;  3LLH A;  2WBU A;  2DMI A;  3KZZ A;  4JI6 E;  2JXP A;  2MC5 A;  2HJJ A;  3C6K A;  2EOI A;  2EPP A;  5IWA E;  4N4R B;  2EMG A;  2MC6 A;  2FV4 B;  5BR8 E;  2H36 X;  4KZS A;  4HTG A;  4DV3 E;  4B3T E;  4BC7 A;  1SR9 A;  4MLV A;  2EMB A;  3ADL A;  2L6M A;  2EQ0 A;  2WZO A;  1N33 E;  4F54 A;  4GEQ B;  3C4T A;  4YY3 E;  2LO3 A;  3QG5 C;  4NZV A;  1DQ3 A;  2F8B A;  4F9C B;  1P47 A;  2EOO A;  1MEY C;  3JAM C;  2EPN A;  3J7Y p;  2YPN A;  3BID A;  2NUE A;  5AAS A;  5LMN E;  1T39 A;  3VYY A;  4DR5 E;  2EPC A;  2RS7 A;  4P7D A;  2CSH A;  2RQL A;  2YTE A;  3VK6 A;  2LTR A;  4LFC E;  2JVA A;  2V89 A;  3IWB A;  2L8T A;  2WBT A;  2NUF A;  2V86 A;  3F6G A;  2EM8 A;  2B3T B;  2DLK A;  2N3H A;  2KHX A;  2L33 A;  2FTX B;  1X5W A;  5ADZ A;  4O24 A;  2JOB A;  4LF6 E;  4MLQ A;  1A1I A;  2LRS A;  1BBO A;  2DLQ A;  4TUG A;  4X65 E;  2LCE A;  2FGG A;  4LF5 E;  2F4V E;  2EN6 A;  2LV2 A;  3VHT B;  2EPL X;  4R2R A;  1YYK A;  3THN A;  2EN8 A;  2YU5 A;  5IT9 C;  4NHR A;  1UHZ A;  3ADG A;  3EPJ A;  3F6H A;  1T4L B;  2IHR 1;  2V88 A;  5IV8 B;  1ZBQ A;  4B3M E;  4JI1 E;  5A6B D;  2EL4 A;  4F6M A;  4GZN C;  4DV1 E;  3DF6 A;  3P1X A;  3C4B A;  4JI2 E;  4ZYE A;  2EMW A;  1XNR E;  2PRT A;  1N32 E;  2ENH A;  2RTX A;  4LFB E;  1T4O A;  2VQE E;  1X6H A;  1G2D C;  1IBM E;  4JI4 E;  1A1K A;  1WJP A;  1G2F C;  3THO B;  5KL2 A;  1KJK A;  2EOH A;  5KL4 A;  4LF7 E;  2EOZ A;  1UBD C;  2DSY A;  4DMI A;  3HQ1 A;  4X66 E;  3JU0 A;  1A1G A;  5CFF E;  2EPK X;  2EMI A;  4R2E A;  1PJT A;  2EPX A;  3AV0 A;  2EOJ A;  4M0V A;  4R8O A;  3TQM A;  4F6N A;  2EM6 A;  4HEI A;  2BB8 A;  2YTO A;  4WSG A;  2J7J A;  2LVH A;  3T1H E;  2UUB E;  4K0K E;  4O4K A;  2A25 A;  3OTO E;  2EOR A;  2YTF A;  1A1L A;  2CPN A;  4B3R E;  4BHC A;  4ZYD A;  2MDG A;  2DRP A;  2WCC 3;  2ADR A;  3JTZ A;  1X47 A;  2RS6 A;  2YT4 A;  1A1H A;  1NCS A;  2KOU A;  2V87 A;  4OOG C;  1KYQ A;  2EM2 A;  2M4I A;  1YUJ A;  3BF2 A;  3VYX A;  5KL3 A;  2EML A;  3HXL A;  2L3C A;  3EPL A;  1YSA C;  1X6F A;  2MDR A;  2L2M A;  2NA2 A;  2EM5 A;  2M9A A;  2M7Q A;  5KL7 A;  1UIL A;  1XMO E;  5LMU E;  3FIG A;  2D9H A;  2YWQ A;  2EOM A;  2LUQ A;  2VE7 C;  1PKP A;  5A69 A;  4R2S A;  3UK3 C;  4L8N A;  2I13 A;  1GQE A;  1WHQ A;  2E72 A;  4X62 E;  2ELZ A;  2LT7 A;  4Q28 A;  4LF4 E;  2JY9 A;  2HC5 A;  2YTD A;  3KZY A;  2YZT A;  4JI7 E;  4M2Z A;  1DGC A;  1AAY A;  1TF3 A;  4NXM E;  3MSW A;  2JR1 A;  4R2A A;  2EMZ A;  2KON A;  4JI3 E;  2RPC A;  2EMA A;  1TF6 A;  4WFT A;  1SFE A;  1RMD A;  4WSP A;  5AC4 A;  2EOE A;  2DMY A;  2MKN A;  2G7H A;  1T4N A;  1PJQ A;  1HNZ E;  2VRD A;  2HHH E;  1YZ9 A;  2EMY A;  1IMU A;  1GZ6 A;  1IBK E;  2EM9 A;  1WRJ A;  1O0W A;  4LF9 E;  2E5L E;  1HNX E;  4BMJ A;  4O43 A; 
#chains in the Genus database with same CATH homology
 1Z1B A;  2ELY A;  2YSO A;  2EM0 A;  1TN9 A;  4R2E A;  2EPX A;  1BB8 A;  2EOJ A;  4IS1 C;  2YU8 A;  4R2C A;  2YTG A;  4F6N A;  1UN6 B;  2EMB A;  2EM6 A;  2EQ0 A;  2BB8 A;  2YTO A;  4WSG A;  2CTD A;  2J7J A;  2LO3 A;  2LVH A;  2EM3 A;  2YTJ A;  2A25 A;  2EN1 A;  1P47 A;  2EOO A;  1MEY C;  2EOR A;  2EPA A;  2DGC A;  2YTP A;  2YTF A;  1A1L A;  2EOS A;  2MKD A;  2RSI A;  2EN2 A;  2EL6 A;  2MDG A;  2EOY A;  2YTN A;  2DRP A;  2EPC A;  2ADR A;  2WCC 3;  2CSH A;  2ENA A;  1A1H A;  2NAB A;  2YTE A;  1ZAA C;  2EM7 A;  1NCS A;  3MHS C;  2EM2 A;  2WBT A;  4M9V C;  1YUI A;  1X3C A;  1YUJ A;  2EM8 A;  4IJD A;  1JK2 A;  5KL3 A;  2EOF A;  2EML A;  2DLK A;  3EPL A;  1YSA C;  3M99 B;  1A1F A;  2JP9 A;  3EPH A;  2EMH A;  1X6F A;  4R2D A;  3MHH C;  1X5W A;  2YTQ A;  4R2P A;  3EPK A;  2EM5 A;  2M9A A;  5KL7 A;  1JK1 A;  1A1I A;  4FK5 C;  2EOX A;  1BBO A;  2EM4 A;  2YRK A;  2D9H A;  2DLQ A;  2EOM A;  2WBS A;  2JPA A;  2EMF A;  1A1J A;  2LCE A;  4R2S A;  3UK3 C;  2EN6 A;  2LV2 A;  2YTI A;  3VHT B;  4R2R A;  1B69 A;  2I13 A;  2EN7 A;  1F2I G;  2EMC A;  2E72 A;  2EN8 A;  2YU5 A;  2EPU A;  2EMK A;  1X6E A;  2ELZ A;  2HGH A;  2LT7 A;  1ZU1 A;  3EPJ A;  2YTD A;  2EJ4 A;  2GHF A;  2EMX A;  4R2Q A;  5KL6 A;  2EL4 A;  1DGC A;  1AAY A;  4F6M A;  2YRH A;  4GZN C;  2YSP A;  1TF3 A;  2EE8 A;  4X9J A;  4R2A A;  2EMZ A;  2EOQ A;  2EMW A;  2RPC A;  2EN3 A;  2PRT A;  2EMA A;  2GLI A;  2ENH A;  1TF6 A;  2EPZ A;  1ZR9 A;  1RMD A;  1X6H A;  2EOE A;  1G2D C;  4F2J C;  2MKN A;  2YRM A;  2ENC A;  1A1K A;  1WJP A;  2VRD A;  1G2F C;  2EMY A;  2EP3 A;  2EN4 A;  5KL2 A;  2EQ1 A;  1LLM C;  1KJK A;  2R1F A;  5KL5 A;  2EOH A;  5KL4 A;  2DMI A;  2WBU A;  2EOZ A;  1UBD C;  2EQ3 A;  2EL5 A;  2EM9 A;  2EPR A;  2EOI A;  2CT1 A;  2EPP A;  1A1G A;  2EMI A;  2EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...