2LO3A

Solution structure of sgf73(59-102) zinc finger domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
NPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the role of SGF11 and SGF73 for the interaction between SAGA and nucleosomes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SAGA-associated factor 73
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18508 zf_C2H2_13 Zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lo3A01
2EN1A 1G2FC 1TF3A 1A1FA 2EMWA 2WBTA 1LLMC 2EQ1A 1WJPA 2ELYA 1G2DC 2YTIA 2WBUA 3EPHA 1X5WA 2DGCA 2EPRA 2EOSA 2NABA 2RSIA 1X6HA 2EMLA 2YTFA 2LVHA 1RMDA 2EQ3A 2EN2A 2EMZA 1NCSA 3MHSC 2EM8A 2EN3A 1MEYC 2EE8A 1DGCA 1F2IG 5KL5A 4FK5C 2YRHA 2ENHA 2EM6A 4F2JC 2EOXA 5KL6A 2EMHA 2EL5A 5KL7A 1JK2A 2EM2A 2GLIA 2EORA 1JK1A 3EPJA 2EOQA 2EMGA 2VRDA 1A1GA 2DLKA 2YTGA 2YU5A 2YTNA 2YTQA 1P47A 4R2DA 4R2SA 1A1LA 4R2RA 2EM3A 2EMAA 4GZNC 2ENCA 2EN6A 2EN4A 1BBOA 2DLQA 2I13A 1X6FA 2RPCA 2MDGA 2EMFA 1UN6B 3UK3C 1A1JA 1B69A 2EMXA 1TN9A 2EOMA 2EP3A 2YU8A 4R2CA 2EOYA 2EL6A 2CT1A 2EL4A 2JPAA 2EM9A 2EOHA 2J7JA 2WCC3 2EOJA 2R1FA 2YSOA 2ADRA 2EMKA 3MHHC 2MKNA 2EPXA 2GHFA 2ENAA 2JP9A 1KJKA 2EPZA 1A1IA 1AAYA 4IS1C 2LCEA 2DMIA 2A25A 2EOIA 2WBSA 2YRMA 1A1KA 1TF6A 2YTEA 1YUIA 2EN8A 2YTOA 2EOOA 4F6MA 1ZR9A 2YRKA 4IJDA 2YTPA 3EPKA 1X3CA 2LV2A 2LT7A 5KL2A 3VHTB 4F6NA 3EPLA 1ZAAC 2EOFA 2EMCA 2EPAA 2EMIA 2D9HA 2EM5A 1YUJA 2E72A 4R2AA 2EPCA 4R2PA 4M9VC 2PRTA 2EM7A 1X6EA 2EMYA 2YTDA 1YSAC 3M99B 5KL3A 2EPPA 2ELZA 2YSPA 2HGHA 2EPUA 2YTJA 1Z1BA 1UBDC 4R2EA 2EOEA 1ZU1A 2BB8A 2DRPA 2EMBA 4X9JA 2M9AA 2EJ4A 2EM0A 2EM4A 4R2QA 1BB8A 1A1HA 2CTDA 2EOZA 2EN7A 2EQ0A 4WSGA 5KL4A 2CSHA 2LO3A 2MKDA
chains in the Genus database with same CATH superfamily
2RQLA 1T38A 2H36X 1KYQA 3C4TA 2HC5A 2WBTA 1FJGE 1LLMC 2HHHE 1PDAA 1X49A 2EWLA 3EPHA 2WBUA 3VK6A 2RSIA 1X6HA 2YTFA 2LVHA 1RMDA 2V87A 3MHSC 2LJUA 4DV3E 2B9DA 2YPNA 2L6MA 4X64E 4F2JC 1RQ0A 3BGHA 2JYAA 4LF8E 2N3GA 2L3JA 1JK1A 1T39A 2VRDA 2VE7C 1A1GA 4F9BB 3DJWA 4DR4E 2JY9A 4R2SA 1X47A 4R2RA 2ENCA 4DUYE 5A6AA 2DLQA 1BBOA 5LLQA 2ODRC 3BIDA 5IXMB 4B3SE 3OTOE 5LMNE 2EPKX 2N8XA 2G7HA 3HQ1A 4O5GA 2EOYA 2V89A 4RHBB 4X8WA 5A2QC 2L2KB 2EM9A 2WCC3 4JV5E 5A6BA 2ADRA 5CFFE 2GHFA 2JP9A 2RTXA 1AAYA 3VYYA 2FGGA 2JR1A 2LJHA 1IBLE 2LCEA 4B3RE 2YRMA 1WHQA 4NXNE 2YTEA 2EOOA 1N3GA 4BHCA 4LFBE 5TSEA 1GZ6A 2ODRD 2LT7A 3ADLA 4L5NC 4O24A 1STUA 2D9HA 5BR8E 3C6KA 3H09A 2EPCA 3J7AG 2JWOA 4P78A 4J8ZA 1YYKA 4O4KA 4TUIA 2LMZA 2V88A 4TUGA 2V86A 3ADGA 2HGHA 1IQOA 1Z1BA 1UBDC 4ZYHA 2JXPA 1N36E 2EMBA 2MDRA 2ZM6E 4LFAE 2EJ4A 4DR7E 2V8QB 2EQ0A 2KHXA 5IT9C 3QG5C 4DV6E 3J80C 4BCAA 4DR6E 2IHR1 1SFEA 5LMUE 4DV2E 2EQ1A 2LBSB 3VYXA 4DV7E 2YTIA 2DB2A 2DGCA 3KWRA 2EPRA 3L00A 4O43A 1PJQA 2Q8UA 2NABA 4DR5E 3ADJA 1EH8A 2L3CA 5ADZA 1XNQE 2EN2A 3THOB 1WXRA 1F2IG 5KL5A 1ZBQA 4JI1E 4KWYA 4GKJE 2EL5A 1GQEA 3BF2A 4F9CB 2GLIA 3EPJA 4WYQB 2EMGA 4DV4E 4YHHE 2K7IA 2YTNA 1P47A 2N3HA 3IWBA 4I8OA 1IBKE 2K4VA 2LUPB 2EMAA 4GZNC 2EN6A 2MC6A 2EN4A 3T1YE 4LF7E 5AE2A 5AASA 1UILA 1FKAE 2LE2A 4MLQA 2EMFA 3HTXA 2YT4A 2DSYA 1PKPA 1EH7A 1YPNA 2UXDE 2EOMA 2UUBE 2EL4A 4R8OA 2EOHA 2RS7A 2R1FA 2YSOA 2EPXA 2L33A 2ENAA 1KJKA 4DR1E 4BC9A 1IQSA 4WX9A 5FLXC 1BBGA 3KZYA 1J26A 2R76A 1TF6A 4X66E 1YUIA 4F6MA 2V85A 2YRKA 1T4LB 4ZYGA 4IJDA 2YTPA 1X3CA 2L8TA 2LV2A 4Q28A 4DV1E 2B7TA 2UXBE 4F6NA 2EMIA 2EM5A 2E72A 4R2AA 2EPNA 4BMJA 1YYWA 2JOBA 1X6EA 2YTDA 4NHRA 2YSPA 4JI4E 1O0WA 4R2EA 4N4RB 2L92A 2WZOA 4DR2E 3EQ1A 4JI0E 2EM4A 4JI7E 4ZYDA 4WSGA 5KL4A 3AUZA 3TQMA 5F3WA 2L2NA 3RMPA 4RH8A 3C4BA 1WHNA 2LO3A 2MKDA 4JYAE 2EN1A 1G2FC 1TF3A 2EMWA 4LU9A 2L2MA 1DI2A 4BHBA 4JI5E 1MGTA 2ELYA 4BBYA 3MSWA 3BBGA 1X5WA 1XMQE 1IMUA 2EMLA 3ADIA 4LF4E 4KHPE 5AE3A 1MEYC 4FK5C 1YYOA 2ENHA 5KL6A 4BC7A 2LTRA 2EORA 2DIXA 1L4SA 2EOQA 4JI3E 4WSPA 4GKKE 1HNZE 5DNYA 2YTGA 2YU5A 5IV8B 2YTQA 1N34E 4WXDA 1NEIA 2YZTA 1YZ9A 2EM3A 3IWDA 5A6KA 4LFCE 3K6QA 3HPZA 2EPLX 1X6FA 2RPCA 2MDGA 4JI6E 3ZOQB 1A1JA 3P1XA 1B69A 2EP3A 3J81C 3F6GA 2YU8A 4R2CA 2EL6A 2CT1A 2NUEA 2LUQA 4DV5E 2J7JA 2EOJA 3MHHC 2CPNA 1A1IA 4ZYEA 3THNA 3KZZA 2F4VE 4OX9E 2DMIA 2WBSA 1A1KA 1N33E 2EN8A 2YTOA 1UHZA 1ZR9A 4X65E 2EZ6A 3VHTB 1IBME 1N32E 4GEQB 1ZAAC 2VQEE 1YUJA 5A69A 1HNXE 1QU6A 2RS6A 5T6JA 4R2PA 4NXME 2DMYA 4F54A 3JAMC 2KOUA 2EMYA 4DUZE 2GPIA 1YSAC 1J5EE 3M99B 1T4NA 5AC5A 5KL3A 4HTGA 2ELZA 4DKKA 2EPUA 3HXLA 2YTJA 2FTXB 2EOEA 1ZU1A 2DRPA 4OOGC 2B3TB 2V83A 2M9AA 4K0KE 2F8BA 4R2QA 5A6JA 1A1HA 2EOZA 2EN7A 2M4IA 2UUCE 4X62E 1DGCA 1YFHA 1A1FA 5A6BD 4LF5E 1XMOE 1WJPA 1G2DC 2EOSA 5AE1A 3ECRA 2NUGA 4WFTA 2EQ3A 2EMZA 1NCSA 2I9IA 2BBGA 4MLVA 2EM8A 2EN3A 3AV0A 2EE8A 4DV0E 2MC5A 2YRHA 2EM6A 1HR0E 2B7VA 2EOXA 2EMHA 2JVAA 5KL7A 1JK2A 2EM2A 2HJJA 1AH5A 1HNWE 2YWQA 4LTYA 2FV4B 1PJSA 2DLKA 4JI8E 4DR3E 4NZVA 2UUAE 4JI2E 4M0VA 4R2DA 4AQYE 1A1LA 2E5LE 2NA2A 2M1SA 3C6MA 2KONA 5LL6R 1RC7A 1PJTA 1I94E 3OMLA 2I13A 2NUFA 1SR9A 2LRSA 2EPOA 2M7QA 1DQ3A 4LF6E 3J7Yp 3UK3C 1ZBTA 4DMIA 2LTSA 4L8NA 1UN6B 1TN9A 2EMXA 2VF1A 2VQFE 2JPAA 1EH6A 2EPMX 3T1HE 2EMKA 2MKNA 4F9AB 2RSMA 2EPZA 4Q35B 4BS9A 3IWCA 4IS1C 3HPSA 3LMLA 3JU0A 4LF9E 2A25A 2EOIA 4B3ME 3F6HA 3EPKA 5KL2A 3EPLA 2EOFA 2EMCA 2EPAA 1QNTA 4WXCA 1EKZA 4HEIA 3JTZA 4B3TE 4M9VC 4M30A 2PRTA 1XNRE 2EM7A 3DF6A 2JOXA 1X48A 2UXCE 1WRJA 2EPPA 3FIGA 4KZSA 5IWAE 2E1MA 2BB8A 4X9JA 4R03A 4M2ZA 2EM0A 1BB8A 2CTDA 4YY3E 1GTKA 4WPYA 1T4OA 4P7DA 3LLHA 2CSHA 2UU9E 5AC4A
chains in the Genus database with same CATH topology
2EN1A 1G2FC 1TF3A 1A1FA 2EMWA 2WBTA 1LLMC 2EQ1A 1WJPA 2ELYA 1G2DC 2YTIA 2WBUA 3EPHA 1X5WA 2DGCA 2EPRA 2EOSA 2NABA 2RSIA 1X6HA 2EMLA 2YTFA 2LVHA 1RMDA 2EQ3A 2EN2A 2EMZA 1NCSA 3MHSC 2EM8A 2EN3A 1MEYC 2EE8A 1DGCA 1F2IG 5KL5A 4FK5C 2YRHA 2ENHA 2EM6A 4F2JC 2EOXA 5KL6A 2EMHA 2EL5A 5KL7A 1JK2A 2EM2A 2GLIA 2EORA 1JK1A 3EPJA 2EOQA 2EMGA 2VRDA 1A1GA 2DLKA 2YTGA 2YU5A 2YTNA 2YTQA 1P47A 4R2DA 4R2SA 1A1LA 4R2RA 2EM3A 2EMAA 4GZNC 2ENCA 2EN6A 2EN4A 1BBOA 2DLQA 2I13A 1X6FA 2RPCA 2MDGA 2EMFA 1UN6B 3UK3C 1A1JA 1B69A 2EMXA 1TN9A 2EOMA 2EP3A 2YU8A 4R2CA 2EOYA 2EL6A 2CT1A 2EL4A 2JPAA 2EM9A 2EOHA 2J7JA 2WCC3 2EOJA 2R1FA 2YSOA 2ADRA 2EMKA 3MHHC 2MKNA 2EPXA 2GHFA 2ENAA 2JP9A 1KJKA 2EPZA 1A1IA 1AAYA 4IS1C 2LCEA 2DMIA 2A25A 2EOIA 2WBSA 2YRMA 1A1KA 1TF6A 2YTEA 1YUIA 2EN8A 2YTOA 2EOOA 4F6MA 1ZR9A 2YRKA 4IJDA 2YTPA 3EPKA 1X3CA 2LV2A 2LT7A 5KL2A 3VHTB 4F6NA 3EPLA 1ZAAC 2EOFA 2EMCA 2EPAA 2EMIA 2D9HA 2EM5A 1YUJA 2E72A 4R2AA 2EPCA 4R2PA 4M9VC 2PRTA 2EM7A 1X6EA 2EMYA 2YTDA 1YSAC 3M99B 5KL3A 2EPPA 2ELZA 2YSPA 2HGHA 2EPUA 2YTJA 1Z1BA 1UBDC 4R2EA 2EOEA 1ZU1A 2BB8A 2DRPA 2EMBA 4X9JA 2M9AA 2EJ4A 2EM0A 2EM4A 4R2QA 1BB8A 1A1HA 2CTDA 2EOZA 2EN7A 2EQ0A 4WSGA 5KL4A 2CSHA 2LO3A 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  1G2F C;  1TF3 A;  1A1F A;  2EMW A;  2WBT A;  1LLM C;  2EQ1 A;  1WJP A;  2ELY A;  1G2D C;  2YTI A;  2WBU A;  3EPH A;  1X5W A;  2DGC A;  2EPR A;  2EOS A;  2NAB A;  2RSI A;  1X6H A;  2EML A;  2YTF A;  2LVH A;  1RMD A;  2EQ3 A;  2EN2 A;  2EMZ A;  1NCS A;  3MHS C;  2EM8 A;  2EN3 A;  1MEY C;  2EE8 A;  1DGC A;  1F2I G;  5KL5 A;  4FK5 C;  2YRH A;  2ENH A;  2EM6 A;  4F2J C;  2EOX A;  5KL6 A;  2EMH A;  2EL5 A;  5KL7 A;  1JK2 A;  2EM2 A;  2GLI A;  2EOR A;  1JK1 A;  3EPJ A;  2EOQ A;  2EMG A;  2VRD A;  1A1G A;  2DLK A;  2YTG A;  2YU5 A;  2YTN A;  2YTQ A;  1P47 A;  4R2D A;  4R2S A;  1A1L A;  4R2R A;  2EM3 A;  2EMA A;  4GZN C;  2ENC A;  2EN6 A;  2EN4 A;  1BBO A;  2DLQ A;  2I13 A;  1X6F A;  2RPC A;  2MDG A;  2EMF A;  1UN6 B;  3UK3 C;  1A1J A;  1B69 A;  2EMX A;  1TN9 A;  2EOM A;  2EP3 A;  2YU8 A;  4R2C A;  2EOY A;  2EL6 A;  2CT1 A;  2EL4 A;  2JPA A;  2EM9 A;  2EOH A;  2J7J A;  2WCC 3;  2EOJ A;  2R1F A;  2YSO A;  2ADR A;  2EMK A;  3MHH C;  2MKN A;  2EPX A;  2GHF A;  2ENA A;  2JP9 A;  1KJK A;  2EPZ A;  1A1I A;  1AAY A;  4IS1 C;  2LCE A;  2DMI A;  2A25 A;  2EOI A;  2WBS A;  2YRM A;  1A1K A;  1TF6 A;  2YTE A;  1YUI A;  2EN8 A;  2YTO A;  2EOO A;  4F6M A;  1ZR9 A;  2YRK A;  4IJD A;  2YTP A;  3EPK A;  1X3C A;  2LV2 A;  2LT7 A;  5KL2 A;  3VHT B;  4F6N A;  3EPL A;  1ZAA C;  2EOF A;  2EMC A;  2EPA A;  2EMI A;  2D9H A;  2EM5 A;  1YUJ A;  2E72 A;  4R2A A;  2EPC A;  4R2P A;  4M9V C;  2PRT A;  2EM7 A;  1X6E A;  2EMY A;  2YTD A;  1YSA C;  3M99 B;  5KL3 A;  2EPP A;  2ELZ A;  2YSP A;  2HGH A;  2EPU A;  2YTJ A;  1Z1B A;  1UBD C;  4R2E A;  2EOE A;  1ZU1 A;  2BB8 A;  2DRP A;  2EMB A;  4X9J A;  2M9A A;  2EJ4 A;  2EM0 A;  2EM4 A;  4R2Q A;  1BB8 A;  1A1H A;  2CTD A;  2EOZ A;  2EN7 A;  2EQ0 A;  4WSG A;  5KL4 A;  2CSH A;  2LO3 A;  2MKD A; 
#chains in the Genus database with same CATH topology
 2RQL A;  1T38 A;  2H36 X;  1KYQ A;  3C4T A;  2HC5 A;  2WBT A;  1FJG E;  1LLM C;  2HHH E;  1PDA A;  1X49 A;  2EWL A;  3EPH A;  2WBU A;  3VK6 A;  2RSI A;  1X6H A;  2YTF A;  2LVH A;  1RMD A;  2V87 A;  3MHS C;  2LJU A;  4DV3 E;  2B9D A;  2YPN A;  2L6M A;  4X64 E;  4F2J C;  1RQ0 A;  3BGH A;  2JYA A;  4LF8 E;  2N3G A;  2L3J A;  1JK1 A;  1T39 A;  2VRD A;  2VE7 C;  1A1G A;  4F9B B;  3DJW A;  4DR4 E;  2JY9 A;  4R2S A;  1X47 A;  4R2R A;  2ENC A;  4DUY E;  5A6A A;  2DLQ A;  1BBO A;  5LLQ A;  2ODR C;  3BID A;  5IXM B;  4B3S E;  3OTO E;  5LMN E;  2EPK X;  2N8X A;  2G7H A;  3HQ1 A;  4O5G A;  2EOY A;  2V89 A;  4RHB B;  4X8W A;  5A2Q C;  2L2K B;  2EM9 A;  2WCC 3;  4JV5 E;  5A6B A;  2ADR A;  5CFF E;  2GHF A;  2JP9 A;  2RTX A;  1AAY A;  3VYY A;  2FGG A;  2JR1 A;  2LJH A;  1IBL E;  2LCE A;  4B3R E;  2YRM A;  1WHQ A;  4NXN E;  2YTE A;  2EOO A;  1N3G A;  4BHC A;  4LFB E;  5TSE A;  1GZ6 A;  2ODR D;  2LT7 A;  3ADL A;  4L5N C;  4O24 A;  1STU A;  2D9H A;  5BR8 E;  3C6K A;  3H09 A;  2EPC A;  3J7A G;  2JWO A;  4P78 A;  4J8Z A;  1YYK A;  4O4K A;  4TUI A;  2LMZ A;  2V88 A;  4TUG A;  2V86 A;  3ADG A;  2HGH A;  1IQO A;  1Z1B A;  1UBD C;  4ZYH A;  2JXP A;  1N36 E;  2EMB A;  2MDR A;  2ZM6 E;  4LFA E;  2EJ4 A;  4DR7 E;  2V8Q B;  2EQ0 A;  2KHX A;  5IT9 C;  3QG5 C;  4DV6 E;  3J80 C;  4BCA A;  4DR6 E;  2IHR 1;  1SFE A;  5LMU E;  4DV2 E;  2EQ1 A;  2LBS B;  3VYX A;  4DV7 E;  2YTI A;  2DB2 A;  2DGC A;  3KWR A;  2EPR A;  3L00 A;  4O43 A;  1PJQ A;  2Q8U A;  2NAB A;  4DR5 E;  3ADJ A;  1EH8 A;  2L3C A;  5ADZ A;  1XNQ E;  2EN2 A;  3THO B;  1WXR A;  1F2I G;  5KL5 A;  1ZBQ A;  4JI1 E;  4KWY A;  4GKJ E;  2EL5 A;  1GQE A;  3BF2 A;  4F9C B;  2GLI A;  3EPJ A;  4WYQ B;  2EMG A;  4DV4 E;  4YHH E;  2K7I A;  2YTN A;  1P47 A;  2N3H A;  3IWB A;  4I8O A;  1IBK E;  2K4V A;  2LUP B;  2EMA A;  4GZN C;  2EN6 A;  2MC6 A;  2EN4 A;  3T1Y E;  4LF7 E;  5AE2 A;  5AAS A;  1UIL A;  1FKA E;  2LE2 A;  4MLQ A;  2EMF A;  3HTX A;  2YT4 A;  2DSY A;  1PKP A;  1EH7 A;  1YPN A;  2UXD E;  2EOM A;  2UUB E;  2EL4 A;  4R8O A;  2EOH A;  2RS7 A;  2R1F A;  2YSO A;  2EPX A;  2L33 A;  2ENA A;  1KJK A;  4DR1 E;  4BC9 A;  1IQS A;  4WX9 A;  5FLX C;  1BBG A;  3KZY A;  1J26 A;  2R76 A;  1TF6 A;  4X66 E;  1YUI A;  4F6M A;  2V85 A;  2YRK A;  1T4L B;  4ZYG A;  4IJD A;  2YTP A;  1X3C A;  2L8T A;  2LV2 A;  4Q28 A;  4DV1 E;  2B7T A;  2UXB E;  4F6N A;  2EMI A;  2EM5 A;  2E72 A;  4R2A A;  2EPN A;  4BMJ A;  1YYW A;  2JOB A;  1X6E A;  2YTD A;  4NHR A;  2YSP A;  4JI4 E;  1O0W A;  4R2E A;  4N4R B;  2L92 A;  2WZO A;  4DR2 E;  3EQ1 A;  4JI0 E;  2EM4 A;  4JI7 E;  4ZYD A;  4WSG A;  5KL4 A;  3AUZ A;  3TQM A;  5F3W A;  2L2N A;  3RMP A;  4RH8 A;  3C4B A;  1WHN A;  2LO3 A;  2MKD A;  4JYA E;  2EN1 A;  1G2F C;  1TF3 A;  2EMW A;  4LU9 A;  2L2M A;  1DI2 A;  4BHB A;  4JI5 E;  1MGT A;  2ELY A;  4BBY A;  3MSW A;  3BBG A;  1X5W A;  1XMQ E;  1IMU A;  2EML A;  3ADI A;  4LF4 E;  4KHP E;  5AE3 A;  1MEY C;  4FK5 C;  1YYO A;  2ENH A;  5KL6 A;  4BC7 A;  2LTR A;  2EOR A;  2DIX A;  1L4S A;  2EOQ A;  4JI3 E;  4WSP A;  4GKK E;  1HNZ E;  5DNY A;  2YTG A;  2YU5 A;  5IV8 B;  2YTQ A;  1N34 E;  4WXD A;  1NEI A;  2YZT A;  1YZ9 A;  2EM3 A;  3IWD A;  5A6K A;  4LFC E;  3K6Q A;  3HPZ A;  2EPL X;  1X6F A;  2RPC A;  2MDG A;  4JI6 E;  3ZOQ B;  1A1J A;  3P1X A;  1B69 A;  2EP3 A;  3J81 C;  3F6G A;  2YU8 A;  4R2C A;  2EL6 A;  2CT1 A;  2NUE A;  2LUQ A;  4DV5 E;  2J7J A;  2EOJ A;  3MHH C;  2CPN A;  1A1I A;  4ZYE A;  3THN A;  3KZZ A;  2F4V E;  4OX9 E;  2DMI A;  2WBS A;  1A1K A;  1N33 E;  2EN8 A;  2YTO A;  1UHZ A;  1ZR9 A;  4X65 E;  2EZ6 A;  3VHT B;  1IBM E;  1N32 E;  4GEQ B;  1ZAA C;  2VQE E;  1YUJ A;  5A69 A;  1HNX E;  1QU6 A;  2RS6 A;  5T6J A;  4R2P A;  4NXM E;  2DMY A;  4F54 A;  3JAM C;  2KOU A;  2EMY A;  4DUZ E;  2GPI A;  1YSA C;  1J5E E;  3M99 B;  1T4N A;  5AC5 A;  5KL3 A;  4HTG A;  2ELZ A;  4DKK A;  2EPU A;  3HXL A;  2YTJ A;  2FTX B;  2EOE A;  1ZU1 A;  2DRP A;  4OOG C;  2B3T B;  2V83 A;  2M9A A;  4K0K E;  2F8B A;  4R2Q A;  5A6J A;  1A1H A;  2EOZ A;  2EN7 A;  2M4I A;  2UUC E;  4X62 E;  1DGC A;  1YFH A;  1A1F A;  5A6B D;  4LF5 E;  1XMO E;  1WJP A;  1G2D C;  2EOS A;  5AE1 A;  3ECR A;  2NUG A;  4WFT A;  2EQ3 A;  2EMZ A;  1NCS A;  2I9I A;  2BBG A;  4MLV A;  2EM8 A;  2EN3 A;  3AV0 A;  2EE8 A;  4DV0 E;  2MC5 A;  2YRH A;  2EM6 A;  1HR0 E;  2B7V A;  2EOX A;  2EMH A;  2JVA A;  5KL7 A;  1JK2 A;  2EM2 A;  2HJJ A;  1AH5 A;  1HNW E;  2YWQ A;  4LTY A;  2FV4 B;  1PJS A;  2DLK A;  4JI8 E;  4DR3 E;  4NZV A;  2UUA E;  4JI2 E;  4M0V A;  4R2D A;  4AQY E;  1A1L A;  2E5L E;  2NA2 A;  2M1S A;  3C6M A;  2KON A;  5LL6 R;  1RC7 A;  1PJT A;  1I94 E;  3OML A;  2I13 A;  2NUF A;  1SR9 A;  2LRS A;  2EPO A;  2M7Q A;  1DQ3 A;  4LF6 E;  3J7Y p;  3UK3 C;  1ZBT A;  4DMI A;  2LTS A;  4L8N A;  1UN6 B;  1TN9 A;  2EMX A;  2VF1 A;  2VQF E;  2JPA A;  1EH6 A;  2EPM X;  3T1H E;  2EMK A;  2MKN A;  4F9A B;  2RSM A;  2EPZ A;  4Q35 B;  4BS9 A;  3IWC A;  4IS1 C;  3HPS A;  3LML A;  3JU0 A;  4LF9 E;  2A25 A;  2EOI A;  4B3M E;  3F6H A;  3EPK A;  5KL2 A;  3EPL A;  2EOF A;  2EMC A;  2EPA A;  1QNT A;  4WXC A;  1EKZ A;  4HEI A;  3JTZ A;  4B3T E;  4M9V C;  4M30 A;  2PRT A;  1XNR E;  2EM7 A;  3DF6 A;  2JOX A;  1X48 A;  2UXC E;  1WRJ A;  2EPP A;  3FIG A;  4KZS A;  5IWA E;  2E1M A;  2BB8 A;  4X9J A;  4R03 A;  4M2Z A;  2EM0 A;  1BB8 A;  2CTD A;  4YY3 E;  1GTK A;  4WPY A;  1T4O A;  4P7D A;  3LLH A;  2CSH A;  2UU9 E;  5AC4 A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  1G2F C;  1TF3 A;  1A1F A;  2EMW A;  2WBT A;  1LLM C;  2EQ1 A;  1WJP A;  2ELY A;  1G2D C;  2YTI A;  2WBU A;  3EPH A;  1X5W A;  2DGC A;  2EPR A;  2EOS A;  2NAB A;  2RSI A;  1X6H A;  2EML A;  2YTF A;  2LVH A;  1RMD A;  2EQ3 A;  2EN2 A;  2EMZ A;  1NCS A;  3MHS C;  2EM8 A;  2EN3 A;  1MEY C;  2EE8 A;  1DGC A;  1F2I G;  5KL5 A;  4FK5 C;  2YRH A;  2ENH A;  2EM6 A;  4F2J C;  2EOX A;  5KL6 A;  2EMH A;  2EL5 A;  5KL7 A;  1JK2 A;  2EM2 A;  2GLI A;  2EOR A;  1JK1 A;  3EPJ A;  2EOQ A;  2EMG A;  2VRD A;  1A1G A;  2DLK A;  2YTG A;  2YU5 A;  2YTN A;  2YTQ A;  1P47 A;  4R2D A;  4R2S A;  1A1L A;  4R2R A;  2EM3 A;  2EMA A;  4GZN C;  2ENC A;  2EN6 A;  2EN4 A;  1BBO A;  2DLQ A;  2I13 A;  1X6F A;  2RPC A;  2MDG A;  2EMF A;  1UN6 B;  3UK3 C;  1A1J A;  1B69 A;  2EMX A;  1TN9 A;  2EOM A;  2EP3 A;  2YU8 A;  4R2C A;  2EOY A;  2EL6 A;  2CT1 A;  2EL4 A;  2JPA A;  2EM9 A;  2EOH A;  2J7J A;  2WCC 3;  2EOJ A;  2R1F A;  2YSO A;  2ADR A;  2EMK A;  3MHH C;  2MKN A;  2EPX A;  2GHF A;  2ENA A;  2JP9 A;  1KJK A;  2EPZ A;  1A1I A;  1AAY A;  4IS1 C;  2LCE A;  2DMI A;  2A25 A;  2EOI A;  2WBS A;  2YRM A;  1A1K A;  1TF6 A;  2YTE A;  1YUI A;  2EN8 A;  2YTO A;  2EOO A;  4F6M A;  1ZR9 A;  2YRK A;  4IJD A;  2YTP A;  3EPK A;  1X3C A;  2LV2 A;  2LT7 A;  5KL2 A;  3VHT B;  4F6N A;  3EPL A;  1ZAA C;  2EOF A;  2EMC A;  2EPA A;  2EMI A;  2D9H A;  2EM5 A;  1YUJ A;  2E72 A;  4R2A A;  2EPC A;  4R2P A;  4M9V C;  2PRT A;  2EM7 A;  1X6E A;  2EMY A;  2YTD A;  1YSA C;  3M99 B;  5KL3 A;  2EPP A;  2ELZ A;  2YSP A;  2HGH A;  2EPU A;  2YTJ A;  1Z1B A;  1UBD C;  4R2E A;  2EOE A;  1ZU1 A;  2BB8 A;  2DRP A;  2EMB A;  4X9J A;  2M9A A;  2EJ4 A;  2EM0 A;  2EM4 A;  4R2Q A;  1BB8 A;  1A1H A;  2CTD A;  2EOZ A;  2EN7 A;  2EQ0 A;  4WSG A;  5KL4 A;  2CSH A;  2LO3 A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...