2LO3A

Solution structure of sgf73(59-102) zinc finger domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
NPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 73
publication title Insights into the role of SGF11 and SGF73 for the interaction between SAGA and nucleosomes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18508 zf_C2H2_13 Zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lo3A01
5KL2A 1UN6B 1A1JA 2EMCA 2PRTA 2EM2A 2EORA 2WBTA 5KL5A 4R2SA 3EPLA 1X5WA 2EM6A 4R2DA 4R2CA 1A1LA 1A1FA 2EMYA 2YU8A 2YSOA 2CSHA 1G2DC 1X3CA 4F2JC 2JPAA 2DLKA 4IS1C 2GLIA 2EL4A 2M9AA 2RSIA 2EL5A 1X6HA 3MHSC 2EOXA 4M9VC 2DLQA 2EMXA 2ENCA 1MEYC 2A25A 2WBSA 3EPKA 1BB8A 2EPXA 2YTIA 3UK3C 1BBOA 2EMFA 2E72A 2EQ0A 2EQ3A 1RMDA 2R1FA 2EE8A 1ZU1A 2EOSA 2MKDA 1YUJA 2EN7A 2LV2A 2EM5A 4F6NA 4R2QA 2NABA 2YTNA 1JK2A 1JK1A 1X6EA 2EOZA 3MHHC 2EM8A 4R2AA 1TF6A 2GHFA 2BB8A 2EM9A 2CT1A 2YTQA 2EOQA 2JP9A 2EMKA 2YTPA 2EOYA 5KL6A 2EM3A 1A1IA 2ADRA 2EPRA 2J7JA 4GZNC 2RPCA 2HGHA 1AAYA 2EN2A 2DGCA 4FK5C 2EPCA 2ENHA 2LVHA 2EOFA 1DGCA 2EOJA 2YTFA 2EMLA 1TN9A 1ZR9A 2EOHA 5KL4A 2EMAA 2EM4A 4IJDA 1Z1BA 1ZAAC 2EPUA 2EPZA 3VHTB 1KJKA 2EMGA 1WJPA 2YTOA 2YRKA 2EM7A 1YSAC 4R2RA 2EOMA 2EOEA 2YTGA 3EPJA 2WCC3 2EPPA 2DRPA 1LLMC 2YSPA 1TF3A 2EOIA 2EN3A 2WBUA 1A1HA 2EL6A 2YU5A 2ELZA 1UBDC 2D9HA 2EMWA 2LCEA 2YRHA 4X9JA 4F6MA 1F2IG 1X6FA 2CTDA 2VRDA 2YTDA 5KL7A 2LT7A 2MKNA 2EMHA 2EMZA 1G2FC 2ELYA 4R2PA 2I13A 1P47A 2YRMA 1B69A 2EM0A 2EN6A 2EPAA 2LO3A 3EPHA 2EN1A 2MDGA 2EN8A 2EOOA 4WSGA 2EMIA 2EMBA 2EQ1A 2EP3A 2EJ4A 2YTJA 2EN4A 4R2EA 5KL3A 2YTEA 2ENAA 2DMIA 3M99B 1A1KA 1NCSA 1YUIA 1A1GA
chains in the Genus database with same CATH superfamily
4KHPE 2EMCA 4OOGC 1O0WA 2DIXA 3JU0A 5KL5A 1X5WA 1A1LA 4X65E 4LU9A 3ADGA 4JV5E 4ZYDA 1T4LB 4JI4E 2VQFE 3MSWA 2EOXA 3VK6A 3THNA 4GEQB 5AE3A 2DLQA 1IBME 3AUZA 2EMXA 2YZTA 1MEYC 2A25A 2L33A 5A6BA 4BHCA 1XNRE 2NUFA 1PJQA 3UK3C 4LTYA 2VE7C 1IBLE 2E72A 2R1FA 1ZU1A 2FGGA 4X8WA 1RC7A 2LV2A 3LLHA 4YHHE 4NXME 5IXMB 3ADJA 2FTXB 2EOZA 1JK1A 2DMYA 2JY9A 4R2AA 1TF6A 2EM9A 2ODRC 3ADIA 2JP9A 2EMKA 4X66E 2EOYA 4X64E 1T38A 2EPRA 1AAYA 1KYQA 2EN2A 2B9DA 2LVHA 3LMLA 5TSEA 2JR1A 4F9BB 2LMZA 4K0KE 4B3SE 5A6AA 5IV8B 4WFTA 2BBGA 4GKKE 1N32E 2L2KB 4JI6E 2L3CA 4LF8E 3ZOQB 2LTRA 1IQSA 1WJPA 4DR2E 1YYWA 5A2QC 3KWRA 2YTGA 4X62E 2F4VE 2EWLA 4L8NA 2N3HA 2EOIA 1TF3A 2EN3A 2WBUA 4KWYA 2UUCE 4DR3E 3ADLA 4DR4E 4F9AB 3FIGA 2YRHA 4F54A 1X6FA 2YT4A 4JI8E 2JOBA 2YTDA 5KL7A 3DF6A 3KZZA 4JYAE 1G2FC 1P47A 2YRMA 1B69A 2EM0A 1IMUA 2FV4B 2MDGA 4M2ZA 1ZBTA 4O5GA 4DR5E 4WSGA 2EMIA 5LMNE 2EMBA 4M30A 4DMIA 4TUIA 2EP3A 2KHXA 2EJ4A 2V8QB 4DR6E 2LBSB 3M99B 2NUEA 1A1GA 1UN6B 3TQMA 4OX9E 2V87A 3RMPA 3T1YE 1SR9A 4DV0E 5AC4A 2EORA 3VYXA 4O43A 1SFEA 5FLXC 3EPLA 1FJGE 4KZSA 4ZYHA 2EM6A 2NA2A 1XMOE 1IBKE 5ADZA 2DSYA 2YU8A 2CSHA 1G2DC 4ZYEA 3F6GA 2DLKA 4BS9A 4IS1C 2RTXA 4I8OA 2EL4A 2M9AA 3MHSC 1PKPA 4ZYGA 4DV4E 2JXPA 4DV1E 2ENCA 2G7HA 1BB8A 2EPXA 1T4OA 2EMFA 5BR8E 1STUA 2EQ3A 1RMDA 4BMJA 2EOSA 2MKDA 4P78A 4WSPA 1N36E 4DUYE 2LUPB 3C6MA 4R2QA 2NABA 4BCAA 2VQEE 1X6EA 3MHHC 2DB2A 3HTXA 1UILA 2GHFA 2BB8A 2UU9E 4WPYA 2CPNA 2LRSA 5KL6A 2HGHA 1A1IA 2J7JA 2DGCA 1WRJA 3AV0A 4JI3E 2N8XA 4JI5E 2YTFA 4HTGA 3C6KA 4YY3E 2L6MA 2EMAA 2M4IA 1DQ3A 2JWOA 2HJJA 2EPZA 2EMGA 2YRKA 2EM7A 1YSAC 4R2RA 1GQEA 2GPIA 2WCC3 3K6QA 2DRPA 3J80C 2EPLX 1LLMC 1J5EE 3IWBA 2L2NA 2HC5A 4M0VA 1AH5A 2EL6A 2MC6A 3BGHA 2L2MA 1UBDC 2KONA 2ZM6E 2D9HA 4F6MA 2V86A 1I94E 1YZ9A 2RSMA 2EMZA 4N4RB 2ELYA 1X47A 5A6JA 4DR7E 3BIDA 4DV6E 1XMQE 1T4NA 3THOB 3VYYA 2M7QA 4LFBE 2EN4A 5KL3A 1PDAA 2DMIA 2MC5A 1A1KA 1YYOA 1NCSA 1FKAE 4R8OA 1YUIA 1NEIA 5KL2A 3H09A 5IWAE 1A1JA 2E5LE 1PJSA 4NXNE 5AE1A 2WZOA 1EKZA 4R2CA 5A6KA 4O4KA 4DV5E 2B7TA 1X3CA 4F2JC 2JPAA 1EH7A 2GLIA 5AC5A 2UXDE 4LFCE 2EL5A 4TUGA 2EPMX 2LUQA 4NHRA 4F9CB 4AQYE 4BHBA 5F3WA 2EPOA 3J7AG 1QU6A 4MLQA 4BC9A 2YTIA 2IHR1 2V83A 2M1SA 2EQ0A 4WX9A 2EE8A 4LF7E 3T1HE 1YUJA 2EN7A 4LFAE 4BC7A 1WHQA 2EZ6A 3C4TA 2EM5A 4LF5E 1JK2A 2UXCE 4GKJE 2K4VA 2L3JA 2EM8A 4RH8A 2KOUA 1WXRA 4J8ZA 3HPSA 2EOQA 5AE2A 4DKKA 2ADRA 5IT9C 4GZNC 2RPCA 4HEIA 4JI2E 2EOFA 2V88A 2UUBE 2EMLA 2LTSA 3HXLA 1ZR9A 4BBYA 2I9IA 1DI2A 2RS6A 2B7VA 3QG5C 3C4BA 3HPZA 1Z1BA 1L4SA 1T39A 1KJKA 4LF4E 4NZVA 2V89A 2YTOA 1HNZE 3L00A 3OTOE 2EOMA 2EOEA 2VF1A 2EPPA 2YPNA 3IWDA 3BBGA 2ODRD 4R03A 2H36X 1IQOA 5T6JA 3JTZA 1YPNA 2V85A 2ELZA 3ECRA 3EQ1A 2EMWA 4DV2E 1N33E 2LCEA 4X9JA 1J26A 2VRDA 2LT7A 1HNWE 2I13A 2E1MA 3EPHA 1WHNA 2EN6A 2EN1A 5A69A 4B3ME 4WXDA 2EN8A 1QNTA 2L8TA 2EOOA 2EPNA 4P7DA 2LJUA 5A6BD 2YTJA 2YTEA 2ENAA 1N34E 5LL6R 4L5NC 2JVAA 2PRTA 4LF6E 2EM2A 2WBTA 1EH8A 4R2SA 1XNQE 2JYAA 4R2DA 5DNYA 3P1XA 5AASA 2B3TB 4JI1E 1A1FA 2HHHE 1PJTA 2EMYA 2YSOA 2RSIA 1X6HA 4M9VC 3JAMC 2LE2A 2WBSA 3EPKA 2RQLA 1BBOA 1BBGA 5LMUE 4DUZE 3BF2A 3KZYA 1X49A 2MDRA 3F6HA 2F8BA 2NUGA 4DR1E 4B3TE 4F6NA 4B3RE 2UXBE 2YTNA 5LLQA 3J81C 4LF9E 4JI7E 1HR0E 4WXCA 2CT1A 2YTQA 1N3GA 2YTPA 2EM3A 3HQ1A 2R76A 2JOXA 2EPKX 4FK5C 2EPCA 2ENHA 3OMLA 2EOJA 1DGCA 1TN9A 2EOHA 5KL4A 2EM4A 4Q28A 4IJDA 1ZAAC 5CFFE 2EPUA 3VHTB 4RHBB 4MLVA 1ZBQA 3EPJA 1RQ0A 3DJWA 4JI0E 2YSPA 1HNXE 2L92A 3J7Yp 4Q35B 2UUAE 4DV3E 1A1HA 2YU5A 1YYKA 2YWQA 1GTKA 1EH6A 1F2IG 1GZ6A 2N3GA 2CTDA 2RS7A 2LJHA 2MKNA 2EMHA 4R2PA 1UHZA 2K7IA 4WYQB 1MGTA 2EPAA 2LO3A 2Q8UA 1YFHA 3IWCA 1X48A 4O24A 2EQ1A 4R2EA 4DV7E
chains in the Genus database with same CATH topology
5KL2A 1UN6B 1A1JA 2EMCA 2PRTA 2EM2A 2EORA 2WBTA 5KL5A 4R2SA 3EPLA 1X5WA 2EM6A 4R2DA 4R2CA 1A1LA 1A1FA 2EMYA 2YU8A 2YSOA 2CSHA 1G2DC 1X3CA 4F2JC 2JPAA 2DLKA 4IS1C 2GLIA 2EL4A 2M9AA 2RSIA 2EL5A 1X6HA 3MHSC 2EOXA 4M9VC 2DLQA 2EMXA 2ENCA 1MEYC 2A25A 2WBSA 3EPKA 1BB8A 2EPXA 2YTIA 3UK3C 1BBOA 2EMFA 2E72A 2EQ0A 2EQ3A 1RMDA 2R1FA 2EE8A 1ZU1A 2EOSA 2MKDA 1YUJA 2EN7A 2LV2A 2EM5A 4F6NA 4R2QA 2NABA 2YTNA 1JK2A 1JK1A 1X6EA 2EOZA 3MHHC 2EM8A 4R2AA 1TF6A 2GHFA 2BB8A 2EM9A 2CT1A 2YTQA 2EOQA 2JP9A 2EMKA 2YTPA 2EOYA 5KL6A 2EM3A 1A1IA 2ADRA 2EPRA 2J7JA 4GZNC 2RPCA 2HGHA 1AAYA 2EN2A 2DGCA 4FK5C 2EPCA 2ENHA 2LVHA 2EOFA 1DGCA 2EOJA 2YTFA 2EMLA 1TN9A 1ZR9A 2EOHA 5KL4A 2EMAA 2EM4A 4IJDA 1Z1BA 1ZAAC 2EPUA 2EPZA 3VHTB 1KJKA 2EMGA 1WJPA 2YTOA 2YRKA 2EM7A 1YSAC 4R2RA 2EOMA 2EOEA 2YTGA 3EPJA 2WCC3 2EPPA 2DRPA 1LLMC 2YSPA 1TF3A 2EOIA 2EN3A 2WBUA 1A1HA 2EL6A 2YU5A 2ELZA 1UBDC 2D9HA 2EMWA 2LCEA 2YRHA 4X9JA 4F6MA 1F2IG 1X6FA 2CTDA 2VRDA 2YTDA 5KL7A 2LT7A 2MKNA 2EMHA 2EMZA 1G2FC 2ELYA 4R2PA 2I13A 1P47A 2YRMA 1B69A 2EM0A 2EN6A 2EPAA 2LO3A 3EPHA 2EN1A 2MDGA 2EN8A 2EOOA 4WSGA 2EMIA 2EMBA 2EQ1A 2EP3A 2EJ4A 2YTJA 2EN4A 4R2EA 5KL3A 2YTEA 2ENAA 2DMIA 3M99B 1A1KA 1NCSA 1YUIA 1A1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL2 A;  1UN6 B;  1A1J A;  2EMC A;  2PRT A;  2EM2 A;  2EOR A;  2WBT A;  5KL5 A;  4R2S A;  3EPL A;  1X5W A;  2EM6 A;  4R2D A;  4R2C A;  1A1L A;  1A1F A;  2EMY A;  2YU8 A;  2YSO A;  2CSH A;  1G2D C;  1X3C A;  4F2J C;  2JPA A;  2DLK A;  4IS1 C;  2GLI A;  2EL4 A;  2M9A A;  2RSI A;  2EL5 A;  1X6H A;  3MHS C;  2EOX A;  4M9V C;  2DLQ A;  2EMX A;  2ENC A;  1MEY C;  2A25 A;  2WBS A;  3EPK A;  1BB8 A;  2EPX A;  2YTI A;  3UK3 C;  1BBO A;  2EMF A;  2E72 A;  2EQ0 A;  2EQ3 A;  1RMD A;  2R1F A;  2EE8 A;  1ZU1 A;  2EOS A;  2MKD A;  1YUJ A;  2EN7 A;  2LV2 A;  2EM5 A;  4F6N A;  4R2Q A;  2NAB A;  2YTN A;  1JK2 A;  1JK1 A;  1X6E A;  2EOZ A;  3MHH C;  2EM8 A;  4R2A A;  1TF6 A;  2GHF A;  2BB8 A;  2EM9 A;  2CT1 A;  2YTQ A;  2EOQ A;  2JP9 A;  2EMK A;  2YTP A;  2EOY A;  5KL6 A;  2EM3 A;  1A1I A;  2ADR A;  2EPR A;  2J7J A;  4GZN C;  2RPC A;  2HGH A;  1AAY A;  2EN2 A;  2DGC A;  4FK5 C;  2EPC A;  2ENH A;  2LVH A;  2EOF A;  1DGC A;  2EOJ A;  2YTF A;  2EML A;  1TN9 A;  1ZR9 A;  2EOH A;  5KL4 A;  2EMA A;  2EM4 A;  4IJD A;  1Z1B A;  1ZAA C;  2EPU A;  2EPZ A;  3VHT B;  1KJK A;  2EMG A;  1WJP A;  2YTO A;  2YRK A;  2EM7 A;  1YSA C;  4R2R A;  2EOM A;  2EOE A;  2YTG A;  3EPJ A;  2WCC 3;  2EPP A;  2DRP A;  1LLM C;  2YSP A;  1TF3 A;  2EOI A;  2EN3 A;  2WBU A;  1A1H A;  2EL6 A;  2YU5 A;  2ELZ A;  1UBD C;  2D9H A;  2EMW A;  2LCE A;  2YRH A;  4X9J A;  4F6M A;  1F2I G;  1X6F A;  2CTD A;  2VRD A;  2YTD A;  5KL7 A;  2LT7 A;  2MKN A;  2EMH A;  2EMZ A;  1G2F C;  2ELY A;  4R2P A;  2I13 A;  1P47 A;  2YRM A;  1B69 A;  2EM0 A;  2EN6 A;  2EPA A;  2LO3 A;  3EPH A;  2EN1 A;  2MDG A;  2EN8 A;  2EOO A;  4WSG A;  2EMI A;  2EMB A;  2EQ1 A;  2EP3 A;  2EJ4 A;  2YTJ A;  2EN4 A;  4R2E A;  5KL3 A;  2YTE A;  2ENA A;  2DMI A;  3M99 B;  1A1K A;  1NCS A;  1YUI A;  1A1G A; 
#chains in the Genus database with same CATH topology
 4KHP E;  2EMC A;  4OOG C;  1O0W A;  2DIX A;  3JU0 A;  5KL5 A;  1X5W A;  1A1L A;  4X65 E;  4LU9 A;  3ADG A;  4JV5 E;  4ZYD A;  1T4L B;  4JI4 E;  2VQF E;  3MSW A;  2EOX A;  3VK6 A;  3THN A;  4GEQ B;  5AE3 A;  2DLQ A;  1IBM E;  3AUZ A;  2EMX A;  2YZT A;  1MEY C;  2A25 A;  2L33 A;  5A6B A;  4BHC A;  1XNR E;  2NUF A;  1PJQ A;  3UK3 C;  4LTY A;  2VE7 C;  1IBL E;  2E72 A;  2R1F A;  1ZU1 A;  2FGG A;  4X8W A;  1RC7 A;  2LV2 A;  3LLH A;  4YHH E;  4NXM E;  5IXM B;  3ADJ A;  2FTX B;  2EOZ A;  1JK1 A;  2DMY A;  2JY9 A;  4R2A A;  1TF6 A;  2EM9 A;  2ODR C;  3ADI A;  2JP9 A;  2EMK A;  4X66 E;  2EOY A;  4X64 E;  1T38 A;  2EPR A;  1AAY A;  1KYQ A;  2EN2 A;  2B9D A;  2LVH A;  3LML A;  5TSE A;  2JR1 A;  4F9B B;  2LMZ A;  4K0K E;  4B3S E;  5A6A A;  5IV8 B;  4WFT A;  2BBG A;  4GKK E;  1N32 E;  2L2K B;  4JI6 E;  2L3C A;  4LF8 E;  3ZOQ B;  2LTR A;  1IQS A;  1WJP A;  4DR2 E;  1YYW A;  5A2Q C;  3KWR A;  2YTG A;  4X62 E;  2F4V E;  2EWL A;  4L8N A;  2N3H A;  2EOI A;  1TF3 A;  2EN3 A;  2WBU A;  4KWY A;  2UUC E;  4DR3 E;  3ADL A;  4DR4 E;  4F9A B;  3FIG A;  2YRH A;  4F54 A;  1X6F A;  2YT4 A;  4JI8 E;  2JOB A;  2YTD A;  5KL7 A;  3DF6 A;  3KZZ A;  4JYA E;  1G2F C;  1P47 A;  2YRM A;  1B69 A;  2EM0 A;  1IMU A;  2FV4 B;  2MDG A;  4M2Z A;  1ZBT A;  4O5G A;  4DR5 E;  4WSG A;  2EMI A;  5LMN E;  2EMB A;  4M30 A;  4DMI A;  4TUI A;  2EP3 A;  2KHX A;  2EJ4 A;  2V8Q B;  4DR6 E;  2LBS B;  3M99 B;  2NUE A;  1A1G A;  1UN6 B;  3TQM A;  4OX9 E;  2V87 A;  3RMP A;  3T1Y E;  1SR9 A;  4DV0 E;  5AC4 A;  2EOR A;  3VYX A;  4O43 A;  1SFE A;  5FLX C;  3EPL A;  1FJG E;  4KZS A;  4ZYH A;  2EM6 A;  2NA2 A;  1XMO E;  1IBK E;  5ADZ A;  2DSY A;  2YU8 A;  2CSH A;  1G2D C;  4ZYE A;  3F6G A;  2DLK A;  4BS9 A;  4IS1 C;  2RTX A;  4I8O A;  2EL4 A;  2M9A A;  3MHS C;  1PKP A;  4ZYG A;  4DV4 E;  2JXP A;  4DV1 E;  2ENC A;  2G7H A;  1BB8 A;  2EPX A;  1T4O A;  2EMF A;  5BR8 E;  1STU A;  2EQ3 A;  1RMD A;  4BMJ A;  2EOS A;  2MKD A;  4P78 A;  4WSP A;  1N36 E;  4DUY E;  2LUP B;  3C6M A;  4R2Q A;  2NAB A;  4BCA A;  2VQE E;  1X6E A;  3MHH C;  2DB2 A;  3HTX A;  1UIL A;  2GHF A;  2BB8 A;  2UU9 E;  4WPY A;  2CPN A;  2LRS A;  5KL6 A;  2HGH A;  1A1I A;  2J7J A;  2DGC A;  1WRJ A;  3AV0 A;  4JI3 E;  2N8X A;  4JI5 E;  2YTF A;  4HTG A;  3C6K A;  4YY3 E;  2L6M A;  2EMA A;  2M4I A;  1DQ3 A;  2JWO A;  2HJJ A;  2EPZ A;  2EMG A;  2YRK A;  2EM7 A;  1YSA C;  4R2R A;  1GQE A;  2GPI A;  2WCC 3;  3K6Q A;  2DRP A;  3J80 C;  2EPL X;  1LLM C;  1J5E E;  3IWB A;  2L2N A;  2HC5 A;  4M0V A;  1AH5 A;  2EL6 A;  2MC6 A;  3BGH A;  2L2M A;  1UBD C;  2KON A;  2ZM6 E;  2D9H A;  4F6M A;  2V86 A;  1I94 E;  1YZ9 A;  2RSM A;  2EMZ A;  4N4R B;  2ELY A;  1X47 A;  5A6J A;  4DR7 E;  3BID A;  4DV6 E;  1XMQ E;  1T4N A;  3THO B;  3VYY A;  2M7Q A;  4LFB E;  2EN4 A;  5KL3 A;  1PDA A;  2DMI A;  2MC5 A;  1A1K A;  1YYO A;  1NCS A;  1FKA E;  4R8O A;  1YUI A;  1NEI A;  5KL2 A;  3H09 A;  5IWA E;  1A1J A;  2E5L E;  1PJS A;  4NXN E;  5AE1 A;  2WZO A;  1EKZ A;  4R2C A;  5A6K A;  4O4K A;  4DV5 E;  2B7T A;  1X3C A;  4F2J C;  2JPA A;  1EH7 A;  2GLI A;  5AC5 A;  2UXD E;  4LFC E;  2EL5 A;  4TUG A;  2EPM X;  2LUQ A;  4NHR A;  4F9C B;  4AQY E;  4BHB A;  5F3W A;  2EPO A;  3J7A G;  1QU6 A;  4MLQ A;  4BC9 A;  2YTI A;  2IHR 1;  2V83 A;  2M1S A;  2EQ0 A;  4WX9 A;  2EE8 A;  4LF7 E;  3T1H E;  1YUJ A;  2EN7 A;  4LFA E;  4BC7 A;  1WHQ A;  2EZ6 A;  3C4T A;  2EM5 A;  4LF5 E;  1JK2 A;  2UXC E;  4GKJ E;  2K4V A;  2L3J A;  2EM8 A;  4RH8 A;  2KOU A;  1WXR A;  4J8Z A;  3HPS A;  2EOQ A;  5AE2 A;  4DKK A;  2ADR A;  5IT9 C;  4GZN C;  2RPC A;  4HEI A;  4JI2 E;  2EOF A;  2V88 A;  2UUB E;  2EML A;  2LTS A;  3HXL A;  1ZR9 A;  4BBY A;  2I9I A;  1DI2 A;  2RS6 A;  2B7V A;  3QG5 C;  3C4B A;  3HPZ A;  1Z1B A;  1L4S A;  1T39 A;  1KJK A;  4LF4 E;  4NZV A;  2V89 A;  2YTO A;  1HNZ E;  3L00 A;  3OTO E;  2EOM A;  2EOE A;  2VF1 A;  2EPP A;  2YPN A;  3IWD A;  3BBG A;  2ODR D;  4R03 A;  2H36 X;  1IQO A;  5T6J A;  3JTZ A;  1YPN A;  2V85 A;  2ELZ A;  3ECR A;  3EQ1 A;  2EMW A;  4DV2 E;  1N33 E;  2LCE A;  4X9J A;  1J26 A;  2VRD A;  2LT7 A;  1HNW E;  2I13 A;  2E1M A;  3EPH A;  1WHN A;  2EN6 A;  2EN1 A;  5A69 A;  4B3M E;  4WXD A;  2EN8 A;  1QNT A;  2L8T A;  2EOO A;  2EPN A;  4P7D A;  2LJU A;  5A6B D;  2YTJ A;  2YTE A;  2ENA A;  1N34 E;  5LL6 R;  4L5N C;  2JVA A;  2PRT A;  4LF6 E;  2EM2 A;  2WBT A;  1EH8 A;  4R2S A;  1XNQ E;  2JYA A;  4R2D A;  5DNY A;  3P1X A;  5AAS A;  2B3T B;  4JI1 E;  1A1F A;  2HHH E;  1PJT A;  2EMY A;  2YSO A;  2RSI A;  1X6H A;  4M9V C;  3JAM C;  2LE2 A;  2WBS A;  3EPK A;  2RQL A;  1BBO A;  1BBG A;  5LMU E;  4DUZ E;  3BF2 A;  3KZY A;  1X49 A;  2MDR A;  3F6H A;  2F8B A;  2NUG A;  4DR1 E;  4B3T E;  4F6N A;  4B3R E;  2UXB E;  2YTN A;  5LLQ A;  3J81 C;  4LF9 E;  4JI7 E;  1HR0 E;  4WXC A;  2CT1 A;  2YTQ A;  1N3G A;  2YTP A;  2EM3 A;  3HQ1 A;  2R76 A;  2JOX A;  2EPK X;  4FK5 C;  2EPC A;  2ENH A;  3OML A;  2EOJ A;  1DGC A;  1TN9 A;  2EOH A;  5KL4 A;  2EM4 A;  4Q28 A;  4IJD A;  1ZAA C;  5CFF E;  2EPU A;  3VHT B;  4RHB B;  4MLV A;  1ZBQ A;  3EPJ A;  1RQ0 A;  3DJW A;  4JI0 E;  2YSP A;  1HNX E;  2L92 A;  3J7Y p;  4Q35 B;  2UUA E;  4DV3 E;  1A1H A;  2YU5 A;  1YYK A;  2YWQ A;  1GTK A;  1EH6 A;  1F2I G;  1GZ6 A;  2N3G A;  2CTD A;  2RS7 A;  2LJH A;  2MKN A;  2EMH A;  4R2P A;  1UHZ A;  2K7I A;  4WYQ B;  1MGT A;  2EPA A;  2LO3 A;  2Q8U A;  1YFH A;  3IWC A;  1X48 A;  4O24 A;  2EQ1 A;  4R2E A;  4DV7 E; 
#chains in the Genus database with same CATH homology
 5KL2 A;  1UN6 B;  1A1J A;  2EMC A;  2PRT A;  2EM2 A;  2EOR A;  2WBT A;  5KL5 A;  4R2S A;  3EPL A;  1X5W A;  2EM6 A;  4R2D A;  4R2C A;  1A1L A;  1A1F A;  2EMY A;  2YU8 A;  2YSO A;  2CSH A;  1G2D C;  1X3C A;  4F2J C;  2JPA A;  2DLK A;  4IS1 C;  2GLI A;  2EL4 A;  2M9A A;  2RSI A;  2EL5 A;  1X6H A;  3MHS C;  2EOX A;  4M9V C;  2DLQ A;  2EMX A;  2ENC A;  1MEY C;  2A25 A;  2WBS A;  3EPK A;  1BB8 A;  2EPX A;  2YTI A;  3UK3 C;  1BBO A;  2EMF A;  2E72 A;  2EQ0 A;  2EQ3 A;  1RMD A;  2R1F A;  2EE8 A;  1ZU1 A;  2EOS A;  2MKD A;  1YUJ A;  2EN7 A;  2LV2 A;  2EM5 A;  4F6N A;  4R2Q A;  2NAB A;  2YTN A;  1JK2 A;  1JK1 A;  1X6E A;  2EOZ A;  3MHH C;  2EM8 A;  4R2A A;  1TF6 A;  2GHF A;  2BB8 A;  2EM9 A;  2CT1 A;  2YTQ A;  2EOQ A;  2JP9 A;  2EMK A;  2YTP A;  2EOY A;  5KL6 A;  2EM3 A;  1A1I A;  2ADR A;  2EPR A;  2J7J A;  4GZN C;  2RPC A;  2HGH A;  1AAY A;  2EN2 A;  2DGC A;  4FK5 C;  2EPC A;  2ENH A;  2LVH A;  2EOF A;  1DGC A;  2EOJ A;  2YTF A;  2EML A;  1TN9 A;  1ZR9 A;  2EOH A;  5KL4 A;  2EMA A;  2EM4 A;  4IJD A;  1Z1B A;  1ZAA C;  2EPU A;  2EPZ A;  3VHT B;  1KJK A;  2EMG A;  1WJP A;  2YTO A;  2YRK A;  2EM7 A;  1YSA C;  4R2R A;  2EOM A;  2EOE A;  2YTG A;  3EPJ A;  2WCC 3;  2EPP A;  2DRP A;  1LLM C;  2YSP A;  1TF3 A;  2EOI A;  2EN3 A;  2WBU A;  1A1H A;  2EL6 A;  2YU5 A;  2ELZ A;  1UBD C;  2D9H A;  2EMW A;  2LCE A;  2YRH A;  4X9J A;  4F6M A;  1F2I G;  1X6F A;  2CTD A;  2VRD A;  2YTD A;  5KL7 A;  2LT7 A;  2MKN A;  2EMH A;  2EMZ A;  1G2F C;  2ELY A;  4R2P A;  2I13 A;  1P47 A;  2YRM A;  1B69 A;  2EM0 A;  2EN6 A;  2EPA A;  2LO3 A;  3EPH A;  2EN1 A;  2MDG A;  2EN8 A;  2EOO A;  4WSG A;  2EMI A;  2EMB A;  2EQ1 A;  2EP3 A;  2EJ4 A;  2YTJ A;  2EN4 A;  4R2E A;  5KL3 A;  2YTE A;  2ENA A;  2DMI A;  3M99 B;  1A1K A;  1NCS A;  1YUI A;  1A1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...