2LOQA

Backbone structure of human membrane protein fam14b (interferon alpha-inducible protein 27-like protein 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
molecule keywords Interferon alpha-inducible protein 27-like protein 1
molecule tags Membrane protein
source organism Homo sapiens
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06140 Ifi-6-16 Interferon-induced 6-16 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.160 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2loqA01
2LOQA
chains in the Genus database with same CATH superfamily
4HGKA 4M70B 5GINA 2XMOA 4PO0A 1GNIA 4TQ0A 4ZCGA 3JRYA 4K71A 1HK5A 3A75A 4ZC6A 2VDBA 2Z8KA 2V36A 2BXDA 5IJEA 2I30A 1HK4A 2XSIA 3H37A 2DBWA 4GDXA 4HGMB 3UIVA 4W4UB 4MBEC 4GG2A 4J2VA 2BXHA 2I2ZA 2LXTA 2EFHA 2VUFA 4G03A 4IW2A 2BXIA 4JK4A 4Z9OA 3JQZA 4WA6B 3V09A 4FK5B 1TXUA 4G01A 5ID9A 4GDKB 2KBZA 2LQHA 2NQOA 3GQXA 4ZBQA 4DHXB 3SIUB 1GNJA 5DBYA 1MUSA 2Z8IA 1BM0A 5GHKA 3NVIA 2ROHA 4BY9C 4TQ1A 4F5UA 2CKXA 2DYOA 2XVUA 1N5UA 4LB2A 3VQIA 2QMCA 3KIKA 3W1SA 3GA9L 1VZSA 2DBXA 1UORA 1MIYA 4L9QA 3FWBC 3PLAA 2K0NA 2GUTA 3LU6A 5IIUA 5IIHA 1E78A 3WHQA 2BXGA 2EFDA 4NAWB 4E99A 4F5SA 3SIVB 2XVVA 1LOTA 2LOQA 2YDFA 4Z69A 2KWFA 3TDLA 1HK1A 4F5VA 4FJCB 5BPKA 4C31B 4IW1A 3NMUA 5DQFA 1KXPD 2JUHA 5IJ5A 1BJ5A 1E7IA 1KW2A 4G04A 2OZBB 1MIVA 2VUEA 5ID7A 2Z8JA 1E7BA 1HK2A 2E0YA 2BXQA 3B9MA 4L8UA 4OTUA 3GQUA 5HOZA 4F5TA 3WHRA 2QHBA 1E7CA 1TF0A 4N3ZA 2OT3A 4LUFA 4N0FD 3V03A 4ZBKA 1H9ZA 2XVWA 2BXEA 5B5TA 3ECPA 3FNMA 3NVMA 5FUOA 3H3AA 3NVKA 2EFEA 1E7GA 3A73A 1NT2B 4I9OA 4DM0A 3BPJA 4N0UD 3LU7A 4ZBRA 2E0XA 4D7XA 3LU8A 4GDLB 5D7GA 5GIOA 3FWCC 2EFCA 2AJEA 1MIWA 2BXPA 4S1YA 4ZUXV 1HK3A 1MA9A 3KJLA 1IJGA 2BXLA 4OTTA 1HA2A 5IFOA 4LA0A 1J7EA 2NNWA 2XW1A 1J78A 3MHSB 1FOUA 2BXOA 2LQIA 2BXMA 2XW0A 4BKEA 5GIPA 2BXAA 2DBUA 4LB9A 4OT2A 2BXKA 4L9KA 2BX8A 2LXSA 4FIPB 1BKEA 3M99C 1E7EA 3WHSA 1E7FA 1JNBA 1LNSA 2BXFA 2QM6A 3CX9A 1MUHA 5IJFA 2DYMA 3SQJA 1H5WA 2XVQA 1MM8A 4EMXA 5IIXA 2AGHB 2BXBA 1O9XA 4OR0A 1E7HA 3B9LA 1SB0A 4LUHA 1KDXA 1AO6A 3ICXA 2BXCA 4K2CA 1E7AA 3MHHB 3V08A 2BXNA 3G9KD 1VFIA 2DG5A
chains in the Genus database with same CATH topology
4HGKA 4M70B 5GINA 2XMOA 4PO0A 1GNIA 4TQ0A 4ZCGA 3JRYA 4K71A 1HK5A 3A75A 4ZC6A 2VDBA 2Z8KA 2V36A 2BXDA 5IJEA 2I30A 1HK4A 2XSIA 3H37A 2DBWA 4GDXA 4HGMB 3UIVA 4W4UB 4MBEC 4GG2A 4J2VA 2BXHA 2I2ZA 4G03A 2EFHA 2VUFA 4JK4A 4IW2A 2BXIA 4Z9OA 3V09A 3JQZA 4WA6B 4FK5B 1TXUA 4G01A 5ID9A 4GDKB 2KBZA 2NQOA 3GQXA 4ZBQA 4DHXB 3SIUB 1GNJA 5DBYA 2Z8IA 1BM0A 5GHKA 3NVIA 2ROHA 4BY9C 4TQ1A 4F5UA 2CKXA 2DYOA 2XVUA 1N5UA 4LB2A 3VQIA 2QMCA 3KIKA 3W1SA 3GA9L 1VZSA 2DBXA 1UORA 1MIYA 4L9QA 3FWBC 3PLAA 3LU6A 5IIUA 5IIHA 1E78A 3WHQA 2BXGA 2EFDA 4NAWB 4E99A 4F5SA 3SIVB 2XVVA 1LOTA 2LOQA 2YDFA 4Z69A 3TDLA 4F5VA 1HK1A 4FJCB 5BPKA 4C31B 4IW1A 3NMUA 5DQFA 1KXPD 2JUHA 5IJ5A 1BJ5A 1E7IA 1KW2A 4G04A 2OZBB 1MIVA 2VUEA 5ID7A 2Z8JA 1E7BA 1HK2A 2E0YA 2BXQA 3B9MA 4L8UA 4OTUA 3GQUA 5HOZA 4F5TA 3WHRA 2QHBA 1E7CA 1TF0A 4N3ZA 2OT3A 4LUFA 4N0FD 3V03A 4ZBKA 1H9ZA 2XVWA 2BXEA 5B5TA 3FNMA 3NVMA 5FUOA 3H3AA 3NVKA 2EFEA 1E7GA 3A73A 1NT2B 4N0UD 3LU7A 4ZBRA 2E0XA 3LU8A 4GDLB 5D7GA 5GIOA 3FWCC 2EFCA 2AJEA 1MIWA 2BXPA 4S1YA 4ZUXV 1HK3A 1MA9A 3KJLA 1IJGA 2BXLA 4OTTA 1HA2A 5IFOA 4LA0A 1J7EA 2NNWA 2XW1A 1J78A 3MHSB 1FOUA 2BXOA 2BXMA 2XW0A 4BKEA 5GIPA 2BXAA 2DBUA 4LB9A 4OT2A 2BXKA 4L9KA 2BX8A 4FIPB 1BKEA 3M99C 1E7EA 3WHSA 1E7FA 1JNBA 1LNSA 2BXFA 2QM6A 3CX9A 5IJFA 2DYMA 3SQJA 1H5WA 2XVQA 4EMXA 5IIXA 2BXBA 1O9XA 4OR0A 1E7HA 3B9LA 4LUHA 1AO6A 3ICXA 2BXCA 4K2CA 1E7AA 3MHHB 3V08A 2BXNA 3G9KD 1VFIA 2DG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOQ A; 
#chains in the Genus database with same CATH topology
 4HGK A;  4M70 B;  5GIN A;  2XMO A;  4PO0 A;  1GNI A;  4TQ0 A;  4ZCG A;  3JRY A;  4K71 A;  1HK5 A;  3A75 A;  4ZC6 A;  2VDB A;  2Z8K A;  2V36 A;  2BXD A;  5IJE A;  2I30 A;  1HK4 A;  2XSI A;  3H37 A;  2DBW A;  4GDX A;  4HGM B;  3UIV A;  4W4U B;  4MBE C;  4GG2 A;  4J2V A;  2BXH A;  2I2Z A;  2LXT A;  2EFH A;  2VUF A;  4G03 A;  4IW2 A;  2BXI A;  4JK4 A;  4Z9O A;  3JQZ A;  4WA6 B;  3V09 A;  4FK5 B;  1TXU A;  4G01 A;  5ID9 A;  4GDK B;  2KBZ A;  2LQH A;  2NQO A;  3GQX A;  4ZBQ A;  4DHX B;  3SIU B;  1GNJ A;  5DBY A;  1MUS A;  2Z8I A;  1BM0 A;  5GHK A;  3NVI A;  2ROH A;  4BY9 C;  4TQ1 A;  4F5U A;  2CKX A;  2DYO A;  2XVU A;  1N5U A;  4LB2 A;  3VQI A;  2QMC A;  3KIK A;  3W1S A;  3GA9 L;  1VZS A;  2DBX A;  1UOR A;  1MIY A;  4L9Q A;  3FWB C;  3PLA A;  2K0N A;  2GUT A;  3LU6 A;  5IIU A;  5IIH A;  1E78 A;  3WHQ A;  2BXG A;  2EFD A;  4NAW B;  4E99 A;  4F5S A;  3SIV B;  2XVV A;  1LOT A;  2LOQ A;  2YDF A;  4Z69 A;  2KWF A;  3TDL A;  1HK1 A;  4F5V A;  4FJC B;  5BPK A;  4C31 B;  4IW1 A;  3NMU A;  5DQF A;  1KXP D;  2JUH A;  5IJ5 A;  1BJ5 A;  1E7I A;  1KW2 A;  4G04 A;  2OZB B;  1MIV A;  2VUE A;  5ID7 A;  2Z8J A;  1E7B A;  1HK2 A;  2E0Y A;  2BXQ A;  3B9M A;  4L8U A;  4OTU A;  3GQU A;  5HOZ A;  4F5T A;  3WHR A;  2QHB A;  1E7C A;  1TF0 A;  4N3Z A;  2OT3 A;  4LUF A;  4N0F D;  3V03 A;  4ZBK A;  1H9Z A;  2XVW A;  2BXE A;  5B5T A;  3ECP A;  3FNM A;  3NVM A;  5FUO A;  3H3A A;  3NVK A;  2EFE A;  1E7G A;  3A73 A;  1NT2 B;  4I9O A;  4DM0 A;  3BPJ A;  4N0U D;  3LU7 A;  4ZBR A;  2E0X A;  4D7X A;  3LU8 A;  4GDL B;  5D7G A;  5GIO A;  3FWC C;  2EFC A;  2AJE A;  1MIW A;  2BXP A;  4S1Y A;  4ZUX V;  1HK3 A;  1MA9 A;  3KJL A;  1IJG A;  2BXL A;  4OTT A;  1HA2 A;  5IFO A;  4LA0 A;  1J7E A;  2NNW A;  2XW1 A;  1J78 A;  3MHS B;  1FOU A;  2BXO A;  2LQI A;  2BXM A;  2XW0 A;  4BKE A;  5GIP A;  2BXA A;  2DBU A;  4LB9 A;  4OT2 A;  2BXK A;  4L9K A;  2BX8 A;  2LXS A;  4FIP B;  1BKE A;  3M99 C;  1E7E A;  3WHS A;  1E7F A;  1JNB A;  1LNS A;  2BXF A;  2QM6 A;  3CX9 A;  1MUH A;  5IJF A;  2DYM A;  3SQJ A;  1H5W A;  2XVQ A;  1MM8 A;  4EMX A;  5IIX A;  2AGH B;  2BXB A;  1O9X A;  4OR0 A;  1E7H A;  3B9L A;  1SB0 A;  4LUH A;  1KDX A;  1AO6 A;  3ICX A;  2BXC A;  4K2C A;  1E7A A;  3MHH B;  3V08 A;  2BXN A;  3G9K D;  1VFI A;  2DG5 A; 
#chains in the Genus database with same CATH homology
 4HGK A;  4M70 B;  5GIN A;  2XMO A;  4PO0 A;  1GNI A;  4TQ0 A;  4ZCG A;  3JRY A;  4K71 A;  1HK5 A;  3A75 A;  4ZC6 A;  2VDB A;  2Z8K A;  2V36 A;  2BXD A;  5IJE A;  2I30 A;  1HK4 A;  2XSI A;  3H37 A;  2DBW A;  4GDX A;  4HGM B;  3UIV A;  4W4U B;  4MBE C;  4GG2 A;  4J2V A;  2BXH A;  2I2Z A;  4G03 A;  2EFH A;  2VUF A;  4JK4 A;  4IW2 A;  2BXI A;  4Z9O A;  3V09 A;  3JQZ A;  4WA6 B;  4FK5 B;  1TXU A;  4G01 A;  5ID9 A;  4GDK B;  2KBZ A;  2NQO A;  3GQX A;  4ZBQ A;  4DHX B;  3SIU B;  1GNJ A;  5DBY A;  2Z8I A;  1BM0 A;  5GHK A;  3NVI A;  2ROH A;  4BY9 C;  4TQ1 A;  4F5U A;  2CKX A;  2DYO A;  2XVU A;  1N5U A;  4LB2 A;  3VQI A;  2QMC A;  3KIK A;  3W1S A;  3GA9 L;  1VZS A;  2DBX A;  1UOR A;  1MIY A;  4L9Q A;  3FWB C;  3PLA A;  3LU6 A;  5IIU A;  5IIH A;  1E78 A;  3WHQ A;  2BXG A;  2EFD A;  4NAW B;  4E99 A;  4F5S A;  3SIV B;  2XVV A;  1LOT A;  2LOQ A;  2YDF A;  4Z69 A;  3TDL A;  4F5V A;  1HK1 A;  4FJC B;  5BPK A;  4C31 B;  4IW1 A;  3NMU A;  5DQF A;  1KXP D;  2JUH A;  5IJ5 A;  1BJ5 A;  1E7I A;  1KW2 A;  4G04 A;  2OZB B;  1MIV A;  2VUE A;  5ID7 A;  2Z8J A;  1E7B A;  1HK2 A;  2E0Y A;  2BXQ A;  3B9M A;  4L8U A;  4OTU A;  3GQU A;  5HOZ A;  4F5T A;  3WHR A;  2QHB A;  1E7C A;  1TF0 A;  4N3Z A;  2OT3 A;  4LUF A;  4N0F D;  3V03 A;  4ZBK A;  1H9Z A;  2XVW A;  2BXE A;  5B5T A;  3FNM A;  3NVM A;  5FUO A;  3H3A A;  3NVK A;  2EFE A;  1E7G A;  3A73 A;  1NT2 B;  4N0U D;  3LU7 A;  4ZBR A;  2E0X A;  3LU8 A;  4GDL B;  5D7G A;  5GIO A;  3FWC C;  2EFC A;  2AJE A;  1MIW A;  2BXP A;  4S1Y A;  4ZUX V;  1HK3 A;  1MA9 A;  3KJL A;  1IJG A;  2BXL A;  4OTT A;  1HA2 A;  5IFO A;  4LA0 A;  1J7E A;  2NNW A;  2XW1 A;  1J78 A;  3MHS B;  1FOU A;  2BXO A;  2BXM A;  2XW0 A;  4BKE A;  5GIP A;  2BXA A;  2DBU A;  4LB9 A;  4OT2 A;  2BXK A;  4L9K A;  2BX8 A;  4FIP B;  1BKE A;  3M99 C;  1E7E A;  3WHS A;  1E7F A;  1JNB A;  1LNS A;  2BXF A;  2QM6 A;  3CX9 A;  5IJF A;  2DYM A;  3SQJ A;  1H5W A;  2XVQ A;  4EMX A;  5IIX A;  2BXB A;  1O9X A;  4OR0 A;  1E7H A;  3B9L A;  4LUH A;  1AO6 A;  3ICX A;  2BXC A;  4K2C A;  1E7A A;  3MHH B;  3V08 A;  2BXN A;  3G9K D;  1VFI A;  2DG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...