2LPKA

Solution nmr of the specialized apo-acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lpkA00
2AFDA 2KG8A 2VSQA 2KR5A 2K0XA 2MY5A 4H2WC 2KGDA 5HVCA 1L0IA 2EHTA 1ACPA 2N6ZA 3GZLA 3CE7A 2CNRA 4BPFA 2FADA 2L9FA 2K94A 4DG9A 4R0MA 2MD9A 2FQ1A 2ROQA 2CQ8A 2M5RA 2KOSA 2L0QA 4HKGA 5KP8B 3EJEA 2KW2A 2KOOA 1HQBA 1DV5A 3LMOA 2KGCA 2X2BA 2K93A 5KP6B 2AF8A 2EHSA 2CG5B 2K2QA 2FVAA 5KP7B 4H2YC 2LPKA 4CA3A 2GDYA 1NQ4A 1AF8A 2LIWA 2FVEA 2MR8A 1HY8A 2LMLA 2MF4A 2LL8A 2KOQA 2N50A 2JGPA 2N5IA 1DNYA 5CZDB 2KWLA 2N98A 2MR7A 2KG9A 2N6YA 4NEOA 2KORA 2JU2A 4PXHB 1X3OA 4MRTC 1L0HA 2PNGA 2KOPA 2FHSC 2LKIA 2N5HA 2AVAA 2MVVA 2MVUA 2JU1A 2FQ2A 4BPGA 3RG2A 3GZMA 4IZ6A 2LIUA 2XZ1C 2LTEA 2FVFA 1VKUA 2LOLA 2GDWA 4BPHA 1OR5A 2KGEA 3NY7B 2XZ0D 2AFEA 2FQ0A 4PWVB 3EJBA 2FAEA 2CGQA 1F80D 2KGAA 2DNWA 2JQ4A 2FACA 2KG6A 1T8KA 2K92A 2L22A 2QNWA 4H2XC 5EJDA 2GDXA 2L4BA 5HV8A 2K0YA 1KLPA 3EJDA
chains in the Genus database with same CATH superfamily
5I4TG 2OTLP 3G26A 1L0IA 2EHTA 1QRJA 3MGEA 3G6EP 2CNRA 4BPFA 3CCEP 3CCLP 2ERHA 2K94A 4XFXA 4R0MA 3CCSP 1YJNP 2K5XA 2FQ1A 2ROQA 5F2KA 2M5RA 2L0QA 5KP8B 4XFYA 1FR2A 4U0BA 1HQBA 3LMOA 3DS5A 2KGCA 3G21A 2PEQA 1YITP 1IUQA 2FVAA 2K0DX 2JYGA 1NJIQ 4CA3A 2GDYA 2Z45A 1NQ4A 2MR8A 1IMPA 2LMLA 2LL8A 2N50A 3Q20A 2KODA 2KWLA 2KG9A 1UJZA 4U0DA 2OTJP 4NEOA 4WYMA 4PXHB 2PNGA 4UHPB 1GXGA 2LKIA 2ONTA 3CPWO 3CXCO 2FQ2A 1K30A 2PEOA 5JPAA 4BPGA 3H0DA 3G28A 4GR2A 4QKOA 3I55P 3DS4A 5HGNA 1EOQA 1K8AQ 2LOLA 1VQ9P 2GZGA 1KD1Q 2GDWA 2KGEA 3RG6C 1KC8Q 2AFEA 3GJNA 1A8OA 2CGQA 3DS2A 2KGAA 2DNWA 2JB0A 2L4BA 4PH1A 3H4EA 2KR5A 1GXHA 1M1KQ 2K0XA 2MY5A 1K9MQ 1BXIA 1AUMA 2PENA 2GYKA 3CE7A 2L9FA 1ZMBA 2GZIA 1M74A 1VQLP 1M90Q 2M8LA 3CMAP 2L6EA 3EJEA 2KW2A 1RO0A 1DV5A 2X2BA 2K93A 3I56P 3NTEA 2K2QA 4H2YC 3CC2P 1AF8A 2LIWA 2WPTA 3DPHA 1Z6MA 2KOQA 1CEIA 1M6EX 2GZEA 4GR6A 2N98A 5HGLA 2JU2A 5EW5E 4MRTC 2VLNA 3DS1A 3CCUP 2PEJA 1VQPP 3CCMP 3CCRP 2BHVA 1VQ5P 1VQOP 3RG2A 3GZMA 3HYBA 3CCJP 3CC7P 2XZ1C 1YJ9P 1Q82Q 4XROA 2FVFA 1VKUA 3VRLC 2JYLA 1OR5A 2XZ0D 2FQ0A 3EJBA 2FAEA 2VLQA 2KG6A 2K92A 5EJDA 4H2XC 1IMQA 2JBGA 3GKLC 4COCA 3H47A 2M8PA 2AFDA 2KG8A 3U43A 1QVGO 2KGDA 7CEIA 5HVCA 1E6JP 2EFJA 1ACPA 2N6ZA 3GZLA 2EG5A 2FADA 4DG9A 1RO2A 3P05A 4PH0A 5HGOA 5BS1A 2KOSA 1VQ6P 3M1MA 1KQSO 1UNKA 3OW2O 3HZQA 3G4SP 3G1IA 2N5IA 2VLOA 2JAZA 5CZDB 3LRYA 4QNBA 1Q7YQ 2MR7A 3B4QA 2PEIA 2XXMA 2N6YA 1VQMP 1D1DA 1VHNA 2KORA 1X3OA 2KOPA 2NO8A 2FHSC 2AVAA 4U0FA 3CMEP 2XT1A 1EIAA 2JO0A 2LIUA 1YIJP 3CCVP 4U0EA 1VQNP 3E2DA 1N8RQ 2PY8A 3G0VA 4IPYA 3NY7B 1Q81Q 4PWVB 2Z44A 1F80D 2FACA 1JJ2O 2QNWA 5F2OA 1BAJA 1GPJA 2K0YA 2M8NA 2QEXP 2VSQA 4H2WC 2P9XA 3DTJA 3B5IA 2CWOA 2LF4A 2MD9A 3G29A 1YJWP 1E0HA 3DS3A 1W2BO 2CQ8A 3DS0A 4HKGA 1EMVA 2KOOA 2Z46A 1S72P 5KP6B 1ZNVA 2AF8A 2E1MA 2EHSA 2CG5B 1RNIA 5KP7B 2LPKA 2PEKA 3CCQP 2FVEA 3WBHA 1YHQP 1HY8A 2MF4A 1K73Q 2JGPA 1VQKP 4U0CA 1QVFO 1DNYA 2PEMA 2DGYA 3CD6P 1Q86Q 4XRQA 4U0AA 2GZJA 1MZ8A 1A43A 1L0HA 2BUOA 2N5HA 5F2NA 2MVVA 1YI2P 2MVUA 2QA4P 2JU1A 4F37A 2EIAA 4IZ6A 2GZFA 3CC4P 3G1GA 2LTEA 5HGMA 4M0IA 1AYIA 5BS2A 4XFZA 1VQ8P 4BPHA 2OARA 1M6NA 2XV6A 2JQ4A 1VQ4P 3G71P 1VQ7P 1T8KA 2L22A 2GDXA 5HV8A 5DCKA 4COPA 2VLPA 1KLPA 3EJDA
chains in the Genus database with same CATH topology
2AFDA 2KG8A 2VSQA 2KR5A 2K0XA 2MY5A 4H2WC 2KGDA 5HVCA 1L0IA 2EHTA 1ACPA 2N6ZA 3GZLA 3CE7A 2CNRA 4BPFA 2FADA 2L9FA 2K94A 4DG9A 4R0MA 2MD9A 2FQ1A 2ROQA 2CQ8A 2M5RA 2KOSA 2L0QA 4HKGA 5KP8B 3EJEA 2KW2A 2KOOA 1HQBA 1DV5A 3LMOA 2KGCA 2X2BA 2K93A 5KP6B 2AF8A 2EHSA 2CG5B 2K2QA 2FVAA 5KP7B 4H2YC 2LPKA 4CA3A 2GDYA 1NQ4A 1AF8A 2LIWA 2FVEA 2MR8A 1HY8A 2LMLA 2MF4A 2LL8A 2KOQA 2N50A 2JGPA 2N5IA 1DNYA 5CZDB 2KWLA 2N98A 2MR7A 2KG9A 2N6YA 4NEOA 2KORA 2JU2A 4PXHB 1X3OA 4MRTC 1L0HA 2PNGA 2KOPA 2FHSC 2LKIA 2N5HA 2AVAA 2MVVA 2MVUA 2JU1A 2FQ2A 4BPGA 3RG2A 3GZMA 4IZ6A 2LIUA 2XZ1C 2LTEA 2FVFA 1VKUA 2LOLA 2GDWA 4BPHA 1OR5A 2KGEA 3NY7B 2XZ0D 2AFEA 2FQ0A 4PWVB 3EJBA 2FAEA 2CGQA 1F80D 2KGAA 2DNWA 2JQ4A 2FACA 2KG6A 1T8KA 2K92A 2L22A 2QNWA 4H2XC 5EJDA 2GDXA 2L4BA 5HV8A 2K0YA 1KLPA 3EJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFD A;  2KG8 A;  2VSQ A;  2KR5 A;  2K0X A;  2MY5 A;  4H2W C;  2KGD A;  5HVC A;  1L0I A;  2EHT A;  1ACP A;  2N6Z A;  3GZL A;  3CE7 A;  2CNR A;  4BPF A;  2FAD A;  2L9F A;  2K94 A;  4DG9 A;  4R0M A;  2MD9 A;  2FQ1 A;  2ROQ A;  2CQ8 A;  2M5R A;  2KOS A;  2L0Q A;  4HKG A;  5KP8 B;  3EJE A;  2KW2 A;  2KOO A;  1HQB A;  1DV5 A;  3LMO A;  2KGC A;  2X2B A;  2K93 A;  5KP6 B;  2AF8 A;  2EHS A;  2CG5 B;  2K2Q A;  2FVA A;  5KP7 B;  4H2Y C;  2LPK A;  4CA3 A;  2GDY A;  1NQ4 A;  1AF8 A;  2LIW A;  2FVE A;  2MR8 A;  1HY8 A;  2LML A;  2MF4 A;  2LL8 A;  2KOQ A;  2N50 A;  2JGP A;  2N5I A;  1DNY A;  5CZD B;  2KWL A;  2N98 A;  2MR7 A;  2KG9 A;  2N6Y A;  4NEO A;  2KOR A;  2JU2 A;  4PXH B;  1X3O A;  4MRT C;  1L0H A;  2PNG A;  2KOP A;  2FHS C;  2LKI A;  2N5H A;  2AVA A;  2MVV A;  2MVU A;  2JU1 A;  2FQ2 A;  4BPG A;  3RG2 A;  3GZM A;  4IZ6 A;  2LIU A;  2XZ1 C;  2LTE A;  2FVF A;  1VKU A;  2LOL A;  2GDW A;  4BPH A;  1OR5 A;  2KGE A;  3NY7 B;  2XZ0 D;  2AFE A;  2FQ0 A;  4PWV B;  3EJB A;  2FAE A;  2CGQ A;  1F80 D;  2KGA A;  2DNW A;  2JQ4 A;  2FAC A;  2KG6 A;  1T8K A;  2K92 A;  2L22 A;  2QNW A;  4H2X C;  5EJD A;  2GDX A;  2L4B A;  5HV8 A;  2K0Y A;  1KLP A;  3EJD A; 
#chains in the Genus database with same CATH topology
 5I4T G;  2OTL P;  3G26 A;  1L0I A;  2EHT A;  1QRJ A;  3MGE A;  3G6E P;  2CNR A;  4BPF A;  3CCE P;  3CCL P;  2ERH A;  2K94 A;  4XFX A;  4R0M A;  3CCS P;  1YJN P;  2K5X A;  2FQ1 A;  2ROQ A;  5F2K A;  2M5R A;  2L0Q A;  5KP8 B;  4XFY A;  1FR2 A;  4U0B A;  1HQB A;  3LMO A;  3DS5 A;  2KGC A;  3G21 A;  2PEQ A;  1YIT P;  1IUQ A;  2FVA A;  2K0D X;  2JYG A;  1NJI Q;  4CA3 A;  2GDY A;  2Z45 A;  1NQ4 A;  2MR8 A;  1IMP A;  2LML A;  2LL8 A;  2N50 A;  3Q20 A;  2KOD A;  2KWL A;  2KG9 A;  1UJZ A;  4U0D A;  2OTJ P;  4NEO A;  4WYM A;  4PXH B;  2PNG A;  4UHP B;  1GXG A;  2LKI A;  2ONT A;  3CPW O;  3CXC O;  2FQ2 A;  1K30 A;  2PEO A;  5JPA A;  4BPG A;  3H0D A;  3G28 A;  4GR2 A;  4QKO A;  3I55 P;  3DS4 A;  5HGN A;  1EOQ A;  1K8A Q;  2LOL A;  1VQ9 P;  2GZG A;  1KD1 Q;  2GDW A;  2KGE A;  3RG6 C;  1KC8 Q;  2AFE A;  3GJN A;  1A8O A;  2CGQ A;  3DS2 A;  2KGA A;  2DNW A;  2JB0 A;  2L4B A;  4PH1 A;  3H4E A;  2KR5 A;  1GXH A;  1M1K Q;  2K0X A;  2MY5 A;  1K9M Q;  1BXI A;  1AUM A;  2PEN A;  2GYK A;  3CE7 A;  2L9F A;  1ZMB A;  2GZI A;  1M74 A;  1VQL P;  1M90 Q;  2M8L A;  3CMA P;  2L6E A;  3EJE A;  2KW2 A;  1RO0 A;  1DV5 A;  2X2B A;  2K93 A;  3I56 P;  3NTE A;  2K2Q A;  4H2Y C;  3CC2 P;  1AF8 A;  2LIW A;  2WPT A;  3DPH A;  1Z6M A;  2KOQ A;  1CEI A;  1M6E X;  2GZE A;  4GR6 A;  2N98 A;  5HGL A;  2JU2 A;  5EW5 E;  4MRT C;  2VLN A;  3DS1 A;  3CCU P;  2PEJ A;  1VQP P;  3CCM P;  3CCR P;  2BHV A;  1VQ5 P;  1VQO P;  3RG2 A;  3GZM A;  3HYB A;  3CCJ P;  3CC7 P;  2XZ1 C;  1YJ9 P;  1Q82 Q;  4XRO A;  2FVF A;  1VKU A;  3VRL C;  2JYL A;  1OR5 A;  2XZ0 D;  2FQ0 A;  3EJB A;  2FAE A;  2VLQ A;  2KG6 A;  2K92 A;  5EJD A;  4H2X C;  1IMQ A;  2JBG A;  3GKL C;  4COC A;  3H47 A;  2M8P A;  2AFD A;  2KG8 A;  3U43 A;  1QVG O;  2KGD A;  7CEI A;  5HVC A;  1E6J P;  2EFJ A;  1ACP A;  2N6Z A;  3GZL A;  2EG5 A;  2FAD A;  4DG9 A;  1RO2 A;  3P05 A;  4PH0 A;  5HGO A;  5BS1 A;  2KOS A;  1VQ6 P;  3M1M A;  1KQS O;  1UNK A;  3OW2 O;  3HZQ A;  3G4S P;  3G1I A;  2N5I A;  2VLO A;  2JAZ A;  5CZD B;  3LRY A;  4QNB A;  1Q7Y Q;  2MR7 A;  3B4Q A;  2PEI A;  2XXM A;  2N6Y A;  1VQM P;  1D1D A;  1VHN A;  2KOR A;  1X3O A;  2KOP A;  2NO8 A;  2FHS C;  2AVA A;  4U0F A;  3CME P;  2XT1 A;  1EIA A;  2JO0 A;  2LIU A;  1YIJ P;  3CCV P;  4U0E A;  1VQN P;  3E2D A;  1N8R Q;  2PY8 A;  3G0V A;  4IPY A;  3NY7 B;  1Q81 Q;  4PWV B;  2Z44 A;  1F80 D;  2FAC A;  1JJ2 O;  2QNW A;  5F2O A;  1BAJ A;  1GPJ A;  2K0Y A;  2M8N A;  2QEX P;  2VSQ A;  4H2W C;  2P9X A;  3DTJ A;  3B5I A;  2CWO A;  2LF4 A;  2MD9 A;  3G29 A;  1YJW P;  1E0H A;  3DS3 A;  1W2B O;  2CQ8 A;  3DS0 A;  4HKG A;  1EMV A;  2KOO A;  2Z46 A;  1S72 P;  5KP6 B;  1ZNV A;  2AF8 A;  2E1M A;  2EHS A;  2CG5 B;  1RNI A;  5KP7 B;  2LPK A;  2PEK A;  3CCQ P;  2FVE A;  3WBH A;  1YHQ P;  1HY8 A;  2MF4 A;  1K73 Q;  2JGP A;  1VQK P;  4U0C A;  1QVF O;  1DNY A;  2PEM A;  2DGY A;  3CD6 P;  1Q86 Q;  4XRQ A;  4U0A A;  2GZJ A;  1MZ8 A;  1A43 A;  1L0H A;  2BUO A;  2N5H A;  5F2N A;  2MVV A;  1YI2 P;  2MVU A;  2QA4 P;  2JU1 A;  4F37 A;  2EIA A;  4IZ6 A;  2GZF A;  3CC4 P;  3G1G A;  2LTE A;  5HGM A;  4M0I A;  1AYI A;  5BS2 A;  4XFZ A;  1VQ8 P;  4BPH A;  2OAR A;  1M6N A;  2XV6 A;  2JQ4 A;  1VQ4 P;  3G71 P;  1VQ7 P;  1T8K A;  2L22 A;  2GDX A;  5HV8 A;  5DCK A;  4COP A;  2VLP A;  1KLP A;  3EJD A; 
#chains in the Genus database with same CATH homology
 2AFD A;  2KG8 A;  2VSQ A;  2KR5 A;  2K0X A;  2MY5 A;  4H2W C;  2KGD A;  5HVC A;  1L0I A;  2EHT A;  1ACP A;  2N6Z A;  3GZL A;  3CE7 A;  2CNR A;  4BPF A;  2FAD A;  2L9F A;  2K94 A;  4DG9 A;  4R0M A;  2MD9 A;  2FQ1 A;  2ROQ A;  2CQ8 A;  2M5R A;  2KOS A;  2L0Q A;  4HKG A;  5KP8 B;  3EJE A;  2KW2 A;  2KOO A;  1HQB A;  1DV5 A;  3LMO A;  2KGC A;  2X2B A;  2K93 A;  5KP6 B;  2AF8 A;  2EHS A;  2CG5 B;  2K2Q A;  2FVA A;  5KP7 B;  4H2Y C;  2LPK A;  4CA3 A;  2GDY A;  1NQ4 A;  1AF8 A;  2LIW A;  2FVE A;  2MR8 A;  1HY8 A;  2LML A;  2MF4 A;  2LL8 A;  2KOQ A;  2N50 A;  2JGP A;  2N5I A;  1DNY A;  5CZD B;  2KWL A;  2N98 A;  2MR7 A;  2KG9 A;  2N6Y A;  4NEO A;  2KOR A;  2JU2 A;  4PXH B;  1X3O A;  4MRT C;  1L0H A;  2PNG A;  2KOP A;  2FHS C;  2LKI A;  2N5H A;  2AVA A;  2MVV A;  2MVU A;  2JU1 A;  2FQ2 A;  4BPG A;  3RG2 A;  3GZM A;  4IZ6 A;  2LIU A;  2XZ1 C;  2LTE A;  2FVF A;  1VKU A;  2LOL A;  2GDW A;  4BPH A;  1OR5 A;  2KGE A;  3NY7 B;  2XZ0 D;  2AFE A;  2FQ0 A;  4PWV B;  3EJB A;  2FAE A;  2CGQ A;  1F80 D;  2KGA A;  2DNW A;  2JQ4 A;  2FAC A;  2KG6 A;  1T8K A;  2K92 A;  2L22 A;  2QNW A;  4H2X C;  5EJD A;  2GDX A;  2L4B A;  5HV8 A;  2K0Y A;  1KLP A;  3EJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...