2LPKA

Solution nmr of the specialized apo-acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lpkA00
1L0HA 5KP8B 1DV5A 2N6YA 2K0YA 2QNWA 2KOQA 1ACPA 4BPFA 2FHSC 2MY5A 2XZ0D 2FADA 2MVVA 5HV8A 2LIUA 4H2WC 4CA3A 3RG2A 2K0XA 2JQ4A 2CG5B 2FQ1A 3EJEA 1KLPA 2FQ0A 4DG9A 2L0QA 1F80D 4BPHA 2AF8A 2LPKA 2N98A 2N5IA 1NQ4A 2EHTA 4IZ6A 2KOSA 2CQ8A 4NEOA 2AFDA 3LMOA 5CZDB 2K2QA 2FACA 1OR5A 2AFEA 5KP7B 2KGAA 3EJDA 2MF4A 2LL8A 2AVAA 1VKUA 2JGPA 4MRTC 2KOOA 2LKIA 3NY7B 2L9FA 1T8KA 2CNRA 2MVUA 2EHSA 2KGCA 2N5HA 4H2YC 2CGQA 2LIWA 2FVAA 2JU1A 2N6ZA 4PWVB 4HKGA 2MD9A 2VSQA 2FAEA 4PXHB 2KG8A 2MR8A 2LOLA 2LTEA 4R0MA 2FQ2A 2ROQA 2KGDA 2KGEA 2FVFA 2K94A 1HQBA 2K92A 2MR7A 1HY8A 2K93A 5KP6B 3CE7A 2KORA 1DNYA 2L4BA 5HVCA 2GDYA 2XZ1C 2N50A 3GZLA 2KOPA 2LMLA 2GDXA 2M5RA 2KW2A 2KG9A 2FVEA 2KWLA 2PNGA 1X3OA 2KG6A 2DNWA 3GZMA 5EJDA 4H2XC 2JU2A 1AF8A 3EJBA 2L22A 1L0IA 2GDWA 4BPGA 2KR5A 2X2BA
chains in the Genus database with same CATH superfamily
1L0HA 2EG5A 5KP8B 1M6EX 3CCJP 2NO8A 1EMVA 2XZ0D 3DPHA 2FADA 3CC4P 4U0BA 5HV8A 2LIUA 4CA3A 2K0XA 3CMEP 1AUMA 1YHQP 3DS2A 3G6EP 1IMQA 2N98A 2VLNA 3B5IA 3WBHA 4COCA 2AFEA 2KGAA 2E1MA 2XXMA 3EJDA 3CC7P 2JGPA 4MRTC 1QVGO 1S72P 2MVUA 2VLPA 2ERHA 2MD9A 2VSQA 4QNBA 2FAEA 1VQOP 4PXHB 2KG8A 3CCRP 2LOLA 4R0MA 1YJNP 2FVFA 4F37A 1Q86Q 4U0DA 1D1DA 2ONTA 2K92A 1QVFO 4XFZA 5HVCA 1VQ7P 1EIAA 3CD6P 1KQSO 3CXCO 2FVEA 2PNGA 3HZQA 2PEMA 3G4SP 5F2KA 4U0CA 1RNIA 2L22A 2PEQA 2BUOA 1DV5A 2N6YA 4BPFA 3U43A 1VQ4P 2MVVA 3H47A 3GKLC 3DS1A 1YJ9P 2JQ4A 2CG5B 2Z45A 2FQ0A 4XRQA 4IPYA 4BPHA 2AF8A 2LPKA 2EHTA 1M1KQ 2GZJA 2PEIA 1W2BO 1AYIA 4IZ6A 3G0VA 3I56P 4XROA 2Z44A 5HGLA 2GZGA 3CCVP 1QRJA 2GZFA 2AVAA 4UHPB 2KOOA 1K9MQ 1GPJA 1IMPA 3NY7B 1EOQA 2CNRA 3GJNA 2EHSA 2LIWA 2JU1A 1RO0A 4HKGA 4XFYA 1M74A 3H4EA 3CCMP 2LTEA 5HGOA 5I4TG 2KGEA 2K94A 3B4QA 1VHNA 5KP6B 5EW5E 2GYKA 2JYLA 2L4BA 2JBGA 1E6JP 2GDYA 3RG6C 2XZ1C 1YIJP 2N50A 1NJIQ 2LMLA 2KW2A 2KG9A 2PEJA 2KG6A 1YI2P 2DNWA 5EJDA 2K0DX 5F2NA 2XT1A 4BPGA 3G21A 2X2BA 3G26A 2KOQA 2MY5A 3DS3A 3MGEA 2QA4P 2OARA 2JO0A 2GZEA 3RG2A 3CC2P 3CCQP 3CCLP 1A43A 1UNKA 2FQ1A 3EJEA 3NTEA 4DG9A 2BHVA 3DS4A 1NQ4A 2JAZA 3CPWO 2OTLP 3H0DA 4XFXA 2KOSA 1K8AQ 2CWOA 3LMOA 5CZDB 2K2QA 5KP7B 1VQKP 2K5XA 2P9XA 1VKUA 2QEXP 2OTJP 2VLOA 2LKIA 3OW2O 2L9FA 4H2YC 1YJWP 1RO2A 2FVAA 4PWVB 1UJZA 3M1MA 4GR6A 1GXHA 3CCEP 3G29A 2PENA 1FR2A 1HQBA 4PH1A 3P05A 2MR7A 1HY8A 2K93A 2GZIA 2KORA 1VQMP 2PEKA 5BS1A 1N8RQ 1BXIA 2EFJA 3GZLA 2KOPA 1Q81Q 1A8OA 2M8LA 3CMAP 2GDXA 7CEIA 2M5RA 1KC8Q 1X3OA 3GZMA 1AF8A 1IUQA 3EJBA 2KR5A 4U0EA 1VQ8P 2K0YA 2QNWA 1ACPA 1VQ5P 2M8NA 2FHSC 3DTJA 3G1IA 5HGMA 2M8PA 1M90Q 1VQPP 2JYGA 4H2WC 5BS2A 2PEOA 2EIAA 1KLPA 1K73Q 2L0QA 3VRLC 4WYMA 1F80D 4U0AA 5JPAA 1ZMBA 1ZNVA 3CCUP 2N5IA 4COPA 1MZ8A 4NEOA 2CQ8A 2AFDA 1CEIA 1M6NA 2FACA 3G1GA 1VQLP 1OR5A 3Q20A 1VQNP 2MF4A 2LL8A 2WPTA 3G71P 2PY8A 1E0HA 1BAJA 1T8KA 2N5HA 2KGCA 2CGQA 4GR2A 1VQ9P 3LRYA 2N6ZA 3DS5A 3E2DA 1Q7YQ 1VQ6P 2MR8A 4U0FA 1KD1Q 1Z6MA 1Q82Q 3G28A 1YITP 2FQ2A 2ROQA 2KODA 5F2OA 5HGNA 2KGDA 1JJ2O 4QKOA 5DCKA 2L6EA 2Z46A 3CE7A 3CCSP 1K30A 2VLQA 1DNYA 2DGYA 4PH0A 2JB0A 3DS0A 1GXGA 2KWLA 2XV6A 4H2XC 2JU2A 3I55P 3HYBA 4M0IA 1L0IA 2GDWA 2LF4A
chains in the Genus database with same CATH topology
1L0HA 5KP8B 1DV5A 2N6YA 2K0YA 2QNWA 2KOQA 1ACPA 4BPFA 2FHSC 2MY5A 2XZ0D 2FADA 2MVVA 5HV8A 2LIUA 4H2WC 4CA3A 3RG2A 2K0XA 2JQ4A 2CG5B 2FQ1A 3EJEA 1KLPA 2FQ0A 4DG9A 2L0QA 1F80D 4BPHA 2AF8A 2LPKA 2N98A 2N5IA 1NQ4A 2EHTA 4IZ6A 2KOSA 2CQ8A 4NEOA 2AFDA 3LMOA 5CZDB 2K2QA 2FACA 1OR5A 2AFEA 5KP7B 2KGAA 3EJDA 2MF4A 2LL8A 2AVAA 1VKUA 2JGPA 4MRTC 2KOOA 2LKIA 3NY7B 2L9FA 1T8KA 2CNRA 2MVUA 2EHSA 2KGCA 2N5HA 4H2YC 2CGQA 2LIWA 2FVAA 2JU1A 2N6ZA 4PWVB 4HKGA 2MD9A 2VSQA 2FAEA 4PXHB 2KG8A 2MR8A 2LOLA 2LTEA 4R0MA 2FQ2A 2ROQA 2KGDA 2KGEA 2FVFA 2K94A 1HQBA 2K92A 2MR7A 1HY8A 2K93A 5KP6B 3CE7A 2KORA 1DNYA 2L4BA 5HVCA 2GDYA 2XZ1C 2N50A 3GZLA 2KOPA 2LMLA 2GDXA 2M5RA 2KW2A 2KG9A 2FVEA 2KWLA 2PNGA 1X3OA 2KG6A 2DNWA 3GZMA 5EJDA 4H2XC 2JU2A 1AF8A 3EJBA 2L22A 1L0IA 2GDWA 4BPGA 2KR5A 2X2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0H A;  5KP8 B;  1DV5 A;  2N6Y A;  2K0Y A;  2QNW A;  2KOQ A;  1ACP A;  4BPF A;  2FHS C;  2MY5 A;  2XZ0 D;  2FAD A;  2MVV A;  5HV8 A;  2LIU A;  4H2W C;  4CA3 A;  3RG2 A;  2K0X A;  2JQ4 A;  2CG5 B;  2FQ1 A;  3EJE A;  1KLP A;  2FQ0 A;  4DG9 A;  2L0Q A;  1F80 D;  4BPH A;  2AF8 A;  2LPK A;  2N98 A;  2N5I A;  1NQ4 A;  2EHT A;  4IZ6 A;  2KOS A;  2CQ8 A;  4NEO A;  2AFD A;  3LMO A;  5CZD B;  2K2Q A;  2FAC A;  1OR5 A;  2AFE A;  5KP7 B;  2KGA A;  3EJD A;  2MF4 A;  2LL8 A;  2AVA A;  1VKU A;  2JGP A;  4MRT C;  2KOO A;  2LKI A;  3NY7 B;  2L9F A;  1T8K A;  2CNR A;  2MVU A;  2EHS A;  2KGC A;  2N5H A;  4H2Y C;  2CGQ A;  2LIW A;  2FVA A;  2JU1 A;  2N6Z A;  4PWV B;  4HKG A;  2MD9 A;  2VSQ A;  2FAE A;  4PXH B;  2KG8 A;  2MR8 A;  2LOL A;  2LTE A;  4R0M A;  2FQ2 A;  2ROQ A;  2KGD A;  2KGE A;  2FVF A;  2K94 A;  1HQB A;  2K92 A;  2MR7 A;  1HY8 A;  2K93 A;  5KP6 B;  3CE7 A;  2KOR A;  1DNY A;  2L4B A;  5HVC A;  2GDY A;  2XZ1 C;  2N50 A;  3GZL A;  2KOP A;  2LML A;  2GDX A;  2M5R A;  2KW2 A;  2KG9 A;  2FVE A;  2KWL A;  2PNG A;  1X3O A;  2KG6 A;  2DNW A;  3GZM A;  5EJD A;  4H2X C;  2JU2 A;  1AF8 A;  3EJB A;  2L22 A;  1L0I A;  2GDW A;  4BPG A;  2KR5 A;  2X2B A; 
#chains in the Genus database with same CATH topology
 1L0H A;  2EG5 A;  5KP8 B;  1M6E X;  3CCJ P;  2NO8 A;  1EMV A;  2XZ0 D;  3DPH A;  2FAD A;  3CC4 P;  4U0B A;  5HV8 A;  2LIU A;  4CA3 A;  2K0X A;  3CME P;  1AUM A;  1YHQ P;  3DS2 A;  3G6E P;  1IMQ A;  2N98 A;  2VLN A;  3B5I A;  3WBH A;  4COC A;  2AFE A;  2KGA A;  2E1M A;  2XXM A;  3EJD A;  3CC7 P;  2JGP A;  4MRT C;  1QVG O;  1S72 P;  2MVU A;  2VLP A;  2ERH A;  2MD9 A;  2VSQ A;  4QNB A;  2FAE A;  1VQO P;  4PXH B;  2KG8 A;  3CCR P;  2LOL A;  4R0M A;  1YJN P;  2FVF A;  4F37 A;  1Q86 Q;  4U0D A;  1D1D A;  2ONT A;  2K92 A;  1QVF O;  4XFZ A;  5HVC A;  1VQ7 P;  1EIA A;  3CD6 P;  1KQS O;  3CXC O;  2FVE A;  2PNG A;  3HZQ A;  2PEM A;  3G4S P;  5F2K A;  4U0C A;  1RNI A;  2L22 A;  2PEQ A;  2BUO A;  1DV5 A;  2N6Y A;  4BPF A;  3U43 A;  1VQ4 P;  2MVV A;  3H47 A;  3GKL C;  3DS1 A;  1YJ9 P;  2JQ4 A;  2CG5 B;  2Z45 A;  2FQ0 A;  4XRQ A;  4IPY A;  4BPH A;  2AF8 A;  2LPK A;  2EHT A;  1M1K Q;  2GZJ A;  2PEI A;  1W2B O;  1AYI A;  4IZ6 A;  3G0V A;  3I56 P;  4XRO A;  2Z44 A;  5HGL A;  2GZG A;  3CCV P;  1QRJ A;  2GZF A;  2AVA A;  4UHP B;  2KOO A;  1K9M Q;  1GPJ A;  1IMP A;  3NY7 B;  1EOQ A;  2CNR A;  3GJN A;  2EHS A;  2LIW A;  2JU1 A;  1RO0 A;  4HKG A;  4XFY A;  1M74 A;  3H4E A;  3CCM P;  2LTE A;  5HGO A;  5I4T G;  2KGE A;  2K94 A;  3B4Q A;  1VHN A;  5KP6 B;  5EW5 E;  2GYK A;  2JYL A;  2L4B A;  2JBG A;  1E6J P;  2GDY A;  3RG6 C;  2XZ1 C;  1YIJ P;  2N50 A;  1NJI Q;  2LML A;  2KW2 A;  2KG9 A;  2PEJ A;  2KG6 A;  1YI2 P;  2DNW A;  5EJD A;  2K0D X;  5F2N A;  2XT1 A;  4BPG A;  3G21 A;  2X2B A;  3G26 A;  2KOQ A;  2MY5 A;  3DS3 A;  3MGE A;  2QA4 P;  2OAR A;  2JO0 A;  2GZE A;  3RG2 A;  3CC2 P;  3CCQ P;  3CCL P;  1A43 A;  1UNK A;  2FQ1 A;  3EJE A;  3NTE A;  4DG9 A;  2BHV A;  3DS4 A;  1NQ4 A;  2JAZ A;  3CPW O;  2OTL P;  3H0D A;  4XFX A;  2KOS A;  1K8A Q;  2CWO A;  3LMO A;  5CZD B;  2K2Q A;  5KP7 B;  1VQK P;  2K5X A;  2P9X A;  1VKU A;  2QEX P;  2OTJ P;  2VLO A;  2LKI A;  3OW2 O;  2L9F A;  4H2Y C;  1YJW P;  1RO2 A;  2FVA A;  4PWV B;  1UJZ A;  3M1M A;  4GR6 A;  1GXH A;  3CCE P;  3G29 A;  2PEN A;  1FR2 A;  1HQB A;  4PH1 A;  3P05 A;  2MR7 A;  1HY8 A;  2K93 A;  2GZI A;  2KOR A;  1VQM P;  2PEK A;  5BS1 A;  1N8R Q;  1BXI A;  2EFJ A;  3GZL A;  2KOP A;  1Q81 Q;  1A8O A;  2M8L A;  3CMA P;  2GDX A;  7CEI A;  2M5R A;  1KC8 Q;  1X3O A;  3GZM A;  1AF8 A;  1IUQ A;  3EJB A;  2KR5 A;  4U0E A;  1VQ8 P;  2K0Y A;  2QNW A;  1ACP A;  1VQ5 P;  2M8N A;  2FHS C;  3DTJ A;  3G1I A;  5HGM A;  2M8P A;  1M90 Q;  1VQP P;  2JYG A;  4H2W C;  5BS2 A;  2PEO A;  2EIA A;  1KLP A;  1K73 Q;  2L0Q A;  3VRL C;  4WYM A;  1F80 D;  4U0A A;  5JPA A;  1ZMB A;  1ZNV A;  3CCU P;  2N5I A;  4COP A;  1MZ8 A;  4NEO A;  2CQ8 A;  2AFD A;  1CEI A;  1M6N A;  2FAC A;  3G1G A;  1VQL P;  1OR5 A;  3Q20 A;  1VQN P;  2MF4 A;  2LL8 A;  2WPT A;  3G71 P;  2PY8 A;  1E0H A;  1BAJ A;  1T8K A;  2N5H A;  2KGC A;  2CGQ A;  4GR2 A;  1VQ9 P;  3LRY A;  2N6Z A;  3DS5 A;  3E2D A;  1Q7Y Q;  1VQ6 P;  2MR8 A;  4U0F A;  1KD1 Q;  1Z6M A;  1Q82 Q;  3G28 A;  1YIT P;  2FQ2 A;  2ROQ A;  2KOD A;  5F2O A;  5HGN A;  2KGD A;  1JJ2 O;  4QKO A;  5DCK A;  2L6E A;  2Z46 A;  3CE7 A;  3CCS P;  1K30 A;  2VLQ A;  1DNY A;  2DGY A;  4PH0 A;  2JB0 A;  3DS0 A;  1GXG A;  2KWL A;  2XV6 A;  4H2X C;  2JU2 A;  3I55 P;  3HYB A;  4M0I A;  1L0I A;  2GDW A;  2LF4 A; 
#chains in the Genus database with same CATH homology
 1L0H A;  5KP8 B;  1DV5 A;  2N6Y A;  2K0Y A;  2QNW A;  2KOQ A;  1ACP A;  4BPF A;  2FHS C;  2MY5 A;  2XZ0 D;  2FAD A;  2MVV A;  5HV8 A;  2LIU A;  4H2W C;  4CA3 A;  3RG2 A;  2K0X A;  2JQ4 A;  2CG5 B;  2FQ1 A;  3EJE A;  1KLP A;  2FQ0 A;  4DG9 A;  2L0Q A;  1F80 D;  4BPH A;  2AF8 A;  2LPK A;  2N98 A;  2N5I A;  1NQ4 A;  2EHT A;  4IZ6 A;  2KOS A;  2CQ8 A;  4NEO A;  2AFD A;  3LMO A;  5CZD B;  2K2Q A;  2FAC A;  1OR5 A;  2AFE A;  5KP7 B;  2KGA A;  3EJD A;  2MF4 A;  2LL8 A;  2AVA A;  1VKU A;  2JGP A;  4MRT C;  2KOO A;  2LKI A;  3NY7 B;  2L9F A;  1T8K A;  2CNR A;  2MVU A;  2EHS A;  2KGC A;  2N5H A;  4H2Y C;  2CGQ A;  2LIW A;  2FVA A;  2JU1 A;  2N6Z A;  4PWV B;  4HKG A;  2MD9 A;  2VSQ A;  2FAE A;  4PXH B;  2KG8 A;  2MR8 A;  2LOL A;  2LTE A;  4R0M A;  2FQ2 A;  2ROQ A;  2KGD A;  2KGE A;  2FVF A;  2K94 A;  1HQB A;  2K92 A;  2MR7 A;  1HY8 A;  2K93 A;  5KP6 B;  3CE7 A;  2KOR A;  1DNY A;  2L4B A;  5HVC A;  2GDY A;  2XZ1 C;  2N50 A;  3GZL A;  2KOP A;  2LML A;  2GDX A;  2M5R A;  2KW2 A;  2KG9 A;  2FVE A;  2KWL A;  2PNG A;  1X3O A;  2KG6 A;  2DNW A;  3GZM A;  5EJD A;  4H2X C;  2JU2 A;  1AF8 A;  3EJB A;  2L22 A;  1L0I A;  2GDW A;  4BPG A;  2KR5 A;  2X2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...