2LPVA

Solution structure of fkbp12 from aedes aegypti
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Solution structure of FK506-binding protein 12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lpvA00
2FKEA 4IQ2A 4QIBA 2ZQTA 3GPKA 4ODPA 4DT4A 4DZ3A 1Q1CA 1NSGA 1ROTA 2Q5AA 2XPBA 4FN2A 5D75A 3IK8A 4DROA 3IKGA 4DRQA 4NNRA 2PPNA 3OOBA 2MF9A 1FKLA 3IKDA 3NI6A 1JVWA 2OFNA 3I6CA 3KAIA 2M08A 2RURA 4DRIA 2M2AA 1P5QA 4IPXA 4LAYA 1L1PA 2L2SA 2MNTA 2MLYA 4MSPA 3UF8A 2Y78A 1QZ2A 2IF4A 4N19A 4BF8A 1PBKA 1NMVA 1ROUA 4DRJA 1B6CA 4ODRA 4TYOA 1ZK6A 4LAVA 5HW8A 2PBCA 2UZ5A 2ZR6A 3UQAA 2D9FA 1EYMA 1PINA 4ITZA 3NTPA 3O5QA 1D7HA 2ZQVA 3TC5A 1D6OA 3O5JA 4O2TA 2LJ4A 2XP6A 1FKRA 1HXVA 1KT1A 3O5IA 5HT1A 2F2DA 2LKNA 4ODNA 1KT0A 2RQSA 1D7JA 3UQIA 1FKHA 1QPFA 1Q6UA 1FKJA 2MPHA 5BXJA 3KAHA 2KGJA 2XP8A 3O5EA 4ODQA 2MLZA 2XPAA 2XP7A 5DITA 3VAWA 5HTGA 2VCDA 1C9HA 4GIVA 5DIUA 3UI5A 2PV1A 2RUCA 4ODMA 5HUAA 1J6YA 3O5FA 2RUDA 2XP5A 2KO7A 4JFJA 1BL4A 4JFMA 4TW7A 2KR7A 5GPGA 4DRNA 1YW5A 1T11A 4U85A 4G2PA 2N87A 3TDBA 1Q6HA 2K8IA 2KI3A 3KABA 3PRDA 1M5YA 3O5OA 5HWBA 3KAGA 1FKGA 1FKDA 1A7XA 3O5GA 3O5DA 4DIPA 4QT3A 3O5LA 5HKGA 3O5RA 4TX0A 4W9OA 1FKFA 2LPVA 3O5PA 3PA7A 4LAWA 1Y0OA 4JFKA 1FKSA 1BKFA 1FD9A 2RSEA 1R9HA 4MGVA 3KZ7A 1FKTA 1J4RA 3ODKA 4DRKA 1N1AA 4C02B 2VN1A 1JNSA 3O5KA 2PPPA 3KACA 3PRBA 3NRKA 1U79A 1W26A 2PV2A 3JXVA 4JFLA 3RGCA 4TW6A 4TNSA 1F40A 2ZQSA 3MDYB 3RFWA 2XP9A 2M1IA 3TCZA 3UI4A 3LUOA 3WH0A 5HWCA 3CGNA 3JYJA 2DG9A 1FAPA 4J4OA 2ZR4A 4W9QA 2ITKA 2F21A 1D7IA 4DRMA 2PV3A 5J6EA 3B7XA 2KE0A 4QT2A 1FJDA 2KFWA 3H9RB 2JZVA 4LAXA 4J4NA 1YATA 1FKIA 4DRPA 4DZ2A 5HW7A 4IQCA 2FAPA 4R0XA 2ZR5A 4ODOA 3CGMA 2AWGA 2XP4A 4TW8A 1J4IA 2DG4A 3KCEA 4DRHA 5HW6A 1FKBA 1EQ3A 1JNTA 1QPLA 2MLXA 1NMWA 2PPOA 2RUQA 4G50A 4ODLA 2F4EA 2ZQUA 4U86A 1J4HA 4GGQA 3KAFA 4FAPA 5I98A 2LGOA 1F8AB 1Q6IA 2XP3A 1TCOC 4JYSA 4ODKA 4W9PA 3FAPA 5DIVA 1FKKA 1ZCNA 4U84A 5B8IC 3UQBA 2DG3A 3IHZA 3EY6A 3JYMA 3KADA 4JFIA 3O5MA 4DH0A 3UI6A
chains in the Genus database with same CATH superfamily
2FKEA 2DSVA 1Q1CA 4MAVA 2XPBA 4FN2A 4MTVA 4NZCA 3IKGA 4DWSC 3AS0A 1FKLA 3W4RA 2OFNA 2RURA 2M2AA 1QZ2A 1HKMA 3CHEA 3B9AA 2WLZA 3CHFA 1NMVA 1ROUA 3WD3A 2PN0A 4L72B 1JCHB 3AS1A 2LKNA 1GPFA 1NWRA 5JH8A 1FKHA 1FKJA 3ARWA 4Z2JA 3O5EA 3ALFA 5DIUA 2QF8A 4ODMA 2XP5A 2DT2A 2KO7A 4JFJA 3PR9A 4TW7A 4DRNA 1EIBA 1GRJA 2DT1A 2YBTA 4G2PA 2N87A 5HWBA 3KABA 4KQZA 1OGGA 1FKGA 2OLHA 5DF0A 3GU0A 1ZBVA 3FY1A 4W9OA 1NWUA 2LPVA 1O6IA 1BKFA 2O9OA 4MGVA 1FKTA 4C02B 3KACA 3PRBA 2PV2A 3JXVA 1D2KA 4Z2IA 1HKJA 3AS3A 1H0GA 2FDMA 2XP9A 3JYJA 2O92A 2ZR4A 2F21A 1FFRA 1D7IA 4QT2A 1JNDA 3H9RB 4LGXA 4LAXA 3CHCA 1W1TA 1RD6A 1YATA 3ALGA 4HBOA 1FKIA 4MNKA 5HW7A 3ARUA 4IQCA 4R0XA 4TW8A 4DRHA 1FKBA 3FXYA 1TFVA 2ZQUA 3B9DA 4ZPVR 1JNEA 1F8AB 3RM4A 4ODKA 5GQBA 4JFIA 3JYMA 4ODLA 4IQ2A 4QIBA 3GPKA 1IX5A 4DZ3A 1NSGA 4DROA 1LJYA 2PPNA 1SR0A 1JVWA 4DRIA 2M08A 1WB0A 1L1PA 2G41A 2L2SA 2MNTA 4MSPA 5DEZA 3UF8A 3AROA 1E6ZA 1WNOA 2WK2A 4AY1A 4BF8A 4P8XA 1B6CA 2IUZA 4TYOA 4WIWA 1ZK6A 5HW8A 1ZB5A 2ZR6A 3ARYA 1EYMA 4Z2HA 4P8WA 1W9VA 4URIA 1WAWA 4O2TA 5DO2A 1HXVA 2RQSA 3UQIA 1LL7A 1Q6UA 1H0IA 2KGJA 2XP7A 3VAWA 2VCDA 4Z2LA 3UI5A 2PV1A 1J6YA 2EULA 4HARA 2RUDA 4JFMA 1T11A 1GUVA 4U85A 1E6PA 4IT6A 3PRDA 1M5YA 3O5OA 3KAGA 1A7XA 1W1YA 3O5GA 3O5DA 4QT3A 3O5LA 3WKZA 3O5RA 4TX0A 1FKFA 3O5PA 3PA7A 3WQWA 4JFKA 1LL4A 1W9PA 1FD9A 1LG1A 1R9HA 1VF8A 3KZ7A 3O5KA 2PPPA 3BMBA 4L3NA 3NRKA 4WKAA 4TNSA 1SYTA 4ZPTR 4HBEA 2M1IA 3TCZA 5HWCA 3WH0A 1OWQA 1FAPA 4QZVB 4DRMA 5J6EA 1W9UA 3B7XA 2KE0A 1FJDA 3EIPA 2WLYA 1E9LA 4Q7NA 3WQVA 5HW6A 1QPLA 1ZBWA 1NMWA 2PPOA 2F4EA 4U86A 4GGQA 5I98A 3OA5A 3QOKA 4DWSB 5DIVA 1FKKA 4U84A 2DG3A 3IHZA 3EY6A 4UDMA 1HJWA 4DT4A 2ZQTA 1FFQA 4NNRA 3OOBA 3IKDA 3WL1A 3KAIA 3I6CA 4R5EA 1P5QA 3RM9A 2Y78A 2IF4A 4N19A 1UR8A 3AS2A 1PBKA 3ARQA 4DRJA 3GTYX 4DWSD 4MPKA 4LAVA 2D9FA 1PINA 4ITZA 2G8ZA 4WKFA 4Q22A 3NTPA 3O5QA 1K9TA 1ZBCA 1FKRA 3B8SA 2XP6A 3CZ8A 5HT1A 3O5IA 2F2DA 4ODNA 1D7JA 1QPFA 2B31A 2MPHA 2XP8A 3ARTA 5DITA 1C9HA 4GIVA 2DT0A 2RUCA 1ZBKA 1BL4A 3ARSA 2DSUA 2KR7A 5GPGA 1X6NA 4W5UA 1YW5A 1GOIA 3CH9A 3TDBA 2K8IA 1FKDA 3WD0A 5HKGA 1UR9A 4S3JA 1Y0OA 5HBFA 1EHNA 2RSEA 3ODKA 4JFLA 3RM8A 3RGCA 4KR0B 1F40A 2ZQSA 3PRAA 1E6NA 3LUOA 3RMEA 3CGNA 1HKKA 1E6RA 2ITKA 2PV3A 2DT3A 2JZVA 1KFWA 3G6LA 4DRPA 4WKHA 2FAPA 2ZR5A 3CGMA 1EQ3A 2DG4A 3KCEA 4ZS6A 1JNTA 2MLXA 4G50A 2RUQA 3KAFA 4MNLA 2LGOA 2AOSA 1Q6IA 2XP3A 3WD1A 4JYSA 1ZCNA 5B8IC 2DPEA 1HJVA 3O5MA 3WD4A 1XRVA 1LL6A 3WL0A 4DH0A 4ODPA 4P8UA 4MNJA 1ROTA 2Q5AA 5D75A 3IK8A 4DRQA 3CHDA 2A3CA 2MF9A 3NI6A 2B5UB 3B9EA 3WD2A 4LAYA 4IPXA 1W1VA 2MLYA 1ITXA 1W1PA 3WIJA 1HKIA 4PTMA 4WJXA 4ODRA 2PBCA 2UZ5A 4ZPWR 3UQAA 1D7HA 2ZQVA 5GPRA 1D6OA 3O5JA 1HJXA 2A3BA 2LJ4A 3TC5A 1KT1A 4NSBA 1E44A 1KT0A 3ARPA 5BXJA 3KAHA 4ODQA 2MLZA 2XPAA 1XHGA 5HTGA 2DSWA 1EDQA 5HUAA 1LQ0A 3O5FA 4XAKA 4Z2GA 2PI6A 3AQUA 1CTNA 1Q6HA 2A3EA 2KI3A 1ZL1A 4DIPA 2WM0A 3ARXA 1NWSA 2ETNA 4LAWA 4IT4A 1FKSA 4MNMA 1J4RA 4DRKA 1N1AA 2VN1A 1JNSA 3ARVA 3BXWA 3G6MA 4DWSA 4S3KA 1LG2A 1U79A 1W26A 4P8VA 4TW6A 3MDYB 3RFWA 2DSZA 2F23A 3UI4A 1E15A 1X6LA 2DG9A 4J4OA 2P4VA 4W9QA 2KFWA 1ZU8A 2ESCA 1NWTA 4J4NA 4WK9A 4ML4A 3ARRA 4DZ2A 4ODOA 2AWGA 2XP4A 1J4IA 4Z2KA 1J4HA 4FAPA 2YBUA 1TCOC 4W9PA 3FAPA 1NH6A 1OGBA 3KADA 3UQBA 2A3AA 3ARZA 3UI6A
chains in the Genus database with same CATH topology
2FKEA 2DSVA 1Q1CA 4MAVA 2XPBA 4FN2A 4MTVA 4NZCA 3IKGA 4DWSC 3AS0A 1FKLA 3W4RA 2OFNA 2RURA 2M2AA 1QZ2A 1HKMA 3CHEA 3B9AA 2WLZA 3CHFA 1NMVA 1ROUA 3WD3A 4L72B 3AS1A 2LKNA 1GPFA 1NWRA 5JH8A 1FKHA 1FKJA 3ARWA 4Z2JA 3O5EA 3ALFA 5DIUA 2QF8A 4ODMA 2XP5A 2DT2A 2KO7A 4JFJA 3PR9A 4TW7A 4DRNA 1EIBA 2DT1A 2YBTA 4G2PA 2N87A 5HWBA 3KABA 4KQZA 1OGGA 1FKGA 2OLHA 5DF0A 1ZBVA 3FY1A 4W9OA 1NWUA 2LPVA 1O6IA 1BKFA 2O9OA 4MGVA 1FKTA 4C02B 3KACA 3PRBA 2PV2A 3JXVA 1D2KA 4Z2IA 1HKJA 3AS3A 1H0GA 2FDMA 2XP9A 3JYJA 2O92A 2ZR4A 2F21A 1FFRA 1D7IA 4QT2A 1JNDA 3H9RB 4LGXA 4LAXA 3CHCA 1W1TA 1RD6A 1YATA 3ALGA 4HBOA 1FKIA 4MNKA 5HW7A 3ARUA 4IQCA 4R0XA 4TW8A 4DRHA 1FKBA 3FXYA 1TFVA 2ZQUA 3B9DA 4ZPVR 1JNEA 1F8AB 3RM4A 4ODKA 5GQBA 4JFIA 3JYMA 4ODLA 4IQ2A 4QIBA 3GPKA 1IX5A 4DZ3A 1NSGA 4DROA 1LJYA 2PPNA 1SR0A 1JVWA 4DRIA 2M08A 1WB0A 1L1PA 2G41A 2L2SA 2MNTA 4MSPA 5DEZA 3UF8A 3AROA 1E6ZA 1WNOA 2WK2A 4AY1A 4BF8A 4P8XA 1B6CA 2IUZA 4TYOA 4WIWA 1ZK6A 5HW8A 1ZB5A 2ZR6A 3ARYA 1EYMA 4Z2HA 4P8WA 1W9VA 4URIA 1WAWA 4O2TA 5DO2A 1HXVA 2RQSA 3UQIA 1LL7A 1Q6UA 1H0IA 2KGJA 2XP7A 3VAWA 2VCDA 4Z2LA 3UI5A 2PV1A 1J6YA 4HARA 2RUDA 4JFMA 1T11A 1GUVA 4U85A 1E6PA 4IT6A 3PRDA 1M5YA 3O5OA 3KAGA 1A7XA 1W1YA 3O5GA 3O5DA 4QT3A 3O5LA 3WKZA 3O5RA 4TX0A 1FKFA 3O5PA 3PA7A 3WQWA 4JFKA 1LL4A 1W9PA 1FD9A 1LG1A 1R9HA 1VF8A 3KZ7A 3O5KA 2PPPA 4L3NA 3NRKA 4WKAA 4TNSA 1SYTA 4ZPTR 4HBEA 2M1IA 3TCZA 5HWCA 3WH0A 1OWQA 1FAPA 4QZVB 4DRMA 5J6EA 1W9UA 3B7XA 2KE0A 1FJDA 2WLYA 1E9LA 4Q7NA 3WQVA 5HW6A 1QPLA 1ZBWA 1NMWA 2PPOA 2F4EA 4U86A 4GGQA 5I98A 3OA5A 3QOKA 4DWSB 5DIVA 1FKKA 4U84A 2DG3A 3IHZA 3EY6A 1HJWA 4DT4A 2ZQTA 1FFQA 4NNRA 3OOBA 3IKDA 3WL1A 3KAIA 3I6CA 4R5EA 1P5QA 3RM9A 2Y78A 2IF4A 4N19A 1UR8A 3AS2A 1PBKA 3ARQA 4DRJA 4DWSD 4MPKA 4LAVA 2D9FA 1PINA 4ITZA 2G8ZA 4WKFA 4Q22A 3NTPA 3O5QA 1K9TA 1ZBCA 1FKRA 3B8SA 2XP6A 3CZ8A 5HT1A 3O5IA 2F2DA 4ODNA 1D7JA 1QPFA 2B31A 2MPHA 2XP8A 3ARTA 5DITA 1C9HA 4GIVA 2DT0A 2RUCA 1ZBKA 1BL4A 3ARSA 2DSUA 2KR7A 5GPGA 1X6NA 4W5UA 1YW5A 1GOIA 3CH9A 3TDBA 2K8IA 1FKDA 3WD0A 5HKGA 1UR9A 4S3JA 1Y0OA 5HBFA 1EHNA 2RSEA 3ODKA 4JFLA 3RM8A 3RGCA 4KR0B 1F40A 2ZQSA 3PRAA 1E6NA 3LUOA 3RMEA 3CGNA 1HKKA 1E6RA 2ITKA 2PV3A 2DT3A 2JZVA 1KFWA 3G6LA 4DRPA 4WKHA 2FAPA 2ZR5A 3CGMA 1EQ3A 2DG4A 3KCEA 4ZS6A 1JNTA 2MLXA 4G50A 2RUQA 3KAFA 4MNLA 2LGOA 2AOSA 1Q6IA 2XP3A 3WD1A 4JYSA 1ZCNA 5B8IC 2DPEA 3O5MA 1HJVA 3WD4A 1XRVA 1LL6A 3WL0A 4DH0A 4ODPA 4P8UA 4MNJA 1ROTA 2Q5AA 5D75A 3IK8A 4DRQA 3CHDA 2A3CA 2MF9A 3NI6A 3B9EA 3WD2A 4LAYA 4IPXA 1W1VA 2MLYA 1ITXA 1W1PA 3WIJA 1HKIA 4PTMA 4WJXA 4ODRA 2PBCA 2UZ5A 4ZPWR 3UQAA 1D7HA 2ZQVA 5GPRA 1D6OA 3O5JA 1HJXA 2A3BA 2LJ4A 3TC5A 1KT1A 4NSBA 1KT0A 3ARPA 5BXJA 3KAHA 4ODQA 2MLZA 2XPAA 1XHGA 5HTGA 2DSWA 1EDQA 5HUAA 1LQ0A 3O5FA 4XAKA 4Z2GA 2PI6A 3AQUA 1CTNA 1Q6HA 2A3EA 2KI3A 1ZL1A 4DIPA 2WM0A 3ARXA 1NWSA 4LAWA 4IT4A 1FKSA 4MNMA 1J4RA 4DRKA 1N1AA 2VN1A 1JNSA 3ARVA 3BXWA 3G6MA 4DWSA 4S3KA 1LG2A 1U79A 1W26A 4P8VA 4TW6A 3MDYB 3RFWA 2DSZA 3UI4A 1E15A 1X6LA 2DG9A 4J4OA 4W9QA 2KFWA 1ZU8A 2ESCA 1NWTA 4J4NA 4WK9A 4ML4A 3ARRA 4DZ2A 4ODOA 2AWGA 2XP4A 1J4IA 4Z2KA 1J4HA 4FAPA 2YBUA 1TCOC 4W9PA 3FAPA 1NH6A 1OGBA 3KADA 3UQBA 2A3AA 3ARZA 3UI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  4IQ2 A;  4QIB A;  2ZQT A;  3GPK A;  4ODP A;  4DT4 A;  4DZ3 A;  1Q1C A;  1NSG A;  1ROT A;  2Q5A A;  2XPB A;  4FN2 A;  5D75 A;  3IK8 A;  4DRO A;  3IKG A;  4DRQ A;  4NNR A;  2PPN A;  3OOB A;  2MF9 A;  1FKL A;  3IKD A;  3NI6 A;  1JVW A;  2OFN A;  3I6C A;  3KAI A;  2M08 A;  2RUR A;  4DRI A;  2M2A A;  1P5Q A;  4IPX A;  4LAY A;  1L1P A;  2L2S A;  2MNT A;  2MLY A;  4MSP A;  3UF8 A;  2Y78 A;  1QZ2 A;  2IF4 A;  4N19 A;  4BF8 A;  1PBK A;  1NMV A;  1ROU A;  4DRJ A;  1B6C A;  4ODR A;  4TYO A;  1ZK6 A;  4LAV A;  5HW8 A;  2PBC A;  2UZ5 A;  2ZR6 A;  3UQA A;  2D9F A;  1EYM A;  1PIN A;  4ITZ A;  3NTP A;  3O5Q A;  1D7H A;  2ZQV A;  3TC5 A;  1D6O A;  3O5J A;  4O2T A;  2LJ4 A;  2XP6 A;  1FKR A;  1HXV A;  1KT1 A;  3O5I A;  5HT1 A;  2F2D A;  2LKN A;  4ODN A;  1KT0 A;  2RQS A;  1D7J A;  3UQI A;  1FKH A;  1QPF A;  1Q6U A;  1FKJ A;  2MPH A;  5BXJ A;  3KAH A;  2KGJ A;  2XP8 A;  3O5E A;  4ODQ A;  2MLZ A;  2XPA A;  2XP7 A;  5DIT A;  3VAW A;  5HTG A;  2VCD A;  1C9H A;  4GIV A;  5DIU A;  3UI5 A;  2PV1 A;  2RUC A;  4ODM A;  5HUA A;  1J6Y A;  3O5F A;  2RUD A;  2XP5 A;  2KO7 A;  4JFJ A;  1BL4 A;  4JFM A;  4TW7 A;  2KR7 A;  5GPG A;  4DRN A;  1YW5 A;  1T11 A;  4U85 A;  4G2P A;  2N87 A;  3TDB A;  1Q6H A;  2K8I A;  2KI3 A;  3KAB A;  3PRD A;  1M5Y A;  3O5O A;  5HWB A;  3KAG A;  1FKG A;  1FKD A;  1A7X A;  3O5G A;  3O5D A;  4DIP A;  4QT3 A;  3O5L A;  5HKG A;  3O5R A;  4TX0 A;  4W9O A;  1FKF A;  2LPV A;  3O5P A;  3PA7 A;  4LAW A;  1Y0O A;  4JFK A;  1FKS A;  1BKF A;  1FD9 A;  2RSE A;  1R9H A;  4MGV A;  3KZ7 A;  1FKT A;  1J4R A;  3ODK A;  4DRK A;  1N1A A;  4C02 B;  2VN1 A;  1JNS A;  3O5K A;  2PPP A;  3KAC A;  3PRB A;  3NRK A;  1U79 A;  1W26 A;  2PV2 A;  3JXV A;  4JFL A;  3RGC A;  4TW6 A;  4TNS A;  1F40 A;  2ZQS A;  3MDY B;  3RFW A;  2XP9 A;  2M1I A;  3TCZ A;  3UI4 A;  3LUO A;  3WH0 A;  5HWC A;  3CGN A;  3JYJ A;  2DG9 A;  1FAP A;  4J4O A;  2ZR4 A;  4W9Q A;  2ITK A;  2F21 A;  1D7I A;  4DRM A;  2PV3 A;  5J6E A;  3B7X A;  2KE0 A;  4QT2 A;  1FJD A;  2KFW A;  3H9R B;  2JZV A;  4LAX A;  4J4N A;  1YAT A;  1FKI A;  4DRP A;  4DZ2 A;  5HW7 A;  4IQC A;  2FAP A;  4R0X A;  2ZR5 A;  4ODO A;  3CGM A;  2AWG A;  2XP4 A;  4TW8 A;  1J4I A;  2DG4 A;  3KCE A;  4DRH A;  5HW6 A;  1FKB A;  1EQ3 A;  1JNT A;  1QPL A;  2MLX A;  1NMW A;  2PPO A;  2RUQ A;  4G50 A;  4ODL A;  2F4E A;  2ZQU A;  4U86 A;  1J4H A;  4GGQ A;  3KAF A;  4FAP A;  5I98 A;  2LGO A;  1F8A B;  1Q6I A;  2XP3 A;  1TCO C;  4JYS A;  4ODK A;  4W9P A;  3FAP A;  5DIV A;  1FKK A;  1ZCN A;  4U84 A;  5B8I C;  3UQB A;  2DG3 A;  3IHZ A;  3EY6 A;  3JYM A;  3KAD A;  4JFI A;  3O5M A;  4DH0 A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 2FKE A;  2DSV A;  1Q1C A;  4MAV A;  2XPB A;  4FN2 A;  4MTV A;  4NZC A;  3IKG A;  4DWS C;  3AS0 A;  1FKL A;  3W4R A;  2OFN A;  2RUR A;  2M2A A;  1QZ2 A;  1HKM A;  3CHE A;  3B9A A;  2WLZ A;  3CHF A;  1NMV A;  1ROU A;  3WD3 A;  2PN0 A;  4L72 B;  1JCH B;  3AS1 A;  2LKN A;  1GPF A;  1NWR A;  5JH8 A;  1FKH A;  1FKJ A;  3ARW A;  4Z2J A;  3O5E A;  3ALF A;  5DIU A;  2QF8 A;  4ODM A;  2XP5 A;  2DT2 A;  2KO7 A;  4JFJ A;  3PR9 A;  4TW7 A;  4DRN A;  1EIB A;  1GRJ A;  2DT1 A;  2YBT A;  4G2P A;  2N87 A;  5HWB A;  3KAB A;  4KQZ A;  1OGG A;  1FKG A;  2OLH A;  5DF0 A;  3GU0 A;  1ZBV A;  3FY1 A;  4W9O A;  1NWU A;  2LPV A;  1O6I A;  1BKF A;  2O9O A;  4MGV A;  1FKT A;  4C02 B;  3KAC A;  3PRB A;  2PV2 A;  3JXV A;  1D2K A;  4Z2I A;  1HKJ A;  3AS3 A;  1H0G A;  2FDM A;  2XP9 A;  3JYJ A;  2O92 A;  2ZR4 A;  2F21 A;  1FFR A;  1D7I A;  4QT2 A;  1JND A;  3H9R B;  4LGX A;  4LAX A;  3CHC A;  1W1T A;  1RD6 A;  1YAT A;  3ALG A;  4HBO A;  1FKI A;  4MNK A;  5HW7 A;  3ARU A;  4IQC A;  4R0X A;  4TW8 A;  4DRH A;  1FKB A;  3FXY A;  1TFV A;  2ZQU A;  3B9D A;  4ZPV R;  1JNE A;  1F8A B;  3RM4 A;  4ODK A;  5GQB A;  4JFI A;  3JYM A;  4ODL A;  4IQ2 A;  4QIB A;  3GPK A;  1IX5 A;  4DZ3 A;  1NSG A;  4DRO A;  1LJY A;  2PPN A;  1SR0 A;  1JVW A;  4DRI A;  2M08 A;  1WB0 A;  1L1P A;  2G41 A;  2L2S A;  2MNT A;  4MSP A;  5DEZ A;  3UF8 A;  3ARO A;  1E6Z A;  1WNO A;  2WK2 A;  4AY1 A;  4BF8 A;  4P8X A;  1B6C A;  2IUZ A;  4TYO A;  4WIW A;  1ZK6 A;  5HW8 A;  1ZB5 A;  2ZR6 A;  3ARY A;  1EYM A;  4Z2H A;  4P8W A;  1W9V A;  4URI A;  1WAW A;  4O2T A;  5DO2 A;  1HXV A;  2RQS A;  3UQI A;  1LL7 A;  1Q6U A;  1H0I A;  2KGJ A;  2XP7 A;  3VAW A;  2VCD A;  4Z2L A;  3UI5 A;  2PV1 A;  1J6Y A;  2EUL A;  4HAR A;  2RUD A;  4JFM A;  1T11 A;  1GUV A;  4U85 A;  1E6P A;  4IT6 A;  3PRD A;  1M5Y A;  3O5O A;  3KAG A;  1A7X A;  1W1Y A;  3O5G A;  3O5D A;  4QT3 A;  3O5L A;  3WKZ A;  3O5R A;  4TX0 A;  1FKF A;  3O5P A;  3PA7 A;  3WQW A;  4JFK A;  1LL4 A;  1W9P A;  1FD9 A;  1LG1 A;  1R9H A;  1VF8 A;  3KZ7 A;  3O5K A;  2PPP A;  3BMB A;  4L3N A;  3NRK A;  4WKA A;  4TNS A;  1SYT A;  4ZPT R;  4HBE A;  2M1I A;  3TCZ A;  5HWC A;  3WH0 A;  1OWQ A;  1FAP A;  4QZV B;  4DRM A;  5J6E A;  1W9U A;  3B7X A;  2KE0 A;  1FJD A;  3EIP A;  2WLY A;  1E9L A;  4Q7N A;  3WQV A;  5HW6 A;  1QPL A;  1ZBW A;  1NMW A;  2PPO A;  2F4E A;  4U86 A;  4GGQ A;  5I98 A;  3OA5 A;  3QOK A;  4DWS B;  5DIV A;  1FKK A;  4U84 A;  2DG3 A;  3IHZ A;  3EY6 A;  4UDM A;  1HJW A;  4DT4 A;  2ZQT A;  1FFQ A;  4NNR A;  3OOB A;  3IKD A;  3WL1 A;  3KAI A;  3I6C A;  4R5E A;  1P5Q A;  3RM9 A;  2Y78 A;  2IF4 A;  4N19 A;  1UR8 A;  3AS2 A;  1PBK A;  3ARQ A;  4DRJ A;  3GTY X;  4DWS D;  4MPK A;  4LAV A;  2D9F A;  1PIN A;  4ITZ A;  2G8Z A;  4WKF A;  4Q22 A;  3NTP A;  3O5Q A;  1K9T A;  1ZBC A;  1FKR A;  3B8S A;  2XP6 A;  3CZ8 A;  5HT1 A;  3O5I A;  2F2D A;  4ODN A;  1D7J A;  1QPF A;  2B31 A;  2MPH A;  2XP8 A;  3ART A;  5DIT A;  1C9H A;  4GIV A;  2DT0 A;  2RUC A;  1ZBK A;  1BL4 A;  3ARS A;  2DSU A;  2KR7 A;  5GPG A;  1X6N A;  4W5U A;  1YW5 A;  1GOI A;  3CH9 A;  3TDB A;  2K8I A;  1FKD A;  3WD0 A;  5HKG A;  1UR9 A;  4S3J A;  1Y0O A;  5HBF A;  1EHN A;  2RSE A;  3ODK A;  4JFL A;  3RM8 A;  3RGC A;  4KR0 B;  1F40 A;  2ZQS A;  3PRA A;  1E6N A;  3LUO A;  3RME A;  3CGN A;  1HKK A;  1E6R A;  2ITK A;  2PV3 A;  2DT3 A;  2JZV A;  1KFW A;  3G6L A;  4DRP A;  4WKH A;  2FAP A;  2ZR5 A;  3CGM A;  1EQ3 A;  2DG4 A;  3KCE A;  4ZS6 A;  1JNT A;  2MLX A;  4G50 A;  2RUQ A;  3KAF A;  4MNL A;  2LGO A;  2AOS A;  1Q6I A;  2XP3 A;  3WD1 A;  4JYS A;  1ZCN A;  5B8I C;  2DPE A;  1HJV A;  3O5M A;  3WD4 A;  1XRV A;  1LL6 A;  3WL0 A;  4DH0 A;  4ODP A;  4P8U A;  4MNJ A;  1ROT A;  2Q5A A;  5D75 A;  3IK8 A;  4DRQ A;  3CHD A;  2A3C A;  2MF9 A;  3NI6 A;  2B5U B;  3B9E A;  3WD2 A;  4LAY A;  4IPX A;  1W1V A;  2MLY A;  1ITX A;  1W1P A;  3WIJ A;  1HKI A;  4PTM A;  4WJX A;  4ODR A;  2PBC A;  2UZ5 A;  4ZPW R;  3UQA A;  1D7H A;  2ZQV A;  5GPR A;  1D6O A;  3O5J A;  1HJX A;  2A3B A;  2LJ4 A;  3TC5 A;  1KT1 A;  4NSB A;  1E44 A;  1KT0 A;  3ARP A;  5BXJ A;  3KAH A;  4ODQ A;  2MLZ A;  2XPA A;  1XHG A;  5HTG A;  2DSW A;  1EDQ A;  5HUA A;  1LQ0 A;  3O5F A;  4XAK A;  4Z2G A;  2PI6 A;  3AQU A;  1CTN A;  1Q6H A;  2A3E A;  2KI3 A;  1ZL1 A;  4DIP A;  2WM0 A;  3ARX A;  1NWS A;  2ETN A;  4LAW A;  4IT4 A;  1FKS A;  4MNM A;  1J4R A;  4DRK A;  1N1A A;  2VN1 A;  1JNS A;  3ARV A;  3BXW A;  3G6M A;  4DWS A;  4S3K A;  1LG2 A;  1U79 A;  1W26 A;  4P8V A;  4TW6 A;  3MDY B;  3RFW A;  2DSZ A;  2F23 A;  3UI4 A;  1E15 A;  1X6L A;  2DG9 A;  4J4O A;  2P4V A;  4W9Q A;  2KFW A;  1ZU8 A;  2ESC A;  1NWT A;  4J4N A;  4WK9 A;  4ML4 A;  3ARR A;  4DZ2 A;  4ODO A;  2AWG A;  2XP4 A;  1J4I A;  4Z2K A;  1J4H A;  4FAP A;  2YBU A;  1TCO C;  4W9P A;  3FAP A;  1NH6 A;  1OGB A;  3KAD A;  3UQB A;  2A3A A;  3ARZ A;  3UI6 A; 
#chains in the Genus database with same CATH homology
 2FKE A;  2DSV A;  1Q1C A;  4MAV A;  2XPB A;  4FN2 A;  4MTV A;  4NZC A;  3IKG A;  4DWS C;  3AS0 A;  1FKL A;  3W4R A;  2OFN A;  2RUR A;  2M2A A;  1QZ2 A;  1HKM A;  3CHE A;  3B9A A;  2WLZ A;  3CHF A;  1NMV A;  1ROU A;  3WD3 A;  4L72 B;  3AS1 A;  2LKN A;  1GPF A;  1NWR A;  5JH8 A;  1FKH A;  1FKJ A;  3ARW A;  4Z2J A;  3O5E A;  3ALF A;  5DIU A;  2QF8 A;  4ODM A;  2XP5 A;  2DT2 A;  2KO7 A;  4JFJ A;  3PR9 A;  4TW7 A;  4DRN A;  1EIB A;  2DT1 A;  2YBT A;  4G2P A;  2N87 A;  5HWB A;  3KAB A;  4KQZ A;  1OGG A;  1FKG A;  2OLH A;  5DF0 A;  1ZBV A;  3FY1 A;  4W9O A;  1NWU A;  2LPV A;  1O6I A;  1BKF A;  2O9O A;  4MGV A;  1FKT A;  4C02 B;  3KAC A;  3PRB A;  2PV2 A;  3JXV A;  1D2K A;  4Z2I A;  1HKJ A;  3AS3 A;  1H0G A;  2FDM A;  2XP9 A;  3JYJ A;  2O92 A;  2ZR4 A;  2F21 A;  1FFR A;  1D7I A;  4QT2 A;  1JND A;  3H9R B;  4LGX A;  4LAX A;  3CHC A;  1W1T A;  1RD6 A;  1YAT A;  3ALG A;  4HBO A;  1FKI A;  4MNK A;  5HW7 A;  3ARU A;  4IQC A;  4R0X A;  4TW8 A;  4DRH A;  1FKB A;  3FXY A;  1TFV A;  2ZQU A;  3B9D A;  4ZPV R;  1JNE A;  1F8A B;  3RM4 A;  4ODK A;  5GQB A;  4JFI A;  3JYM A;  4ODL A;  4IQ2 A;  4QIB A;  3GPK A;  1IX5 A;  4DZ3 A;  1NSG A;  4DRO A;  1LJY A;  2PPN A;  1SR0 A;  1JVW A;  4DRI A;  2M08 A;  1WB0 A;  1L1P A;  2G41 A;  2L2S A;  2MNT A;  4MSP A;  5DEZ A;  3UF8 A;  3ARO A;  1E6Z A;  1WNO A;  2WK2 A;  4AY1 A;  4BF8 A;  4P8X A;  1B6C A;  2IUZ A;  4TYO A;  4WIW A;  1ZK6 A;  5HW8 A;  1ZB5 A;  2ZR6 A;  3ARY A;  1EYM A;  4Z2H A;  4P8W A;  1W9V A;  4URI A;  1WAW A;  4O2T A;  5DO2 A;  1HXV A;  2RQS A;  3UQI A;  1LL7 A;  1Q6U A;  1H0I A;  2KGJ A;  2XP7 A;  3VAW A;  2VCD A;  4Z2L A;  3UI5 A;  2PV1 A;  1J6Y A;  4HAR A;  2RUD A;  4JFM A;  1T11 A;  1GUV A;  4U85 A;  1E6P A;  4IT6 A;  3PRD A;  1M5Y A;  3O5O A;  3KAG A;  1A7X A;  1W1Y A;  3O5G A;  3O5D A;  4QT3 A;  3O5L A;  3WKZ A;  3O5R A;  4TX0 A;  1FKF A;  3O5P A;  3PA7 A;  3WQW A;  4JFK A;  1LL4 A;  1W9P A;  1FD9 A;  1LG1 A;  1R9H A;  1VF8 A;  3KZ7 A;  3O5K A;  2PPP A;  4L3N A;  3NRK A;  4WKA A;  4TNS A;  1SYT A;  4ZPT R;  4HBE A;  2M1I A;  3TCZ A;  5HWC A;  3WH0 A;  1OWQ A;  1FAP A;  4QZV B;  4DRM A;  5J6E A;  1W9U A;  3B7X A;  2KE0 A;  1FJD A;  2WLY A;  1E9L A;  4Q7N A;  3WQV A;  5HW6 A;  1QPL A;  1ZBW A;  1NMW A;  2PPO A;  2F4E A;  4U86 A;  4GGQ A;  5I98 A;  3OA5 A;  3QOK A;  4DWS B;  5DIV A;  1FKK A;  4U84 A;  2DG3 A;  3IHZ A;  3EY6 A;  1HJW A;  4DT4 A;  2ZQT A;  1FFQ A;  4NNR A;  3OOB A;  3IKD A;  3WL1 A;  3KAI A;  3I6C A;  4R5E A;  1P5Q A;  3RM9 A;  2Y78 A;  2IF4 A;  4N19 A;  1UR8 A;  3AS2 A;  1PBK A;  3ARQ A;  4DRJ A;  4DWS D;  4MPK A;  4LAV A;  2D9F A;  1PIN A;  4ITZ A;  2G8Z A;  4WKF A;  4Q22 A;  3NTP A;  3O5Q A;  1K9T A;  1ZBC A;  1FKR A;  3B8S A;  2XP6 A;  3CZ8 A;  5HT1 A;  3O5I A;  2F2D A;  4ODN A;  1D7J A;  1QPF A;  2B31 A;  2MPH A;  2XP8 A;  3ART A;  5DIT A;  1C9H A;  4GIV A;  2DT0 A;  2RUC A;  1ZBK A;  1BL4 A;  3ARS A;  2DSU A;  2KR7 A;  5GPG A;  1X6N A;  4W5U A;  1YW5 A;  1GOI A;  3CH9 A;  3TDB A;  2K8I A;  1FKD A;  3WD0 A;  5HKG A;  1UR9 A;  4S3J A;  1Y0O A;  5HBF A;  1EHN A;  2RSE A;  3ODK A;  4JFL A;  3RM8 A;  3RGC A;  4KR0 B;  1F40 A;  2ZQS A;  3PRA A;  1E6N A;  3LUO A;  3RME A;  3CGN A;  1HKK A;  1E6R A;  2ITK A;  2PV3 A;  2DT3 A;  2JZV A;  1KFW A;  3G6L A;  4DRP A;  4WKH A;  2FAP A;  2ZR5 A;  3CGM A;  1EQ3 A;  2DG4 A;  3KCE A;  4ZS6 A;  1JNT A;  2MLX A;  4G50 A;  2RUQ A;  3KAF A;  4MNL A;  2LGO A;  2AOS A;  1Q6I A;  2XP3 A;  3WD1 A;  4JYS A;  1ZCN A;  5B8I C;  2DPE A;  3O5M A;  1HJV A;  3WD4 A;  1XRV A;  1LL6 A;  3WL0 A;  4DH0 A;  4ODP A;  4P8U A;  4MNJ A;  1ROT A;  2Q5A A;  5D75 A;  3IK8 A;  4DRQ A;  3CHD A;  2A3C A;  2MF9 A;  3NI6 A;  3B9E A;  3WD2 A;  4LAY A;  4IPX A;  1W1V A;  2MLY A;  1ITX A;  1W1P A;  3WIJ A;  1HKI A;  4PTM A;  4WJX A;  4ODR A;  2PBC A;  2UZ5 A;  4ZPW R;  3UQA A;  1D7H A;  2ZQV A;  5GPR A;  1D6O A;  3O5J A;  1HJX A;  2A3B A;  2LJ4 A;  3TC5 A;  1KT1 A;  4NSB A;  1KT0 A;  3ARP A;  5BXJ A;  3KAH A;  4ODQ A;  2MLZ A;  2XPA A;  1XHG A;  5HTG A;  2DSW A;  1EDQ A;  5HUA A;  1LQ0 A;  3O5F A;  4XAK A;  4Z2G A;  2PI6 A;  3AQU A;  1CTN A;  1Q6H A;  2A3E A;  2KI3 A;  1ZL1 A;  4DIP A;  2WM0 A;  3ARX A;  1NWS A;  4LAW A;  4IT4 A;  1FKS A;  4MNM A;  1J4R A;  4DRK A;  1N1A A;  2VN1 A;  1JNS A;  3ARV A;  3BXW A;  3G6M A;  4DWS A;  4S3K A;  1LG2 A;  1U79 A;  1W26 A;  4P8V A;  4TW6 A;  3MDY B;  3RFW A;  2DSZ A;  3UI4 A;  1E15 A;  1X6L A;  2DG9 A;  4J4O A;  4W9Q A;  2KFW A;  1ZU8 A;  2ESC A;  1NWT A;  4J4N A;  4WK9 A;  4ML4 A;  3ARR A;  4DZ2 A;  4ODO A;  2AWG A;  2XP4 A;  1J4I A;  4Z2K A;  1J4H A;  4FAP A;  2YBU A;  1TCO C;  4W9P A;  3FAP A;  1NH6 A;  1OGB A;  3KAD A;  3UQB A;  2A3A A;  3ARZ A;  3UI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...