2LPVA

Solution structure of fkbp12 from aedes aegypti
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Solution structure of FK506-binding protein 12 from Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Isomerase
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lpvA00
2RSEA 4JYSA 1FKBA 1FKGA 1T11A 1R9HA 1W26A 2LGOA 1P5QA 4DZ2A 4JFKA 2RURA 2XPBA 4ODNA 2ZQSA 1NSGA 1Q6IA 2UZ5A 1Q6UA 2KGJA 2M1IA 4U85A 5I98A 4ODQA 2IF4A 4GIVA 1YATA 2N87A 4TYOA 1FKRA 1D6OA 1FKFA 3WH0A 1FKJA 3KAFA 4JFLA 2XP5A 3I6CA 2RQSA 1QPFA 4DRJA 2ZR6A 2PV2A 2L2SA 2DG9A 3IHZA 3OOBA 3O5DA 5HT1A 3JYJA 1TCOC 1FKTA 2AWGA 4DRMA 5HW7A 3O5FA 4TNSA 3UQBA 1JNSA 1M5YA 1N1AA 1D7HA 2XPAA 3KAHA 4N19A 4TW6A 1KT1A 2KR7A 3O5RA 3PRBA 1B6CA 1FD9A 4LAVA 2KE0A 3O5MA 3B7XA 1PINA 2F4EA 2ITKA 1ROTA 3ODKA 2FKEA 4DRIA 1A7XA 1JVWA 2RUDA 1C9HA 1J4IA 3O5OA 4ODPA 4ODLA 3JYMA 1KT0A 3KABA 1U79A 2FAPA 2LKNA 4W9QA 4ODOA 4IQCA 4TW7A 4DH0A 2XP3A 4MSPA 4TX0A 4DROA 5HKGA 3RFWA 3H9RB 4ODMA 3PA7A 1ZK6A 1FJDA 3TDBA 1FKHA 1J4RA 1J6YA 1Q6HA 3O5EA 3FAPA 3TCZA 2ZR5A 4MGVA 2MF9A 2KI3A 3UI4A 2VN1A 4IQ2A 3KAGA 4J4OA 3KADA 1EYMA 2ZQUA 3CGNA 3IKDA 5D75A 2F2DA 2KO7A 3TC5A 2RUCA 1D7IA 4FN2A 1PBKA 4J4NA 1FKIA 1F40A 2Q5AA 4DT4A 4FAPA 1YW5A 2LPVA 1FKDA 4JFJA 1L1PA 2MNTA 1QZ2A 3UI6A 4LAXA 3PRDA 1FKKA 2LJ4A 1Y0OA 3O5LA 4QT2A 5DITA 4ODKA 4DRNA 3O5PA 1FKSA 1ZCNA 3IK8A 3MDYB 4JFIA 4G50A 2XP9A 4IPXA 2PPNA 2XP6A 4GGQA 1JNTA 2RUQA 3NI6A 5HW6A 3RGCA 5DIUA 1J4HA 4TW8A 3O5GA 4U84A 5HTGA 4R0XA 3NRKA 2MPHA 2F21A 2OFNA 3UQIA 2XP7A 4W9OA 1F8AB 4LAWA 5BXJA 5B8IC 3IKGA 1FAPA 4G2PA 2XP4A 2M08A 4U86A 4LAYA 5HWCA 1HXVA 5HW8A 2XP8A 3UQAA 2ZQTA 2PBCA 4BF8A 3KACA 4C02B 3GPKA 2D9FA 4JFMA 2MLZA 3CGMA 2PPOA 2M2AA 4ODRA 2PV1A 4DRQA 4O2TA 3KAIA 4DIPA 2PV3A 3O5KA 3UF8A 3O5JA 2ZQVA 1BKFA 3VAWA 3UI5A 5J6EA 1D7JA 4W9PA 5HUAA 1NMWA 2PPPA 3O5QA 2KFWA 1EQ3A 3KCEA 3KZ7A 4ITZA 5HWBA 2VCDA 2MLXA 4DRPA 4DRKA 5DIVA 3NTPA 1Q1CA 1BL4A 4DZ3A 4QIBA 1NMVA 1QPLA 4NNRA 1FKLA 2DG3A 3JXVA 1ROUA 5GPGA 2DG4A 2ZR4A 3LUOA 3EY6A 4QT3A 2JZVA 2MLYA 4DRHA 2K8IA 3O5IA 2Y78A
chains in the Genus database with same CATH superfamily
4MNMA 1EDQA 1FKGA 4ML4A 1P5QA 4W5UA 1ZBKA 4ODNA 2UZ5A 4MNJA 2M1IA 4ODQA 4GIVA 3B9AA 1NWRA 4WIWA 2DG9A 3JYJA 1E15A 1TCOC 3ARUA 2AWGA 4Z2JA 5HW7A 1M5YA 4WKHA 1N1AA 4TW6A 1XHGA 1B6CA 4Z2LA 1FD9A 3CHEA 4LAVA 2O9OA 3O5MA 1OGBA 2FKEA 1JVWA 3ARTA 1C9HA 4ODPA 1W9VA 3OA5A 4DH0A 3H9RB 1ZK6A 1FJDA 3TDBA 3FAPA 3TCZA 2VN1A 4J4OA 3KADA 2ZQUA 2RUCA 1CTNA 1NWSA 3BXWA 4DT4A 1YW5A 1FKDA 4JFJA 2MNTA 1QZ2A 4LAXA 3O5LA 4QT2A 1Y0OA 3ARWA 2A3AA 4HBOA 1ZCNA 4JFIA 1H0GA 4IPXA 2XP6A 1JNTA 3NI6A 5DIUA 1OGGA 1X6LA 3NRKA 2F21A 2OLHA 3UQIA 4XAKA 3IKGA 1GUVA 5HWCA 3UQAA 4BF8A 3KACA 3AQUA 2D9FA 3CGMA 4IT4A 2M2AA 1E44A 3KAIA 1NMWA 3O5QA 2KFWA 1EQ3A 1TFVA 3G6MA 5HWBA 1HJXA 2MLXA 4DRKA 4Q7NA 4Z2KA 1NMVA 1LG1A 5DF0A 1ZBCA 5GPGA 1W9UA 3LUOA 3EY6A 2JZVA 4DRHA 1HKJA 3RMEA 3ALGA 2Y78A 3ARRA 4ODRA 3WIJA 2RSEA 3B8SA 2A3CA 1WAWA 1JNDA 2WLZA 4JFKA 2XPBA 1GRJA 4DWSA 2ZQSA 1NSGA 1Q6UA 4U85A 2N87A 4TYOA 2WK2A 3FY1A 3WH0A 3KAFA 2XP5A 3ARPA 2RQSA 2ZR6A 2L2SA 4UDMA 1JCHB 2ESCA 2G41A 2YBTA 1EHNA 3AS3A 4NSBA 1LL6A 1JNEA 2FDMA 3O5FA 1NWUA 2DSWA 1D7HA 2KR7A 3O5RA 4QZVB 4LGXA 2DT0A 2ITKA 1ROTA 2DSZA 3ARZA 1LG2A 4WKAA 1J4IA 1KT0A 4TW7A 5DO2A 5GQBA 2XP3A 4MSPA 5HKGA 4Z2HA 3AROA 1FKHA 5JH8A 1FFRA 3ARYA 4IT6A 5HBFA 2F2DA 4FN2A 1PBKA 1UR8A 1HJVA 1L1PA 3CHFA 3UI6A 1FKKA 3ARVA 4DRNA 3IK8A 4G50A 3WQVA 2RUQA 1E6PA 1NH6A 2A3BA 1F8AB 3AS2A 5B8IC 1FAPA 2PI6A 2M08A 3G6LA 4LAYA 4U86A 5HW8A 2PBCA 1W1YA 1HKIA 2PPOA 1E6NA 4DRQA 4O2TA 2DT3A 4DIPA 4AY1A 2PV3A 2G8ZA 3O5KA 2ZQVA 3VAWA 1D7JA 3WQWA 5HUAA 3GU0A 3AS1A 3KZ7A 2VCDA 1ZU8A 3NTPA 1BL4A 1OWQA 2ETNA 4WK9A 4Q22A 2ZR4A 2K8IA 3PRBA 1F40A 1E6RA 4JYSA 1FKBA 1T11A 4P8WA 1R9HA 1Q6IA 2IF4A 4R5EA 1ZB5A 1D6OA 1ZL1A 1FKFA 1FKJA 4MTVA 1W1TA 4ZPVR 1IX5A 4DRJA 1HKKA 2PV2A 3IHZA 3O5DA 3RM8A 1FKTA 3PRAA 4TNSA 4HBEA 3UQBA 1ZBVA 2XPAA 1O6IA 2F23A 1VF8A 2KE0A 3B7XA 2F4EA 1GPFA 3ODKA 4DRIA 1A7XA 3O5OA 2WLYA 3JYMA 3KABA 4W9QA 3PR9A 4TX0A 4ODMA 4NZCA 1E6ZA 1K9TA 3CZ8A 1J6YA 1Q6HA 3O5EA 4MGVA 2MF9A 2KI3A 4P8UA 1EYMA 3CGNA 3IKDA 5D75A 3TC5A 2A3EA 1ITXA 1FKIA 3ARQA 3CHCA 4DWSB 3O5PA 4DWSD 1FFQA 4KQZA 3MDYB 2XP9A 1E9LA 5GPRA 2DT1A 4P8XA 1RD6A 1J4HA 1H0IA 3ARSA 3O5GA 4TW8A 2OFNA 4W9OA 4URIA 4PTMA 2XP8A 4MNLA 3WL1A 3GPKA 4JFMA 3WD1A 2DT2A 1LL7A 1GOIA 1EIBA 1KFWA 1LJYA 3UF8A 3UI5A 3WD3A 4W9PA 2YBUA 3KCEA 4ITZA 4DRPA 1LQ0A 4MAVA 5DIVA 1Q1CA 4QIBA 1FKLA 2DSVA 3JXVA 1ROUA 2DG4A 4P8VA 1W26A 2LGOA 3WD2A 4DZ2A 2RURA 1XRVA 1NWTA 2KGJA 5I98A 3CH9A 3FXYA 3CHDA 1FKRA 1YATA 3ALFA 4JFLA 3I6CA 1QPFA 3WKZA 3OOBA 1W9PA 2O92A 5HT1A 2DPEA 4DRMA 4Z2GA 3B9DA 1JNSA 4N19A 3KAHA 1KT1A 3GTYX 1ZBWA 2DSUA 1PINA 4WJXA 2RUDA 1HKMA 4ODLA 1U79A 2FAPA 2LKNA 4ODOA 4IQCA 3B9EA 4DROA 1SR0A 3RFWA 3PA7A 3WD0A 4Z2IA 4HARA 1J4RA 1SYTA 2ZR5A 3UI4A 4IQ2A 3KAGA 1HJWA 1X6NA 2KO7A 1D7IA 2IUZA 4J4NA 2Q5AA 4FAPA 2LPVA 4WKFA 3PRDA 2LJ4A 5DITA 2PN0A 4ODKA 2AOSA 4MNKA 1FKSA 3ARXA 2B31A 1WNOA 3QOKA 2PPNA 4S3JA 1UR9A 3RM4A 4GGQA 2P4VA 5HW6A 3RGCA 3AS0A 4MPKA 4U84A 5HTGA 4R0XA 2MPHA 2XP7A 4LAWA 5BXJA 1HXVA 4G2PA 2XP4A 3EIPA 4ZPTR 2QF8A 2ZQTA 4C02B 2MLZA 3RM9A 2WM0A 4L3NA 5DEZA 2PV1A 3O5JA 1BKFA 3BMBA 3WD4A 4ZS6A 4KR0B 2EULA 5J6EA 2PPPA 1LL4A 1D2KA 1W1PA 4ZPWR 1WB0A 3WL0A 4DZ3A 2B5UB 1QPLA 4L72B 4NNRA 2DG3A 1W1VA 4S3KA 4QT3A 3W4RA 2MLYA 3O5IA 4DWSC
chains in the Genus database with same CATH topology
4MNMA 1EDQA 1FKGA 4ML4A 1P5QA 4W5UA 1ZBKA 4ODNA 2UZ5A 4MNJA 2M1IA 4ODQA 4GIVA 3B9AA 1NWRA 4WIWA 2DG9A 3JYJA 1E15A 1TCOC 3ARUA 2AWGA 4Z2JA 5HW7A 1M5YA 4WKHA 1N1AA 4TW6A 1XHGA 1B6CA 4Z2LA 1FD9A 3CHEA 4LAVA 2O9OA 3O5MA 1OGBA 2FKEA 1JVWA 3ARTA 1C9HA 4ODPA 1W9VA 3OA5A 4DH0A 3H9RB 1ZK6A 1FJDA 3TDBA 3FAPA 3TCZA 2VN1A 4J4OA 3KADA 2ZQUA 2RUCA 1CTNA 1NWSA 3BXWA 4DT4A 1YW5A 1FKDA 4JFJA 2MNTA 1QZ2A 4LAXA 3O5LA 4QT2A 1Y0OA 3ARWA 2A3AA 4HBOA 1ZCNA 4JFIA 1H0GA 4IPXA 2XP6A 1JNTA 3NI6A 5DIUA 1OGGA 1X6LA 3NRKA 2F21A 2OLHA 3UQIA 4XAKA 3IKGA 1GUVA 5HWCA 3UQAA 4BF8A 3KACA 3AQUA 2D9FA 3CGMA 4IT4A 2M2AA 3KAIA 1NMWA 3O5QA 2KFWA 1EQ3A 1TFVA 3G6MA 5HWBA 1HJXA 2MLXA 4DRKA 4Q7NA 4Z2KA 1NMVA 1LG1A 5DF0A 1ZBCA 5GPGA 1W9UA 3LUOA 3EY6A 2JZVA 4DRHA 1HKJA 3RMEA 3ALGA 2Y78A 3ARRA 4ODRA 3WIJA 2RSEA 3B8SA 2A3CA 1WAWA 1JNDA 2WLZA 4JFKA 2XPBA 4DWSA 2ZQSA 1NSGA 1Q6UA 4U85A 2N87A 4TYOA 2WK2A 3FY1A 3WH0A 3KAFA 2XP5A 3ARPA 2RQSA 2ZR6A 2L2SA 2ESCA 2G41A 2YBTA 1EHNA 3AS3A 4NSBA 1LL6A 1JNEA 2FDMA 3O5FA 1NWUA 2DSWA 1D7HA 2KR7A 3O5RA 4QZVB 4LGXA 2DT0A 2ITKA 1ROTA 2DSZA 3ARZA 1LG2A 4WKAA 1J4IA 1KT0A 4TW7A 5DO2A 5GQBA 2XP3A 4MSPA 5HKGA 4Z2HA 3AROA 1FKHA 5JH8A 1FFRA 3ARYA 4IT6A 5HBFA 2F2DA 4FN2A 1PBKA 1UR8A 1HJVA 1L1PA 3CHFA 3UI6A 1FKKA 3ARVA 4DRNA 3IK8A 4G50A 3WQVA 2RUQA 1E6PA 1NH6A 2A3BA 1F8AB 3AS2A 5B8IC 1FAPA 2PI6A 2M08A 3G6LA 4LAYA 4U86A 5HW8A 2PBCA 1W1YA 1HKIA 2PPOA 1E6NA 4DRQA 4O2TA 2DT3A 4DIPA 4AY1A 2PV3A 2G8ZA 3O5KA 2ZQVA 3VAWA 1D7JA 3WQWA 5HUAA 3AS1A 3KZ7A 2VCDA 1ZU8A 3NTPA 1BL4A 1OWQA 4WK9A 4Q22A 2ZR4A 2K8IA 3PRBA 1F40A 1E6RA 4JYSA 1FKBA 1T11A 4P8WA 1R9HA 1Q6IA 2IF4A 4R5EA 1ZB5A 1D6OA 1ZL1A 1FKFA 1FKJA 4MTVA 1W1TA 4ZPVR 1IX5A 4DRJA 1HKKA 2PV2A 3IHZA 3O5DA 3RM8A 1FKTA 3PRAA 4TNSA 4HBEA 3UQBA 1ZBVA 2XPAA 1O6IA 1VF8A 2KE0A 3B7XA 2F4EA 1GPFA 3ODKA 4DRIA 1A7XA 3O5OA 2WLYA 3JYMA 3KABA 4W9QA 3PR9A 4TX0A 4ODMA 4NZCA 1E6ZA 1K9TA 3CZ8A 1J6YA 1Q6HA 3O5EA 4MGVA 2MF9A 2KI3A 4P8UA 1EYMA 3CGNA 3IKDA 5D75A 3TC5A 2A3EA 1ITXA 1FKIA 3ARQA 3CHCA 4DWSB 3O5PA 4DWSD 1FFQA 4KQZA 3MDYB 2XP9A 1E9LA 5GPRA 2DT1A 4P8XA 1RD6A 1J4HA 1H0IA 3ARSA 3O5GA 4TW8A 2OFNA 4W9OA 4URIA 4PTMA 2XP8A 4MNLA 3WL1A 3GPKA 4JFMA 3WD1A 2DT2A 1LL7A 1GOIA 1EIBA 1KFWA 1LJYA 3UF8A 3UI5A 3WD3A 4W9PA 2YBUA 3KCEA 4ITZA 4DRPA 1LQ0A 4MAVA 5DIVA 1Q1CA 4QIBA 1FKLA 2DSVA 3JXVA 1ROUA 2DG4A 4P8VA 1W26A 2LGOA 3WD2A 4DZ2A 2RURA 1XRVA 1NWTA 2KGJA 5I98A 3CH9A 3FXYA 3CHDA 1FKRA 1YATA 3ALFA 4JFLA 3I6CA 1QPFA 3WKZA 3OOBA 1W9PA 2O92A 5HT1A 2DPEA 4DRMA 4Z2GA 3B9DA 1JNSA 4N19A 3KAHA 1KT1A 1ZBWA 2DSUA 1PINA 4WJXA 2RUDA 1HKMA 4ODLA 1U79A 2FAPA 2LKNA 4ODOA 4IQCA 3B9EA 4DROA 1SR0A 3RFWA 3PA7A 3WD0A 4Z2IA 4HARA 1J4RA 1SYTA 2ZR5A 3UI4A 4IQ2A 3KAGA 1HJWA 1X6NA 2KO7A 1D7IA 2IUZA 4J4NA 2Q5AA 4FAPA 2LPVA 4WKFA 3PRDA 2LJ4A 5DITA 4ODKA 2AOSA 4MNKA 1FKSA 3ARXA 2B31A 1WNOA 3QOKA 2PPNA 4S3JA 1UR9A 3RM4A 4GGQA 5HW6A 3RGCA 3AS0A 4MPKA 4U84A 5HTGA 4R0XA 2MPHA 2XP7A 4LAWA 5BXJA 1HXVA 4G2PA 2XP4A 4ZPTR 2QF8A 2ZQTA 4C02B 2MLZA 3RM9A 2WM0A 4L3NA 5DEZA 2PV1A 3O5JA 1BKFA 3WD4A 4ZS6A 4KR0B 5J6EA 2PPPA 1LL4A 1D2KA 1W1PA 4ZPWR 1WB0A 3WL0A 4DZ3A 1QPLA 4L72B 4NNRA 2DG3A 1W1VA 4S3KA 4QT3A 3W4RA 2MLYA 3O5IA 4DWSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSE A;  4JYS A;  1FKB A;  1FKG A;  1T11 A;  1R9H A;  1W26 A;  2LGO A;  1P5Q A;  4DZ2 A;  4JFK A;  2RUR A;  2XPB A;  4ODN A;  2ZQS A;  1NSG A;  1Q6I A;  2UZ5 A;  1Q6U A;  2KGJ A;  2M1I A;  4U85 A;  5I98 A;  4ODQ A;  2IF4 A;  4GIV A;  1YAT A;  2N87 A;  4TYO A;  1FKR A;  1D6O A;  1FKF A;  3WH0 A;  1FKJ A;  3KAF A;  4JFL A;  2XP5 A;  3I6C A;  2RQS A;  1QPF A;  4DRJ A;  2ZR6 A;  2PV2 A;  2L2S A;  2DG9 A;  3IHZ A;  3OOB A;  3O5D A;  5HT1 A;  3JYJ A;  1TCO C;  1FKT A;  2AWG A;  4DRM A;  5HW7 A;  3O5F A;  4TNS A;  3UQB A;  1JNS A;  1M5Y A;  1N1A A;  1D7H A;  2XPA A;  3KAH A;  4N19 A;  4TW6 A;  1KT1 A;  2KR7 A;  3O5R A;  3PRB A;  1B6C A;  1FD9 A;  4LAV A;  2KE0 A;  3O5M A;  3B7X A;  1PIN A;  2F4E A;  2ITK A;  1ROT A;  3ODK A;  2FKE A;  4DRI A;  1A7X A;  1JVW A;  2RUD A;  1C9H A;  1J4I A;  3O5O A;  4ODP A;  4ODL A;  3JYM A;  1KT0 A;  3KAB A;  1U79 A;  2FAP A;  2LKN A;  4W9Q A;  4ODO A;  4IQC A;  4TW7 A;  4DH0 A;  2XP3 A;  4MSP A;  4TX0 A;  4DRO A;  5HKG A;  3RFW A;  3H9R B;  4ODM A;  3PA7 A;  1ZK6 A;  1FJD A;  3TDB A;  1FKH A;  1J4R A;  1J6Y A;  1Q6H A;  3O5E A;  3FAP A;  3TCZ A;  2ZR5 A;  4MGV A;  2MF9 A;  2KI3 A;  3UI4 A;  2VN1 A;  4IQ2 A;  3KAG A;  4J4O A;  3KAD A;  1EYM A;  2ZQU A;  3CGN A;  3IKD A;  5D75 A;  2F2D A;  2KO7 A;  3TC5 A;  2RUC A;  1D7I A;  4FN2 A;  1PBK A;  4J4N A;  1FKI A;  1F40 A;  2Q5A A;  4DT4 A;  4FAP A;  1YW5 A;  2LPV A;  1FKD A;  4JFJ A;  1L1P A;  2MNT A;  1QZ2 A;  3UI6 A;  4LAX A;  3PRD A;  1FKK A;  2LJ4 A;  1Y0O A;  3O5L A;  4QT2 A;  5DIT A;  4ODK A;  4DRN A;  3O5P A;  1FKS A;  1ZCN A;  3IK8 A;  3MDY B;  4JFI A;  4G50 A;  2XP9 A;  4IPX A;  2PPN A;  2XP6 A;  4GGQ A;  1JNT A;  2RUQ A;  3NI6 A;  5HW6 A;  3RGC A;  5DIU A;  1J4H A;  4TW8 A;  3O5G A;  4U84 A;  5HTG A;  4R0X A;  3NRK A;  2MPH A;  2F21 A;  2OFN A;  3UQI A;  2XP7 A;  4W9O A;  1F8A B;  4LAW A;  5BXJ A;  5B8I C;  3IKG A;  1FAP A;  4G2P A;  2XP4 A;  2M08 A;  4U86 A;  4LAY A;  5HWC A;  1HXV A;  5HW8 A;  2XP8 A;  3UQA A;  2ZQT A;  2PBC A;  4BF8 A;  3KAC A;  4C02 B;  3GPK A;  2D9F A;  4JFM A;  2MLZ A;  3CGM A;  2PPO A;  2M2A A;  4ODR A;  2PV1 A;  4DRQ A;  4O2T A;  3KAI A;  4DIP A;  2PV3 A;  3O5K A;  3UF8 A;  3O5J A;  2ZQV A;  1BKF A;  3VAW A;  3UI5 A;  5J6E A;  1D7J A;  4W9P A;  5HUA A;  1NMW A;  2PPP A;  3O5Q A;  2KFW A;  1EQ3 A;  3KCE A;  3KZ7 A;  4ITZ A;  5HWB A;  2VCD A;  2MLX A;  4DRP A;  4DRK A;  5DIV A;  3NTP A;  1Q1C A;  1BL4 A;  4DZ3 A;  4QIB A;  1NMV A;  1QPL A;  4NNR A;  1FKL A;  2DG3 A;  3JXV A;  1ROU A;  5GPG A;  2DG4 A;  2ZR4 A;  3LUO A;  3EY6 A;  4QT3 A;  2JZV A;  2MLY A;  4DRH A;  2K8I A;  3O5I A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 4MNM A;  1EDQ A;  1FKG A;  4ML4 A;  1P5Q A;  4W5U A;  1ZBK A;  4ODN A;  2UZ5 A;  4MNJ A;  2M1I A;  4ODQ A;  4GIV A;  3B9A A;  1NWR A;  4WIW A;  2DG9 A;  3JYJ A;  1E15 A;  1TCO C;  3ARU A;  2AWG A;  4Z2J A;  5HW7 A;  1M5Y A;  4WKH A;  1N1A A;  4TW6 A;  1XHG A;  1B6C A;  4Z2L A;  1FD9 A;  3CHE A;  4LAV A;  2O9O A;  3O5M A;  1OGB A;  2FKE A;  1JVW A;  3ART A;  1C9H A;  4ODP A;  1W9V A;  3OA5 A;  4DH0 A;  3H9R B;  1ZK6 A;  1FJD A;  3TDB A;  3FAP A;  3TCZ A;  2VN1 A;  4J4O A;  3KAD A;  2ZQU A;  2RUC A;  1CTN A;  1NWS A;  3BXW A;  4DT4 A;  1YW5 A;  1FKD A;  4JFJ A;  2MNT A;  1QZ2 A;  4LAX A;  3O5L A;  4QT2 A;  1Y0O A;  3ARW A;  2A3A A;  4HBO A;  1ZCN A;  4JFI A;  1H0G A;  4IPX A;  2XP6 A;  1JNT A;  3NI6 A;  5DIU A;  1OGG A;  1X6L A;  3NRK A;  2F21 A;  2OLH A;  3UQI A;  4XAK A;  3IKG A;  1GUV A;  5HWC A;  3UQA A;  4BF8 A;  3KAC A;  3AQU A;  2D9F A;  3CGM A;  4IT4 A;  2M2A A;  1E44 A;  3KAI A;  1NMW A;  3O5Q A;  2KFW A;  1EQ3 A;  1TFV A;  3G6M A;  5HWB A;  1HJX A;  2MLX A;  4DRK A;  4Q7N A;  4Z2K A;  1NMV A;  1LG1 A;  5DF0 A;  1ZBC A;  5GPG A;  1W9U A;  3LUO A;  3EY6 A;  2JZV A;  4DRH A;  1HKJ A;  3RME A;  3ALG A;  2Y78 A;  3ARR A;  4ODR A;  3WIJ A;  2RSE A;  3B8S A;  2A3C A;  1WAW A;  1JND A;  2WLZ A;  4JFK A;  2XPB A;  1GRJ A;  4DWS A;  2ZQS A;  1NSG A;  1Q6U A;  4U85 A;  2N87 A;  4TYO A;  2WK2 A;  3FY1 A;  3WH0 A;  3KAF A;  2XP5 A;  3ARP A;  2RQS A;  2ZR6 A;  2L2S A;  4UDM A;  1JCH B;  2ESC A;  2G41 A;  2YBT A;  1EHN A;  3AS3 A;  4NSB A;  1LL6 A;  1JNE A;  2FDM A;  3O5F A;  1NWU A;  2DSW A;  1D7H A;  2KR7 A;  3O5R A;  4QZV B;  4LGX A;  2DT0 A;  2ITK A;  1ROT A;  2DSZ A;  3ARZ A;  1LG2 A;  4WKA A;  1J4I A;  1KT0 A;  4TW7 A;  5DO2 A;  5GQB A;  2XP3 A;  4MSP A;  5HKG A;  4Z2H A;  3ARO A;  1FKH A;  5JH8 A;  1FFR A;  3ARY A;  4IT6 A;  5HBF A;  2F2D A;  4FN2 A;  1PBK A;  1UR8 A;  1HJV A;  1L1P A;  3CHF A;  3UI6 A;  1FKK A;  3ARV A;  4DRN A;  3IK8 A;  4G50 A;  3WQV A;  2RUQ A;  1E6P A;  1NH6 A;  2A3B A;  1F8A B;  3AS2 A;  5B8I C;  1FAP A;  2PI6 A;  2M08 A;  3G6L A;  4LAY A;  4U86 A;  5HW8 A;  2PBC A;  1W1Y A;  1HKI A;  2PPO A;  1E6N A;  4DRQ A;  4O2T A;  2DT3 A;  4DIP A;  4AY1 A;  2PV3 A;  2G8Z A;  3O5K A;  2ZQV A;  3VAW A;  1D7J A;  3WQW A;  5HUA A;  3GU0 A;  3AS1 A;  3KZ7 A;  2VCD A;  1ZU8 A;  3NTP A;  1BL4 A;  1OWQ A;  2ETN A;  4WK9 A;  4Q22 A;  2ZR4 A;  2K8I A;  3PRB A;  1F40 A;  1E6R A;  4JYS A;  1FKB A;  1T11 A;  4P8W A;  1R9H A;  1Q6I A;  2IF4 A;  4R5E A;  1ZB5 A;  1D6O A;  1ZL1 A;  1FKF A;  1FKJ A;  4MTV A;  1W1T A;  4ZPV R;  1IX5 A;  4DRJ A;  1HKK A;  2PV2 A;  3IHZ A;  3O5D A;  3RM8 A;  1FKT A;  3PRA A;  4TNS A;  4HBE A;  3UQB A;  1ZBV A;  2XPA A;  1O6I A;  2F23 A;  1VF8 A;  2KE0 A;  3B7X A;  2F4E A;  1GPF A;  3ODK A;  4DRI A;  1A7X A;  3O5O A;  2WLY A;  3JYM A;  3KAB A;  4W9Q A;  3PR9 A;  4TX0 A;  4ODM A;  4NZC A;  1E6Z A;  1K9T A;  3CZ8 A;  1J6Y A;  1Q6H A;  3O5E A;  4MGV A;  2MF9 A;  2KI3 A;  4P8U A;  1EYM A;  3CGN A;  3IKD A;  5D75 A;  3TC5 A;  2A3E A;  1ITX A;  1FKI A;  3ARQ A;  3CHC A;  4DWS B;  3O5P A;  4DWS D;  1FFQ A;  4KQZ A;  3MDY B;  2XP9 A;  1E9L A;  5GPR A;  2DT1 A;  4P8X A;  1RD6 A;  1J4H A;  1H0I A;  3ARS A;  3O5G A;  4TW8 A;  2OFN A;  4W9O A;  4URI A;  4PTM A;  2XP8 A;  4MNL A;  3WL1 A;  3GPK A;  4JFM A;  3WD1 A;  2DT2 A;  1LL7 A;  1GOI A;  1EIB A;  1KFW A;  1LJY A;  3UF8 A;  3UI5 A;  3WD3 A;  4W9P A;  2YBU A;  3KCE A;  4ITZ A;  4DRP A;  1LQ0 A;  4MAV A;  5DIV A;  1Q1C A;  4QIB A;  1FKL A;  2DSV A;  3JXV A;  1ROU A;  2DG4 A;  4P8V A;  1W26 A;  2LGO A;  3WD2 A;  4DZ2 A;  2RUR A;  1XRV A;  1NWT A;  2KGJ A;  5I98 A;  3CH9 A;  3FXY A;  3CHD A;  1FKR A;  1YAT A;  3ALF A;  4JFL A;  3I6C A;  1QPF A;  3WKZ A;  3OOB A;  1W9P A;  2O92 A;  5HT1 A;  2DPE A;  4DRM A;  4Z2G A;  3B9D A;  1JNS A;  4N19 A;  3KAH A;  1KT1 A;  3GTY X;  1ZBW A;  2DSU A;  1PIN A;  4WJX A;  2RUD A;  1HKM A;  4ODL A;  1U79 A;  2FAP A;  2LKN A;  4ODO A;  4IQC A;  3B9E A;  4DRO A;  1SR0 A;  3RFW A;  3PA7 A;  3WD0 A;  4Z2I A;  4HAR A;  1J4R A;  1SYT A;  2ZR5 A;  3UI4 A;  4IQ2 A;  3KAG A;  1HJW A;  1X6N A;  2KO7 A;  1D7I A;  2IUZ A;  4J4N A;  2Q5A A;  4FAP A;  2LPV A;  4WKF A;  3PRD A;  2LJ4 A;  5DIT A;  2PN0 A;  4ODK A;  2AOS A;  4MNK A;  1FKS A;  3ARX A;  2B31 A;  1WNO A;  3QOK A;  2PPN A;  4S3J A;  1UR9 A;  3RM4 A;  4GGQ A;  2P4V A;  5HW6 A;  3RGC A;  3AS0 A;  4MPK A;  4U84 A;  5HTG A;  4R0X A;  2MPH A;  2XP7 A;  4LAW A;  5BXJ A;  1HXV A;  4G2P A;  2XP4 A;  3EIP A;  4ZPT R;  2QF8 A;  2ZQT A;  4C02 B;  2MLZ A;  3RM9 A;  2WM0 A;  4L3N A;  5DEZ A;  2PV1 A;  3O5J A;  1BKF A;  3BMB A;  3WD4 A;  4ZS6 A;  4KR0 B;  2EUL A;  5J6E A;  2PPP A;  1LL4 A;  1D2K A;  1W1P A;  4ZPW R;  1WB0 A;  3WL0 A;  4DZ3 A;  2B5U B;  1QPL A;  4L72 B;  4NNR A;  2DG3 A;  1W1V A;  4S3K A;  4QT3 A;  3W4R A;  2MLY A;  3O5I A;  4DWS C; 
#chains in the Genus database with same CATH homology
 4MNM A;  1EDQ A;  1FKG A;  4ML4 A;  1P5Q A;  4W5U A;  1ZBK A;  4ODN A;  2UZ5 A;  4MNJ A;  2M1I A;  4ODQ A;  4GIV A;  3B9A A;  1NWR A;  4WIW A;  2DG9 A;  3JYJ A;  1E15 A;  1TCO C;  3ARU A;  2AWG A;  4Z2J A;  5HW7 A;  1M5Y A;  4WKH A;  1N1A A;  4TW6 A;  1XHG A;  1B6C A;  4Z2L A;  1FD9 A;  3CHE A;  4LAV A;  2O9O A;  3O5M A;  1OGB A;  2FKE A;  1JVW A;  3ART A;  1C9H A;  4ODP A;  1W9V A;  3OA5 A;  4DH0 A;  3H9R B;  1ZK6 A;  1FJD A;  3TDB A;  3FAP A;  3TCZ A;  2VN1 A;  4J4O A;  3KAD A;  2ZQU A;  2RUC A;  1CTN A;  1NWS A;  3BXW A;  4DT4 A;  1YW5 A;  1FKD A;  4JFJ A;  2MNT A;  1QZ2 A;  4LAX A;  3O5L A;  4QT2 A;  1Y0O A;  3ARW A;  2A3A A;  4HBO A;  1ZCN A;  4JFI A;  1H0G A;  4IPX A;  2XP6 A;  1JNT A;  3NI6 A;  5DIU A;  1OGG A;  1X6L A;  3NRK A;  2F21 A;  2OLH A;  3UQI A;  4XAK A;  3IKG A;  1GUV A;  5HWC A;  3UQA A;  4BF8 A;  3KAC A;  3AQU A;  2D9F A;  3CGM A;  4IT4 A;  2M2A A;  3KAI A;  1NMW A;  3O5Q A;  2KFW A;  1EQ3 A;  1TFV A;  3G6M A;  5HWB A;  1HJX A;  2MLX A;  4DRK A;  4Q7N A;  4Z2K A;  1NMV A;  1LG1 A;  5DF0 A;  1ZBC A;  5GPG A;  1W9U A;  3LUO A;  3EY6 A;  2JZV A;  4DRH A;  1HKJ A;  3RME A;  3ALG A;  2Y78 A;  3ARR A;  4ODR A;  3WIJ A;  2RSE A;  3B8S A;  2A3C A;  1WAW A;  1JND A;  2WLZ A;  4JFK A;  2XPB A;  4DWS A;  2ZQS A;  1NSG A;  1Q6U A;  4U85 A;  2N87 A;  4TYO A;  2WK2 A;  3FY1 A;  3WH0 A;  3KAF A;  2XP5 A;  3ARP A;  2RQS A;  2ZR6 A;  2L2S A;  2ESC A;  2G41 A;  2YBT A;  1EHN A;  3AS3 A;  4NSB A;  1LL6 A;  1JNE A;  2FDM A;  3O5F A;  1NWU A;  2DSW A;  1D7H A;  2KR7 A;  3O5R A;  4QZV B;  4LGX A;  2DT0 A;  2ITK A;  1ROT A;  2DSZ A;  3ARZ A;  1LG2 A;  4WKA A;  1J4I A;  1KT0 A;  4TW7 A;  5DO2 A;  5GQB A;  2XP3 A;  4MSP A;  5HKG A;  4Z2H A;  3ARO A;  1FKH A;  5JH8 A;  1FFR A;  3ARY A;  4IT6 A;  5HBF A;  2F2D A;  4FN2 A;  1PBK A;  1UR8 A;  1HJV A;  1L1P A;  3CHF A;  3UI6 A;  1FKK A;  3ARV A;  4DRN A;  3IK8 A;  4G50 A;  3WQV A;  2RUQ A;  1E6P A;  1NH6 A;  2A3B A;  1F8A B;  3AS2 A;  5B8I C;  1FAP A;  2PI6 A;  2M08 A;  3G6L A;  4LAY A;  4U86 A;  5HW8 A;  2PBC A;  1W1Y A;  1HKI A;  2PPO A;  1E6N A;  4DRQ A;  4O2T A;  2DT3 A;  4DIP A;  4AY1 A;  2PV3 A;  2G8Z A;  3O5K A;  2ZQV A;  3VAW A;  1D7J A;  3WQW A;  5HUA A;  3AS1 A;  3KZ7 A;  2VCD A;  1ZU8 A;  3NTP A;  1BL4 A;  1OWQ A;  4WK9 A;  4Q22 A;  2ZR4 A;  2K8I A;  3PRB A;  1F40 A;  1E6R A;  4JYS A;  1FKB A;  1T11 A;  4P8W A;  1R9H A;  1Q6I A;  2IF4 A;  4R5E A;  1ZB5 A;  1D6O A;  1ZL1 A;  1FKF A;  1FKJ A;  4MTV A;  1W1T A;  4ZPV R;  1IX5 A;  4DRJ A;  1HKK A;  2PV2 A;  3IHZ A;  3O5D A;  3RM8 A;  1FKT A;  3PRA A;  4TNS A;  4HBE A;  3UQB A;  1ZBV A;  2XPA A;  1O6I A;  1VF8 A;  2KE0 A;  3B7X A;  2F4E A;  1GPF A;  3ODK A;  4DRI A;  1A7X A;  3O5O A;  2WLY A;  3JYM A;  3KAB A;  4W9Q A;  3PR9 A;  4TX0 A;  4ODM A;  4NZC A;  1E6Z A;  1K9T A;  3CZ8 A;  1J6Y A;  1Q6H A;  3O5E A;  4MGV A;  2MF9 A;  2KI3 A;  4P8U A;  1EYM A;  3CGN A;  3IKD A;  5D75 A;  3TC5 A;  2A3E A;  1ITX A;  1FKI A;  3ARQ A;  3CHC A;  4DWS B;  3O5P A;  4DWS D;  1FFQ A;  4KQZ A;  3MDY B;  2XP9 A;  1E9L A;  5GPR A;  2DT1 A;  4P8X A;  1RD6 A;  1J4H A;  1H0I A;  3ARS A;  3O5G A;  4TW8 A;  2OFN A;  4W9O A;  4URI A;  4PTM A;  2XP8 A;  4MNL A;  3WL1 A;  3GPK A;  4JFM A;  3WD1 A;  2DT2 A;  1LL7 A;  1GOI A;  1EIB A;  1KFW A;  1LJY A;  3UF8 A;  3UI5 A;  3WD3 A;  4W9P A;  2YBU A;  3KCE A;  4ITZ A;  4DRP A;  1LQ0 A;  4MAV A;  5DIV A;  1Q1C A;  4QIB A;  1FKL A;  2DSV A;  3JXV A;  1ROU A;  2DG4 A;  4P8V A;  1W26 A;  2LGO A;  3WD2 A;  4DZ2 A;  2RUR A;  1XRV A;  1NWT A;  2KGJ A;  5I98 A;  3CH9 A;  3FXY A;  3CHD A;  1FKR A;  1YAT A;  3ALF A;  4JFL A;  3I6C A;  1QPF A;  3WKZ A;  3OOB A;  1W9P A;  2O92 A;  5HT1 A;  2DPE A;  4DRM A;  4Z2G A;  3B9D A;  1JNS A;  4N19 A;  3KAH A;  1KT1 A;  1ZBW A;  2DSU A;  1PIN A;  4WJX A;  2RUD A;  1HKM A;  4ODL A;  1U79 A;  2FAP A;  2LKN A;  4ODO A;  4IQC A;  3B9E A;  4DRO A;  1SR0 A;  3RFW A;  3PA7 A;  3WD0 A;  4Z2I A;  4HAR A;  1J4R A;  1SYT A;  2ZR5 A;  3UI4 A;  4IQ2 A;  3KAG A;  1HJW A;  1X6N A;  2KO7 A;  1D7I A;  2IUZ A;  4J4N A;  2Q5A A;  4FAP A;  2LPV A;  4WKF A;  3PRD A;  2LJ4 A;  5DIT A;  4ODK A;  2AOS A;  4MNK A;  1FKS A;  3ARX A;  2B31 A;  1WNO A;  3QOK A;  2PPN A;  4S3J A;  1UR9 A;  3RM4 A;  4GGQ A;  5HW6 A;  3RGC A;  3AS0 A;  4MPK A;  4U84 A;  5HTG A;  4R0X A;  2MPH A;  2XP7 A;  4LAW A;  5BXJ A;  1HXV A;  4G2P A;  2XP4 A;  4ZPT R;  2QF8 A;  2ZQT A;  4C02 B;  2MLZ A;  3RM9 A;  2WM0 A;  4L3N A;  5DEZ A;  2PV1 A;  3O5J A;  1BKF A;  3WD4 A;  4ZS6 A;  4KR0 B;  5J6E A;  2PPP A;  1LL4 A;  1D2K A;  1W1P A;  4ZPW R;  1WB0 A;  3WL0 A;  4DZ3 A;  1QPL A;  4L72 B;  4NNR A;  2DG3 A;  1W1V A;  4S3K A;  4QT3 A;  3W4R A;  2MLY A;  3O5I A;  4DWS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...