2LPVA

Solution structure of fkbp12 from aedes aegypti
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNATLTFDVELLRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FK506-binding protein 12 from Aedes aegypti.
pubmed doi rcsb
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
molecule tags Isomerase
source organism Aedes aegypti
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2lpvA00
1F8AB 2LGOA 4DRMA 1Q1CA 4JYSA 1J6YA 3KAFA 4TX0A 5HWCA 1Q6IA 2IF4A 2KO7A 2PV2A 5HW7A 2OFNA 3IHZA 4IPXA 5J6EA 2KFWA 3WH0A 3KABA 2D9FA 2DG4A 3UI4A 3ODKA 1QPFA 3O5OA 2F2DA 3KAGA 2DG3A 5HT1A 2KE0A 1J4RA 4ODLA 2XP8A 1QPLA 4TW8A 3UI5A 4GIVA 3O5EA 4JFMA 4N19A 4JFLA 4MGVA 4DRJA 4O2TA 1NMVA 3TDBA 1PBKA 3O5KA 1ZCNA 4W9OA 1R9HA 2MPHA 1EYMA 2ZR5A 2N87A 5HW6A 4DZ3A 2KR7A 2F4EA 2XP7A 1FKLA 2Y78A 3B7XA 4FN2A 1BKFA 1Q6HA 4IQ2A 1KT0A 4J4NA 5HUAA 2RQSA 3IKGA 1YATA 3KAIA 4TYOA 1KT1A 3EY6A 3LUOA 3GPKA 2Q5AA 1FKFA 4DRQA 2FKEA 2PPNA 1C9HA 1M5YA 2MNTA 4ITZA 1ROTA 1N1AA 2DG9A 2ZQTA 5B8IC 1L1PA 4BF8A 1T11A 2M08A 4DRIA 3OOBA 1D7HA 2VN1A 1EQ3A 4C02B 3IKDA 2ZR6A 4MSPA 5GPGA 2RUQA 2PPPA 4U86A 1JVWA 1FKDA 1FAPA 4DH0A 4J4OA 4QT3A 3CGMA 1NMWA 3KZ7A 3O5FA 4DZ2A 4W9QA 3IK8A 2MLYA 2LJ4A 2LKNA 3KCEA 4NNRA 5HKGA 1F40A 2L2SA 3KACA 1J4HA 1ROUA 3PRDA 5DIVA 1FKKA 1BL4A 2KGJA 4W9PA 1FKHA 1FKSA 1W26A 3UF8A 2ZQSA 2VCDA 4ODPA 2PPOA 4FAPA 3RGCA 4TW6A 4JFJA 4IQCA 1PINA 1FKGA 3UI6A 1J4IA 2XPBA 2MF9A 2XP4A 1JNSA 3UQAA 1FD9A 3FAPA 2ZQUA 1FKBA 2XP3A 4QT2A 4DRHA 5HTGA 1D6OA 3NTPA 3TCZA 4JFIA 4ODKA 4LAXA 1ZK6A 3O5PA 4TNSA 5DITA 2KI3A 1FJDA 1FKTA 3PA7A 3I6CA 3O5QA 4DRKA 3UQBA 1FKIA 3NRKA 2PV3A 3O5IA 4ODRA 4JFKA 2MLXA 2ZQVA 1A7XA 1JNTA 1HXVA 1D7JA 2PV1A 2XP9A 1FKJA 2XP6A 2RSEA 3O5RA 4R0XA 3JYMA 1P5QA 3JYJA 3O5GA 3RFWA 4DRNA 2AWGA 2PBCA 4QIBA 3VAWA 4LAWA 3NI6A 1NSGA 4ODOA 4DROA 5I98A 4U84A 2LPVA 1Y0OA 4ODQA 2K8IA 3O5LA 2M2AA 2UZ5A 3KAHA 5HWBA 1B6CA 3JXVA 3UQIA 2RUDA 1TCOC 3CGNA 2ITKA 5HW8A 3MDYB 2RURA 4LAVA 4LAYA 4TW7A 2JZVA 4DRPA 1D7IA 1QZ2A 2XP5A 3O5DA 1YW5A 4ODNA 4U85A 5DIUA 4DT4A 1FKRA 2XPAA 3H9RB 3O5MA 2M1IA 1Q6UA 3PRBA 2F21A 5BXJA 3TC5A 1U79A 4G2PA 2RUCA 4G50A 3KADA 5D75A 3O5JA 4DIPA 2ZR4A 2FAPA 2MLZA 4GGQA 4ODMA
chains in the Genus database with same CATH superfamily
1Q1CA 2DG4A 2A3BA 3O5OA 3KAGA 2PN0A 2KE0A 3B9AA 1OGGA 3WKZA 2XP8A 3UI5A 4GIVA 3O5EA 4P8UA 3OA5A 3B8SA 2B31A 4O2TA 3GU0A 4AY1A 1R9HA 2MPHA 2N87A 1JNDA 1W1YA 4FN2A 3B7XA 1Q6HA 4IT4A 1KT0A 4WKHA 4TYOA 1XRVA 3EY6A 3GPKA 2FKEA 2A3EA 4W5UA 2MNTA 5B8IC 4URIA 4DRIA 3WQWA 2VN1A 5DF0A 3QOKA 1FAPA 2L2SA 1E44A 4Z2JA 5GPRA 3UF8A 2VCDA 4FAPA 2FDMA 3RGCA 1ZU8A 4Z2LA 1PINA 3CHFA 1E6NA 2IUZA 2XPBA 2MF9A 1NWSA 1JNSA 1HJVA 1K9TA 1UR8A 1FKBA 4QT2A 3AS0A 3G6MA 4ODKA 3RM8A 1ZK6A 1LL4A 4WJXA 1ZBKA 4P8XA 3UQBA 4ODRA 4DWSB 2ZQVA 1A7XA 1JNTA 1D7JA 2XP6A 3EIPA 3O5RA 1P5QA 3O5GA 4DRNA 4LAWA 3WD1A 4U84A 2LPVA 1W1PA 1SR0A 4ODQA 2K8IA 3JXVA 4LAVA 1W1TA 4MNLA 1GUVA 1KFWA 1QZ2A 2XP5A 4U85A 4DT4A 1FKRA 2XPAA 3O5MA 1Q6UA 3PRBA 4WIWA 5BXJA 3KADA 3TC5A 2RUDA 2MLZA 4GGQA 4MAVA 3WD0A 4NZCA 1WB0A 3KAFA 2EULA 2O92A 4TX0A 1Q6IA 2IF4A 2KO7A 3IHZA 5J6EA 1HJXA 2F2DA 2DG3A 5HT1A 1NWUA 1LL7A 4DRJA 4KR0B 1NMVA 3O5KA 2ZR5A 3ARSA 3AS3A 2F4EA 2XP7A 1OWQA 1YATA 3KAIA 2OLHA 3WD3A 4DWSC 3ARPA 4DRQA 1GOIA 1JNEA 1C9HA 1M5YA 1ROTA 3AS1A 3RM4A 5JH8A 1L1PA 4BF8A 2M08A 1HKMA 2B5UB 4C02B 1OGBA 3IKDA 4DWSA 4S3KA 2ZR6A 2RUQA 1X6NA 4DH0A 1FKDA 3ARRA 4QT3A 2DPEA 3KZ7A 3KCEA 4NNRA 4P8WA 1J4HA 1HKJA 1SYTA 4R5EA 3WD2A 1FKKA 1WAWA 1FKSA 1W26A 2ZQSA 2PPOA 3W4RA 4TW6A 4JFJA 4IQCA 1LG1A 1FKGA 2DSWA 2XP4A 3ARQA 2XP3A 5HTGA 3NTPA 4MNMA 4ZPTR 3TCZA 3AQUA 4JFIA 2G8ZA 4LAXA 3O5PA 1TFVA 1FKTA 3I6CA 4DRKA 2MLXA 1W9UA 4Z2IA 3B9EA 2PV1A 2PI6A 2XP9A 3WIJA 1UR9A 3JYJA 2PBCA 3VAWA 4ODOA 3ARXA 1Y0OA 1X6LA 3O5LA 3KAHA 3WL0A 2YBTA 4WK9A 2YBUA 5HW8A 3WD4A 3O5DA 3H9RB 2DT2A 1XHGA 1ITXA 1U79A 1W9VA 2DSUA 3WL1A 4G50A 2A3CA 2DT0A 1F8AB 3AROA 4DRMA 2A3AA 1J6YA 2PV2A 5HW7A 4IPXA 4L72B 4ZS6A 2KFWA 3WH0A 3KABA 3UI4A 3ODKA 1QPFA 3B9DA 1J4RA 1QPLA 4N19A 4QZVB 4Q7NA 4JFLA 2P4VA 4Q22A 2QF8A 3TDBA 4W9OA 1EYMA 3GTYX 1FKLA 4MTVA 4J4NA 2RQSA 3CHCA 3LUOA 4HARA 2Q5AA 4MNKA 4ITZA 1RD6A 2DG9A 1O6IA 3OOBA 1D7HA 1FFQA 1HKKA 1EQ3A 3CHDA 5GPGA 4U86A 1H0IA 4J4OA 1GPFA 1E9LA 3CGMA 1NMWA 3O5FA 4MPKA 3IK8A 2LJ4A 4L3NA 1E6RA 1F40A 5DEZA 1GRJA 3ARTA 3RM9A 3PRDA 1BL4A 3BMBA 1FFRA 3FXYA 1J4IA 1HKIA 3UQAA 2O9OA 2ZQUA 4DRHA 1D6OA 3G6LA 1LJYA 4TNSA 5DITA 4WKAA 1NWTA 1D2KA 3ARUA 1W1VA 4Z2KA 1FKJA 3ARYA 3WQVA 4R0XA 3RFWA 2AWGA 4QIBA 5I98A 4DROA 3PRAA 2M2AA 1B6CA 4IT6A 1TCOC 3RMEA 3MDYB 1E6ZA 4LAYA 4WKFA 2JZVA 3CH9A 1D7IA 4P8VA 4DRPA 5DIUA 4HBEA 4LGXA 1ZBCA 1VF8A 4Z2HA 1HJWA 3O5JA 2FAPA 1ZL1A 4ODMA 2LGOA 4JYSA 2F23A 5HWCA 1W9PA 2OFNA 4KQZA 2ETNA 2D9FA 4ODLA 4TW8A 4JFMA 4MGVA 4ZPWR 2WM0A 1PBKA 1ZCNA 1EDQA 5GQBA 5HW6A 4DZ3A 2KR7A 2Y78A 4NSBA 2DT1A 1BKFA 4IQ2A 4PTMA 1NH6A 5HUAA 3IKGA 1KT1A 1FKFA 4MNJA 4ZPVR 2PPNA 1ZBVA 2ZQTA 1N1AA 1T11A 3ALFA 4DWSD 3CHEA 4MSPA 2PPPA 1JVWA 3ARZA 1E15A 2ESCA 4DZ2A 1NWRA 4W9QA 2MLYA 2LKNA 3AS2A 5HKGA 3ARVA 3FY1A 4XAKA 3KACA 1WNOA 1ROUA 5DIVA 4Z2GA 2KGJA 4W9PA 1FKHA 2DSVA 1JCHB 4HBOA 4ODPA 3BXWA 5DO2A 1ZBWA 3UI6A 1FD9A 3FAPA 1ZB5A 2DT3A 2KI3A 1FJDA 3ALGA 3PA7A 1IX5A 1E6PA 3O5QA 2G41A 1FKIA 3CZ8A 3NRKA 2PV3A 3O5IA 4JFKA 1CTNA 1LG2A 5HBFA 2AOSA 1HXVA 2RSEA 2DSZA 3JYMA 1H0GA 3NI6A 1NSGA 2WLZA 2UZ5A 2WLYA 4S3JA 4UDMA 1EHNA 5HWBA 3UQIA 3CGNA 2ITKA 3ARWA 2RURA 4ML4A 4TW7A 1EIBA 1LL6A 1YW5A 3PR9A 4ODNA 2M1IA 2WK2A 2F21A 1LQ0A 4G2PA 2RUCA 5D75A 4DIPA 2ZR4A
chains in the Genus database with same CATH topology
1Q1CA 2DG4A 2A3BA 3O5OA 3KAGA 2KE0A 3B9AA 1OGGA 3WKZA 2XP8A 3UI5A 4GIVA 3O5EA 4P8UA 3OA5A 3B8SA 2B31A 4O2TA 4AY1A 1R9HA 2MPHA 2N87A 1JNDA 1W1YA 4FN2A 3B7XA 1Q6HA 4IT4A 1KT0A 4WKHA 4TYOA 1XRVA 3EY6A 3GPKA 2FKEA 2A3EA 4W5UA 2MNTA 5B8IC 4URIA 4DRIA 3WQWA 2VN1A 5DF0A 3QOKA 1FAPA 2L2SA 4Z2JA 5GPRA 3UF8A 2VCDA 4FAPA 2FDMA 3RGCA 1ZU8A 4Z2LA 1PINA 3CHFA 1E6NA 2IUZA 2XPBA 2MF9A 1NWSA 1JNSA 1HJVA 1K9TA 1UR8A 1FKBA 4QT2A 3AS0A 3G6MA 4ODKA 3RM8A 1ZK6A 1LL4A 4WJXA 1ZBKA 4P8XA 3UQBA 4ODRA 4DWSB 2ZQVA 1A7XA 1JNTA 1D7JA 2XP6A 3O5RA 1P5QA 3O5GA 4DRNA 4LAWA 3WD1A 4U84A 2LPVA 1W1PA 1SR0A 4ODQA 2K8IA 3JXVA 4LAVA 1W1TA 4MNLA 1GUVA 1KFWA 1QZ2A 2XP5A 4U85A 4DT4A 1FKRA 2XPAA 3O5MA 1Q6UA 3PRBA 4WIWA 5BXJA 3KADA 3TC5A 2RUDA 2MLZA 4GGQA 4MAVA 3WD0A 4NZCA 1WB0A 3KAFA 2O92A 4TX0A 1Q6IA 2IF4A 2KO7A 3IHZA 5J6EA 1HJXA 2F2DA 2DG3A 5HT1A 1NWUA 1LL7A 4DRJA 4KR0B 1NMVA 3O5KA 2ZR5A 3ARSA 3AS3A 2F4EA 2XP7A 1OWQA 1YATA 3KAIA 2OLHA 3WD3A 4DWSC 3ARPA 4DRQA 1GOIA 1JNEA 1C9HA 1M5YA 1ROTA 3AS1A 3RM4A 5JH8A 1L1PA 4BF8A 2M08A 1HKMA 4C02B 1OGBA 3IKDA 4DWSA 4S3KA 2ZR6A 2RUQA 1X6NA 4DH0A 1FKDA 3ARRA 4QT3A 2DPEA 3KZ7A 3KCEA 4NNRA 4P8WA 1J4HA 1HKJA 1SYTA 4R5EA 3WD2A 1FKKA 1WAWA 1FKSA 1W26A 2ZQSA 2PPOA 3W4RA 4TW6A 4JFJA 4IQCA 1LG1A 1FKGA 2DSWA 2XP4A 3ARQA 2XP3A 5HTGA 3NTPA 4MNMA 4ZPTR 3TCZA 3AQUA 4JFIA 2G8ZA 4LAXA 3O5PA 1TFVA 1FKTA 3I6CA 4DRKA 2MLXA 1W9UA 4Z2IA 3B9EA 2PV1A 2PI6A 2XP9A 3WIJA 1UR9A 3JYJA 2PBCA 3VAWA 4ODOA 3ARXA 1Y0OA 1X6LA 3O5LA 3KAHA 3WL0A 2YBTA 4WK9A 2YBUA 5HW8A 3WD4A 3O5DA 3H9RB 2DT2A 1XHGA 1ITXA 1U79A 1W9VA 2DSUA 3WL1A 4G50A 2A3CA 2DT0A 1F8AB 3AROA 4DRMA 2A3AA 1J6YA 2PV2A 5HW7A 4IPXA 4L72B 4ZS6A 2KFWA 3WH0A 3KABA 3UI4A 3ODKA 1QPFA 3B9DA 1J4RA 1QPLA 4N19A 4QZVB 4Q7NA 4JFLA 4Q22A 2QF8A 3TDBA 4W9OA 1EYMA 1FKLA 4MTVA 4J4NA 2RQSA 3CHCA 3LUOA 4HARA 2Q5AA 4MNKA 4ITZA 1RD6A 2DG9A 1O6IA 3OOBA 1D7HA 1FFQA 1HKKA 1EQ3A 3CHDA 5GPGA 4U86A 1H0IA 4J4OA 1GPFA 1E9LA 3CGMA 1NMWA 3O5FA 4MPKA 3IK8A 2LJ4A 4L3NA 1E6RA 1F40A 5DEZA 3ARTA 3RM9A 3PRDA 1BL4A 1FFRA 3FXYA 1J4IA 1HKIA 3UQAA 2O9OA 2ZQUA 4DRHA 1D6OA 3G6LA 1LJYA 4TNSA 5DITA 4WKAA 1NWTA 1D2KA 3ARUA 1W1VA 4Z2KA 1FKJA 3ARYA 3WQVA 4R0XA 3RFWA 2AWGA 4QIBA 5I98A 4DROA 3PRAA 2M2AA 1B6CA 4IT6A 1TCOC 3RMEA 3MDYB 1E6ZA 4LAYA 4WKFA 2JZVA 3CH9A 1D7IA 4P8VA 4DRPA 5DIUA 4HBEA 4LGXA 1ZBCA 1VF8A 4Z2HA 1HJWA 3O5JA 2FAPA 1ZL1A 4ODMA 2LGOA 4JYSA 5HWCA 1W9PA 2OFNA 4KQZA 2D9FA 4ODLA 4TW8A 4JFMA 4MGVA 4ZPWR 2WM0A 1PBKA 1ZCNA 1EDQA 5GQBA 5HW6A 4DZ3A 2KR7A 2Y78A 4NSBA 2DT1A 1BKFA 4IQ2A 4PTMA 1NH6A 5HUAA 3IKGA 1KT1A 1FKFA 4MNJA 4ZPVR 2PPNA 1ZBVA 2ZQTA 1N1AA 1T11A 3ALFA 4DWSD 3CHEA 4MSPA 2PPPA 1JVWA 3ARZA 1E15A 2ESCA 4DZ2A 1NWRA 4W9QA 2MLYA 2LKNA 3AS2A 5HKGA 3ARVA 3FY1A 4XAKA 3KACA 1WNOA 1ROUA 5DIVA 4Z2GA 2KGJA 4W9PA 1FKHA 2DSVA 4HBOA 4ODPA 3BXWA 5DO2A 1ZBWA 3UI6A 1FD9A 3FAPA 1ZB5A 2DT3A 2KI3A 1FJDA 3ALGA 3PA7A 1IX5A 1E6PA 3O5QA 2G41A 1FKIA 3CZ8A 3NRKA 2PV3A 3O5IA 4JFKA 1CTNA 1LG2A 5HBFA 2AOSA 1HXVA 2RSEA 2DSZA 3JYMA 1H0GA 3NI6A 1NSGA 2WLZA 2UZ5A 2WLYA 4S3JA 1EHNA 5HWBA 3UQIA 3CGNA 2ITKA 3ARWA 2RURA 4ML4A 4TW7A 1EIBA 1LL6A 1YW5A 3PR9A 4ODNA 2M1IA 2WK2A 2F21A 1LQ0A 4G2PA 2RUCA 5D75A 4DIPA 2ZR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  2LGO A;  4DRM A;  1Q1C A;  4JYS A;  1J6Y A;  3KAF A;  4TX0 A;  5HWC A;  1Q6I A;  2IF4 A;  2KO7 A;  2PV2 A;  5HW7 A;  2OFN A;  3IHZ A;  4IPX A;  5J6E A;  2KFW A;  3WH0 A;  3KAB A;  2D9F A;  2DG4 A;  3UI4 A;  3ODK A;  1QPF A;  3O5O A;  2F2D A;  3KAG A;  2DG3 A;  5HT1 A;  2KE0 A;  1J4R A;  4ODL A;  2XP8 A;  1QPL A;  4TW8 A;  3UI5 A;  4GIV A;  3O5E A;  4JFM A;  4N19 A;  4JFL A;  4MGV A;  4DRJ A;  4O2T A;  1NMV A;  3TDB A;  1PBK A;  3O5K A;  1ZCN A;  4W9O A;  1R9H A;  2MPH A;  1EYM A;  2ZR5 A;  2N87 A;  5HW6 A;  4DZ3 A;  2KR7 A;  2F4E A;  2XP7 A;  1FKL A;  2Y78 A;  3B7X A;  4FN2 A;  1BKF A;  1Q6H A;  4IQ2 A;  1KT0 A;  4J4N A;  5HUA A;  2RQS A;  3IKG A;  1YAT A;  3KAI A;  4TYO A;  1KT1 A;  3EY6 A;  3LUO A;  3GPK A;  2Q5A A;  1FKF A;  4DRQ A;  2FKE A;  2PPN A;  1C9H A;  1M5Y A;  2MNT A;  4ITZ A;  1ROT A;  1N1A A;  2DG9 A;  2ZQT A;  5B8I C;  1L1P A;  4BF8 A;  1T11 A;  2M08 A;  4DRI A;  3OOB A;  1D7H A;  2VN1 A;  1EQ3 A;  4C02 B;  3IKD A;  2ZR6 A;  4MSP A;  5GPG A;  2RUQ A;  2PPP A;  4U86 A;  1JVW A;  1FKD A;  1FAP A;  4DH0 A;  4J4O A;  4QT3 A;  3CGM A;  1NMW A;  3KZ7 A;  3O5F A;  4DZ2 A;  4W9Q A;  3IK8 A;  2MLY A;  2LJ4 A;  2LKN A;  3KCE A;  4NNR A;  5HKG A;  1F40 A;  2L2S A;  3KAC A;  1J4H A;  1ROU A;  3PRD A;  5DIV A;  1FKK A;  1BL4 A;  2KGJ A;  4W9P A;  1FKH A;  1FKS A;  1W26 A;  3UF8 A;  2ZQS A;  2VCD A;  4ODP A;  2PPO A;  4FAP A;  3RGC A;  4TW6 A;  4JFJ A;  4IQC A;  1PIN A;  1FKG A;  3UI6 A;  1J4I A;  2XPB A;  2MF9 A;  2XP4 A;  1JNS A;  3UQA A;  1FD9 A;  3FAP A;  2ZQU A;  1FKB A;  2XP3 A;  4QT2 A;  4DRH A;  5HTG A;  1D6O A;  3NTP A;  3TCZ A;  4JFI A;  4ODK A;  4LAX A;  1ZK6 A;  3O5P A;  4TNS A;  5DIT A;  2KI3 A;  1FJD A;  1FKT A;  3PA7 A;  3I6C A;  3O5Q A;  4DRK A;  3UQB A;  1FKI A;  3NRK A;  2PV3 A;  3O5I A;  4ODR A;  4JFK A;  2MLX A;  2ZQV A;  1A7X A;  1JNT A;  1HXV A;  1D7J A;  2PV1 A;  2XP9 A;  1FKJ A;  2XP6 A;  2RSE A;  3O5R A;  4R0X A;  3JYM A;  1P5Q A;  3JYJ A;  3O5G A;  3RFW A;  4DRN A;  2AWG A;  2PBC A;  4QIB A;  3VAW A;  4LAW A;  3NI6 A;  1NSG A;  4ODO A;  4DRO A;  5I98 A;  4U84 A;  2LPV A;  1Y0O A;  4ODQ A;  2K8I A;  3O5L A;  2M2A A;  2UZ5 A;  3KAH A;  5HWB A;  1B6C A;  3JXV A;  3UQI A;  2RUD A;  1TCO C;  3CGN A;  2ITK A;  5HW8 A;  3MDY B;  2RUR A;  4LAV A;  4LAY A;  4TW7 A;  2JZV A;  4DRP A;  1D7I A;  1QZ2 A;  2XP5 A;  3O5D A;  1YW5 A;  4ODN A;  4U85 A;  5DIU A;  4DT4 A;  1FKR A;  2XPA A;  3H9R B;  3O5M A;  2M1I A;  1Q6U A;  3PRB A;  2F21 A;  5BXJ A;  3TC5 A;  1U79 A;  4G2P A;  2RUC A;  4G50 A;  3KAD A;  5D75 A;  3O5J A;  4DIP A;  2ZR4 A;  2FAP A;  2MLZ A;  4GGQ A;  4ODM A; 
#chains in the Genus database with same CATH topology
 1Q1C A;  2DG4 A;  2A3B A;  3O5O A;  3KAG A;  2PN0 A;  2KE0 A;  3B9A A;  1OGG A;  3WKZ A;  2XP8 A;  3UI5 A;  4GIV A;  3O5E A;  4P8U A;  3OA5 A;  3B8S A;  2B31 A;  4O2T A;  3GU0 A;  4AY1 A;  1R9H A;  2MPH A;  2N87 A;  1JND A;  1W1Y A;  4FN2 A;  3B7X A;  1Q6H A;  4IT4 A;  1KT0 A;  4WKH A;  4TYO A;  1XRV A;  3EY6 A;  3GPK A;  2FKE A;  2A3E A;  4W5U A;  2MNT A;  5B8I C;  4URI A;  4DRI A;  3WQW A;  2VN1 A;  5DF0 A;  3QOK A;  1FAP A;  2L2S A;  1E44 A;  4Z2J A;  5GPR A;  3UF8 A;  2VCD A;  4FAP A;  2FDM A;  3RGC A;  1ZU8 A;  4Z2L A;  1PIN A;  3CHF A;  1E6N A;  2IUZ A;  2XPB A;  2MF9 A;  1NWS A;  1JNS A;  1HJV A;  1K9T A;  1UR8 A;  1FKB A;  4QT2 A;  3AS0 A;  3G6M A;  4ODK A;  3RM8 A;  1ZK6 A;  1LL4 A;  4WJX A;  1ZBK A;  4P8X A;  3UQB A;  4ODR A;  4DWS B;  2ZQV A;  1A7X A;  1JNT A;  1D7J A;  2XP6 A;  3EIP A;  3O5R A;  1P5Q A;  3O5G A;  4DRN A;  4LAW A;  3WD1 A;  4U84 A;  2LPV A;  1W1P A;  1SR0 A;  4ODQ A;  2K8I A;  3JXV A;  4LAV A;  1W1T A;  4MNL A;  1GUV A;  1KFW A;  1QZ2 A;  2XP5 A;  4U85 A;  4DT4 A;  1FKR A;  2XPA A;  3O5M A;  1Q6U A;  3PRB A;  4WIW A;  5BXJ A;  3KAD A;  3TC5 A;  2RUD A;  2MLZ A;  4GGQ A;  4MAV A;  3WD0 A;  4NZC A;  1WB0 A;  3KAF A;  2EUL A;  2O92 A;  4TX0 A;  1Q6I A;  2IF4 A;  2KO7 A;  3IHZ A;  5J6E A;  1HJX A;  2F2D A;  2DG3 A;  5HT1 A;  1NWU A;  1LL7 A;  4DRJ A;  4KR0 B;  1NMV A;  3O5K A;  2ZR5 A;  3ARS A;  3AS3 A;  2F4E A;  2XP7 A;  1OWQ A;  1YAT A;  3KAI A;  2OLH A;  3WD3 A;  4DWS C;  3ARP A;  4DRQ A;  1GOI A;  1JNE A;  1C9H A;  1M5Y A;  1ROT A;  3AS1 A;  3RM4 A;  5JH8 A;  1L1P A;  4BF8 A;  2M08 A;  1HKM A;  2B5U B;  4C02 B;  1OGB A;  3IKD A;  4DWS A;  4S3K A;  2ZR6 A;  2RUQ A;  1X6N A;  4DH0 A;  1FKD A;  3ARR A;  4QT3 A;  2DPE A;  3KZ7 A;  3KCE A;  4NNR A;  4P8W A;  1J4H A;  1HKJ A;  1SYT A;  4R5E A;  3WD2 A;  1FKK A;  1WAW A;  1FKS A;  1W26 A;  2ZQS A;  2PPO A;  3W4R A;  4TW6 A;  4JFJ A;  4IQC A;  1LG1 A;  1FKG A;  2DSW A;  2XP4 A;  3ARQ A;  2XP3 A;  5HTG A;  3NTP A;  4MNM A;  4ZPT R;  3TCZ A;  3AQU A;  4JFI A;  2G8Z A;  4LAX A;  3O5P A;  1TFV A;  1FKT A;  3I6C A;  4DRK A;  2MLX A;  1W9U A;  4Z2I A;  3B9E A;  2PV1 A;  2PI6 A;  2XP9 A;  3WIJ A;  1UR9 A;  3JYJ A;  2PBC A;  3VAW A;  4ODO A;  3ARX A;  1Y0O A;  1X6L A;  3O5L A;  3KAH A;  3WL0 A;  2YBT A;  4WK9 A;  2YBU A;  5HW8 A;  3WD4 A;  3O5D A;  3H9R B;  2DT2 A;  1XHG A;  1ITX A;  1U79 A;  1W9V A;  2DSU A;  3WL1 A;  4G50 A;  2A3C A;  2DT0 A;  1F8A B;  3ARO A;  4DRM A;  2A3A A;  1J6Y A;  2PV2 A;  5HW7 A;  4IPX A;  4L72 B;  4ZS6 A;  2KFW A;  3WH0 A;  3KAB A;  3UI4 A;  3ODK A;  1QPF A;  3B9D A;  1J4R A;  1QPL A;  4N19 A;  4QZV B;  4Q7N A;  4JFL A;  2P4V A;  4Q22 A;  2QF8 A;  3TDB A;  4W9O A;  1EYM A;  3GTY X;  1FKL A;  4MTV A;  4J4N A;  2RQS A;  3CHC A;  3LUO A;  4HAR A;  2Q5A A;  4MNK A;  4ITZ A;  1RD6 A;  2DG9 A;  1O6I A;  3OOB A;  1D7H A;  1FFQ A;  1HKK A;  1EQ3 A;  3CHD A;  5GPG A;  4U86 A;  1H0I A;  4J4O A;  1GPF A;  1E9L A;  3CGM A;  1NMW A;  3O5F A;  4MPK A;  3IK8 A;  2LJ4 A;  4L3N A;  1E6R A;  1F40 A;  5DEZ A;  1GRJ A;  3ART A;  3RM9 A;  3PRD A;  1BL4 A;  3BMB A;  1FFR A;  3FXY A;  1J4I A;  1HKI A;  3UQA A;  2O9O A;  2ZQU A;  4DRH A;  1D6O A;  3G6L A;  1LJY A;  4TNS A;  5DIT A;  4WKA A;  1NWT A;  1D2K A;  3ARU A;  1W1V A;  4Z2K A;  1FKJ A;  3ARY A;  3WQV A;  4R0X A;  3RFW A;  2AWG A;  4QIB A;  5I98 A;  4DRO A;  3PRA A;  2M2A A;  1B6C A;  4IT6 A;  1TCO C;  3RME A;  3MDY B;  1E6Z A;  4LAY A;  4WKF A;  2JZV A;  3CH9 A;  1D7I A;  4P8V A;  4DRP A;  5DIU A;  4HBE A;  4LGX A;  1ZBC A;  1VF8 A;  4Z2H A;  1HJW A;  3O5J A;  2FAP A;  1ZL1 A;  4ODM A;  2LGO A;  4JYS A;  2F23 A;  5HWC A;  1W9P A;  2OFN A;  4KQZ A;  2ETN A;  2D9F A;  4ODL A;  4TW8 A;  4JFM A;  4MGV A;  4ZPW R;  2WM0 A;  1PBK A;  1ZCN A;  1EDQ A;  5GQB A;  5HW6 A;  4DZ3 A;  2KR7 A;  2Y78 A;  4NSB A;  2DT1 A;  1BKF A;  4IQ2 A;  4PTM A;  1NH6 A;  5HUA A;  3IKG A;  1KT1 A;  1FKF A;  4MNJ A;  4ZPV R;  2PPN A;  1ZBV A;  2ZQT A;  1N1A A;  1T11 A;  3ALF A;  4DWS D;  3CHE A;  4MSP A;  2PPP A;  1JVW A;  3ARZ A;  1E15 A;  2ESC A;  4DZ2 A;  1NWR A;  4W9Q A;  2MLY A;  2LKN A;  3AS2 A;  5HKG A;  3ARV A;  3FY1 A;  4XAK A;  3KAC A;  1WNO A;  1ROU A;  5DIV A;  4Z2G A;  2KGJ A;  4W9P A;  1FKH A;  2DSV A;  1JCH B;  4HBO A;  4ODP A;  3BXW A;  5DO2 A;  1ZBW A;  3UI6 A;  1FD9 A;  3FAP A;  1ZB5 A;  2DT3 A;  2KI3 A;  1FJD A;  3ALG A;  3PA7 A;  1IX5 A;  1E6P A;  3O5Q A;  2G41 A;  1FKI A;  3CZ8 A;  3NRK A;  2PV3 A;  3O5I A;  4JFK A;  1CTN A;  1LG2 A;  5HBF A;  2AOS A;  1HXV A;  2RSE A;  2DSZ A;  3JYM A;  1H0G A;  3NI6 A;  1NSG A;  2WLZ A;  2UZ5 A;  2WLY A;  4S3J A;  4UDM A;  1EHN A;  5HWB A;  3UQI A;  3CGN A;  2ITK A;  3ARW A;  2RUR A;  4ML4 A;  4TW7 A;  1EIB A;  1LL6 A;  1YW5 A;  3PR9 A;  4ODN A;  2M1I A;  2WK2 A;  2F21 A;  1LQ0 A;  4G2P A;  2RUC A;  5D75 A;  4DIP A;  2ZR4 A; 
#chains in the Genus database with same CATH homology
 1Q1C A;  2DG4 A;  2A3B A;  3O5O A;  3KAG A;  2KE0 A;  3B9A A;  1OGG A;  3WKZ A;  2XP8 A;  3UI5 A;  4GIV A;  3O5E A;  4P8U A;  3OA5 A;  3B8S A;  2B31 A;  4O2T A;  4AY1 A;  1R9H A;  2MPH A;  2N87 A;  1JND A;  1W1Y A;  4FN2 A;  3B7X A;  1Q6H A;  4IT4 A;  1KT0 A;  4WKH A;  4TYO A;  1XRV A;  3EY6 A;  3GPK A;  2FKE A;  2A3E A;  4W5U A;  2MNT A;  5B8I C;  4URI A;  4DRI A;  3WQW A;  2VN1 A;  5DF0 A;  3QOK A;  1FAP A;  2L2S A;  4Z2J A;  5GPR A;  3UF8 A;  2VCD A;  4FAP A;  2FDM A;  3RGC A;  1ZU8 A;  4Z2L A;  1PIN A;  3CHF A;  1E6N A;  2IUZ A;  2XPB A;  2MF9 A;  1NWS A;  1JNS A;  1HJV A;  1K9T A;  1UR8 A;  1FKB A;  4QT2 A;  3AS0 A;  3G6M A;  4ODK A;  3RM8 A;  1ZK6 A;  1LL4 A;  4WJX A;  1ZBK A;  4P8X A;  3UQB A;  4ODR A;  4DWS B;  2ZQV A;  1A7X A;  1JNT A;  1D7J A;  2XP6 A;  3O5R A;  1P5Q A;  3O5G A;  4DRN A;  4LAW A;  3WD1 A;  4U84 A;  2LPV A;  1W1P A;  1SR0 A;  4ODQ A;  2K8I A;  3JXV A;  4LAV A;  1W1T A;  4MNL A;  1GUV A;  1KFW A;  1QZ2 A;  2XP5 A;  4U85 A;  4DT4 A;  1FKR A;  2XPA A;  3O5M A;  1Q6U A;  3PRB A;  4WIW A;  5BXJ A;  3KAD A;  3TC5 A;  2RUD A;  2MLZ A;  4GGQ A;  4MAV A;  3WD0 A;  4NZC A;  1WB0 A;  3KAF A;  2O92 A;  4TX0 A;  1Q6I A;  2IF4 A;  2KO7 A;  3IHZ A;  5J6E A;  1HJX A;  2F2D A;  2DG3 A;  5HT1 A;  1NWU A;  1LL7 A;  4DRJ A;  4KR0 B;  1NMV A;  3O5K A;  2ZR5 A;  3ARS A;  3AS3 A;  2F4E A;  2XP7 A;  1OWQ A;  1YAT A;  3KAI A;  2OLH A;  3WD3 A;  4DWS C;  3ARP A;  4DRQ A;  1GOI A;  1JNE A;  1C9H A;  1M5Y A;  1ROT A;  3AS1 A;  3RM4 A;  5JH8 A;  1L1P A;  4BF8 A;  2M08 A;  1HKM A;  4C02 B;  1OGB A;  3IKD A;  4DWS A;  4S3K A;  2ZR6 A;  2RUQ A;  1X6N A;  4DH0 A;  1FKD A;  3ARR A;  4QT3 A;  2DPE A;  3KZ7 A;  3KCE A;  4NNR A;  4P8W A;  1J4H A;  1HKJ A;  1SYT A;  4R5E A;  3WD2 A;  1FKK A;  1WAW A;  1FKS A;  1W26 A;  2ZQS A;  2PPO A;  3W4R A;  4TW6 A;  4JFJ A;  4IQC A;  1LG1 A;  1FKG A;  2DSW A;  2XP4 A;  3ARQ A;  2XP3 A;  5HTG A;  3NTP A;  4MNM A;  4ZPT R;  3TCZ A;  3AQU A;  4JFI A;  2G8Z A;  4LAX A;  3O5P A;  1TFV A;  1FKT A;  3I6C A;  4DRK A;  2MLX A;  1W9U A;  4Z2I A;  3B9E A;  2PV1 A;  2PI6 A;  2XP9 A;  3WIJ A;  1UR9 A;  3JYJ A;  2PBC A;  3VAW A;  4ODO A;  3ARX A;  1Y0O A;  1X6L A;  3O5L A;  3KAH A;  3WL0 A;  2YBT A;  4WK9 A;  2YBU A;  5HW8 A;  3WD4 A;  3O5D A;  3H9R B;  2DT2 A;  1XHG A;  1ITX A;  1U79 A;  1W9V A;  2DSU A;  3WL1 A;  4G50 A;  2A3C A;  2DT0 A;  1F8A B;  3ARO A;  4DRM A;  2A3A A;  1J6Y A;  2PV2 A;  5HW7 A;  4IPX A;  4L72 B;  4ZS6 A;  2KFW A;  3WH0 A;  3KAB A;  3UI4 A;  3ODK A;  1QPF A;  3B9D A;  1J4R A;  1QPL A;  4N19 A;  4QZV B;  4Q7N A;  4JFL A;  4Q22 A;  2QF8 A;  3TDB A;  4W9O A;  1EYM A;  1FKL A;  4MTV A;  4J4N A;  2RQS A;  3CHC A;  3LUO A;  4HAR A;  2Q5A A;  4MNK A;  4ITZ A;  1RD6 A;  2DG9 A;  1O6I A;  3OOB A;  1D7H A;  1FFQ A;  1HKK A;  1EQ3 A;  3CHD A;  5GPG A;  4U86 A;  1H0I A;  4J4O A;  1GPF A;  1E9L A;  3CGM A;  1NMW A;  3O5F A;  4MPK A;  3IK8 A;  2LJ4 A;  4L3N A;  1E6R A;  1F40 A;  5DEZ A;  3ART A;  3RM9 A;  3PRD A;  1BL4 A;  1FFR A;  3FXY A;  1J4I A;  1HKI A;  3UQA A;  2O9O A;  2ZQU A;  4DRH A;  1D6O A;  3G6L A;  1LJY A;  4TNS A;  5DIT A;  4WKA A;  1NWT A;  1D2K A;  3ARU A;  1W1V A;  4Z2K A;  1FKJ A;  3ARY A;  3WQV A;  4R0X A;  3RFW A;  2AWG A;  4QIB A;  5I98 A;  4DRO A;  3PRA A;  2M2A A;  1B6C A;  4IT6 A;  1TCO C;  3RME A;  3MDY B;  1E6Z A;  4LAY A;  4WKF A;  2JZV A;  3CH9 A;  1D7I A;  4P8V A;  4DRP A;  5DIU A;  4HBE A;  4LGX A;  1ZBC A;  1VF8 A;  4Z2H A;  1HJW A;  3O5J A;  2FAP A;  1ZL1 A;  4ODM A;  2LGO A;  4JYS A;  5HWC A;  1W9P A;  2OFN A;  4KQZ A;  2D9F A;  4ODL A;  4TW8 A;  4JFM A;  4MGV A;  4ZPW R;  2WM0 A;  1PBK A;  1ZCN A;  1EDQ A;  5GQB A;  5HW6 A;  4DZ3 A;  2KR7 A;  2Y78 A;  4NSB A;  2DT1 A;  1BKF A;  4IQ2 A;  4PTM A;  1NH6 A;  5HUA A;  3IKG A;  1KT1 A;  1FKF A;  4MNJ A;  4ZPV R;  2PPN A;  1ZBV A;  2ZQT A;  1N1A A;  1T11 A;  3ALF A;  4DWS D;  3CHE A;  4MSP A;  2PPP A;  1JVW A;  3ARZ A;  1E15 A;  2ESC A;  4DZ2 A;  1NWR A;  4W9Q A;  2MLY A;  2LKN A;  3AS2 A;  5HKG A;  3ARV A;  3FY1 A;  4XAK A;  3KAC A;  1WNO A;  1ROU A;  5DIV A;  4Z2G A;  2KGJ A;  4W9P A;  1FKH A;  2DSV A;  4HBO A;  4ODP A;  3BXW A;  5DO2 A;  1ZBW A;  3UI6 A;  1FD9 A;  3FAP A;  1ZB5 A;  2DT3 A;  2KI3 A;  1FJD A;  3ALG A;  3PA7 A;  1IX5 A;  1E6P A;  3O5Q A;  2G41 A;  1FKI A;  3CZ8 A;  3NRK A;  2PV3 A;  3O5I A;  4JFK A;  1CTN A;  1LG2 A;  5HBF A;  2AOS A;  1HXV A;  2RSE A;  2DSZ A;  3JYM A;  1H0G A;  3NI6 A;  1NSG A;  2WLZ A;  2UZ5 A;  2WLY A;  4S3J A;  1EHN A;  5HWB A;  3UQI A;  3CGN A;  2ITK A;  3ARW A;  2RUR A;  4ML4 A;  4TW7 A;  1EIB A;  1LL6 A;  1YW5 A;  3PR9 A;  4ODN A;  2M1I A;  2WK2 A;  2F21 A;  1LQ0 A;  4G2P A;  2RUC A;  5D75 A;  4DIP A;  2ZR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...