2LPXA

Solution structure of strawberry allergen fra a 1e
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
159
structure length
159
Chain Sequence
b'GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major strawberry allergen Fra a 1-E
publication title Solution structure of the strawberry allergen Fra a 1.
pubmed doi rcsb
source organism Fragaria x ananassa
molecule tags Unknown function
total genus 28
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2lpxA00
5I8FA 4IH0A 4A87A 2PSOA 4IGVA 3E85A 2GKDA 4A8GA 2KF2A 2Q3QA 2A1LA 3H3TA 1E09A 3QN1A 5AMWA 2LUZA 2L65A 1XN6A 3P0LA 2E3OA 1QMRA 4A81A 1LN1A 3NEGA 1XFSA 4BK7A 4LA7A 3NEFA 5E4BA 4IH2A 2NS9A 4Z3LA 4DS8A 3OJIA 3NJ1A 3K90A 4BTZA 2LIOA 5I9JA 2Z9ZA 1BTVA 2M89A 2LEQA 1XN5A 4Q0KA 3NJ0A 1X53A 3OQUA 3QSZA 4N3EA 4BKCA 2EJXA 4JHHA 1XUVA 3Q64A 4Y31A 3OTLA 4IGYA 4C9CA 2KCZA 3Q6AA 4REHA 1T27A 4A80A 4A8VA 2L9PA 4JDLA 1TXCA 4FPWA 5E46A 3FO5A 2E3PA 3NMPA 2KTEA 4JHIA 3NI8A 4M9BA 3F08A 3UJLA 4C94A 4WVOA 5BRLA 1LN3A 2N4BA 1TW0A 2QPVA 4A83A 3ZVUA 1FM4A 2QIMA 3IJTA 2IL5A 2E3SA 4JHGA 3TVQA 2LCGA 3H3RA 5E4DA 4LG5A 2L8OA 4XRWA 2VQ5A 3P9VA 2KEWA 3KDIA 4IHRA 4RYVA 3H3QA 3TFZA 3KAZA 2LPXA 2VNEA 3UQHA 3NS2A 2FLHA 3TVRA 4OICA 3CNWA 2E3RA 3H3SA 3K3KA 1VJHA 1FSKA 2E3QA 4IGWA 4XRTA 1KCMA 3C0VA 3TL1A 2R55A 3KDJA 4M9WA 4N0GC 1ZXFA 3WG8A 4LGBA 3KB0A 3P51A 5JNNA 4A8UA 3NMHA 4MNSA 4REJA 3IE5A 4A88A 4B9RA 5C9YA 4BKDA 3KLXA 2RESA 1T17A 3RT2A 1LLTA 1UW5A 3ELIA 1BV1A 2BK0A 4IGXA 3UIDA 3NMVA 3JRQB 2REZA 3PU2A 2PCSA 2K7HA 4DSCA 2RERA 4MA6A 1JSSA 3NR4A 3R6PA 4A85A 1B6FA 2I9YA 3RT0C 1H2OA 1ICXA 4C9IA 5JO2A 3Q63A 2LAKA 3NMNA 1EM2A 2Z9YA 4MAPA 4DSBA 3PUTA 4QIPA 2LF2A 3OH8A 3JRSA 3NJOA 4JDAA 4PSBA 2WQLA 2D4RA 2M47A 4A86A 1LN2A 2FFSA 2NN5A 4R7KA 1Z94A 4A84A 2E3MA 1IFVA 2LDKA 3KAYA 3KB3A 3RD6A 3W9KA 2E3NA 4BK6A 4GY9A 5JO1A 2K5GA 3GGNA 4LGAA 3KDHA 2MOUA 2LGHA 2N4AA 1XDFA 3NMTA 4REIA 3W9RA 2LE1A 3KL1A 5E4MA
chains in the Genus database with same CATH superfamily
5I8FA 4IH0A 4A87A 2PSOA 4IGVA 3E85A 2GKDA 4A8GA 2KF2A 2Q3QA 2A1LA 3H3TA 1E09A 3QN1A 5AMWA 2LUZA 2L65A 1XN6A 3P0LA 2E3OA 1QMRA 3GTSA 1LN1A 3NEGA 4QDCA 4A81A 4N41A 1XFSA 4BK7A 4LA7A 3NEFA 5E4BA 4IH2A 2NS9A 4Z3LA 4DS8A 4NCBA 3OJIA 3NJ1A 3K90A 3GL0A 4BTZA 2LIOA 2ZYLA 4KPYA 5I9JA 2Z9ZA 1BTVA 2M89A 2LEQA 1XN5A 4Q0KA 3NJ0A 1X53A 3NQNA 3OQUA 3QSZA 3GB4A 4N3EA 4BKCA 2EJXA 4JHHA 4QDFB 1XUVA 3Q64A 4Y31A 3OTLA 4IGYA 3DLBA 4C9CA 2KCZA 3Q6AA 4REHA 1T27A 4A80A 4A8VA 2L9PA 4JDLA 1TXCA 4FPWA 5E46A 5EKQC 3FO5A 2YH6A 3F73A 2E3PA 3NMPA 3GTEA 2KTEA 4JHIA 3NI8A 4M9BA 4QCKA 3F08A 3UJLA 4C94A 4WVOA 5BRLA 1LN3A 2N4BA 1TW0A 2QPVA 4A83A 4QDDA 3ZVUA 1FM4A 2QIMA 3IJTA 2IL5A 2E3SA 4JHGA 3TVQA 2LCGA 3H3RA 5E4DA 4LG5A 2L8OA 4XRWA 2VQ5A 3P9VA 2KEWA 3KDIA 4IHRA 4N76A 4RYVA 3H3QA 3TFZA 3KAZA 2LPXA 2VNEA 3UQHA 3NS2A 2FLHA 3TVRA 4OICA 3CNWA 2E3RA 3H3SA 3K3KA 1VJHA 1FSKA 2E3QA 4IGWA 4XRTA 1KCMA 3C0VA 3TL1A 2R55A 3KDJA 3HJFA 4M9WA 4N0GC 1ZXFA 3HK2A 3WG8A 3HO1A 4LGBA 3KB0A 3P51A 5JNNA 4A8UA 4NCAA 2LAFA 3NMHA 4MNSA 4REJA 3IE5A 4A88A 4B9RA 3HM9A 5C9YA 4BKDA 3KLXA 3HXMA 2RESA 3GKEA 3DLHA 1T17A 3RT2A 4E6FA 1LLTA 1UW5A 3ELIA 1BV1A 2BK0A 3GL2A 4IGXA 3UIDA 3NMVA 3JRQB 2REZA 3PU2A 2PCSA 2K7HA 4DSCA 2RERA 4MA6A 1JSSA 3NR4A 3R6PA 4A85A 1B6FA 2I9YA 4N47A 3RT0C 1H2OA 1ICXA 4C9IA 5JO2A 3Q63A 2LAKA 3GOBA 3NMNA 3HVRA 1EM2A 2Z9YA 4MAPA 4DSBA 4QDFA 3PUTA 4QIPA 2LF2A 3OH8A 3JRSA 3NJOA 4JDAA 4PSBA 2WQLA 2D4RA 2M47A 4A86A 1LN2A 2FFSA 2NN5A 4R7KA 1Z94A 4JHYA 4A84A 2E3MA 1IFVA 2LDKA 3KAYA 3KB3A 3RD6A 3W9KA 2E3NA 4BK6A 4GY9A 5JO1A 2K5GA 3GGNA 4LGAA 3KDHA 2MOUA 2LGHA 2N4AA 1XDFA 3NMTA 4REIA 3W9RA 2LE1A 3KL1A 5E4MA 3TGOC
chains in the Genus database with same CATH topology
5I8FA 4IH0A 4A87A 2PSOA 4IGVA 3E85A 2GKDA 4A8GA 2KF2A 2Q3QA 2A1LA 3H3TA 1E09A 3QN1A 5AMWA 2LUZA 2L65A 1XN6A 3P0LA 2E3OA 1QMRA 3GTSA 1LN1A 3NEGA 4QDCA 4A81A 4N41A 1XFSA 4BK7A 4LA7A 3NEFA 5E4BA 4IH2A 2NS9A 4Z3LA 4DS8A 4NCBA 3OJIA 3NJ1A 3K90A 3GL0A 4BTZA 2LIOA 2ZYLA 4KPYA 5I9JA 2Z9ZA 1BTVA 2M89A 2LEQA 1XN5A 4Q0KA 3NJ0A 1X53A 3NQNA 3OQUA 3QSZA 3GB4A 4N3EA 4BKCA 2EJXA 4JHHA 4QDFB 1XUVA 3Q64A 4Y31A 3OTLA 4IGYA 3DLBA 4C9CA 2KCZA 3Q6AA 4REHA 1T27A 4A80A 4A8VA 2L9PA 4JDLA 1TXCA 4FPWA 5E46A 5EKQC 3FO5A 2YH6A 3F73A 2E3PA 3NMPA 3GTEA 2KTEA 4JHIA 3NI8A 4M9BA 4QCKA 3F08A 3UJLA 4C94A 4WVOA 5BRLA 1LN3A 2N4BA 1TW0A 2QPVA 4A83A 4QDDA 3ZVUA 1FM4A 2QIMA 3IJTA 2IL5A 2E3SA 4JHGA 3TVQA 2LCGA 3H3RA 5E4DA 4LG5A 2L8OA 4XRWA 2VQ5A 3P9VA 2KEWA 3KDIA 4IHRA 4N76A 4RYVA 3H3QA 3TFZA 3KAZA 2LPXA 2VNEA 3UQHA 3NS2A 2FLHA 3TVRA 4OICA 3CNWA 2E3RA 3H3SA 3K3KA 1VJHA 1FSKA 2E3QA 4IGWA 4XRTA 1KCMA 3C0VA 3TL1A 2R55A 3KDJA 3HJFA 4M9WA 4N0GC 1ZXFA 3HK2A 3WG8A 3HO1A 4LGBA 3KB0A 3P51A 5JNNA 4A8UA 4NCAA 2LAFA 3NMHA 4MNSA 4REJA 3IE5A 4A88A 4B9RA 3HM9A 5C9YA 4BKDA 3KLXA 3HXMA 2RESA 3GKEA 3DLHA 1T17A 3RT2A 4E6FA 1LLTA 1UW5A 3ELIA 1BV1A 2BK0A 3GL2A 4IGXA 3UIDA 3NMVA 3JRQB 2REZA 3PU2A 2PCSA 2K7HA 4DSCA 2RERA 4MA6A 1JSSA 3NR4A 3R6PA 4A85A 1B6FA 2I9YA 4N47A 3RT0C 1H2OA 1ICXA 4C9IA 5JO2A 3Q63A 2LAKA 3GOBA 3NMNA 3HVRA 1EM2A 2Z9YA 4MAPA 4DSBA 4QDFA 3PUTA 4QIPA 2LF2A 3OH8A 3JRSA 3NJOA 4JDAA 4PSBA 2WQLA 2D4RA 2M47A 4A86A 1LN2A 2FFSA 2NN5A 4R7KA 1Z94A 4JHYA 4A84A 2E3MA 1IFVA 2LDKA 3KAYA 3KB3A 3RD6A 3W9KA 2E3NA 4BK6A 4GY9A 5JO1A 2K5GA 3GGNA 4LGAA 3KDHA 2MOUA 2LGHA 2N4AA 1XDFA 3NMTA 4REIA 3W9RA 2LE1A 3KL1A 5E4MA 3TGOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I8F A;  4IH0 A;  4A87 A;  2PSO A;  4IGV A;  3E85 A;  2GKD A;  4A8G A;  2KF2 A;  2Q3Q A;  2A1L A;  3H3T A;  1E09 A;  3QN1 A;  5AMW A;  2LUZ A;  2L65 A;  1XN6 A;  3P0L A;  2E3O A;  1QMR A;  4A81 A;  1LN1 A;  3NEG A;  1XFS A;  4BK7 A;  4LA7 A;  3NEF A;  5E4B A;  4IH2 A;  2NS9 A;  4Z3L A;  4DS8 A;  3OJI A;  3NJ1 A;  3K90 A;  4BTZ A;  2LIO A;  5I9J A;  2Z9Z A;  1BTV A;  2M89 A;  2LEQ A;  1XN5 A;  4Q0K A;  3NJ0 A;  1X53 A;  3OQU A;  3QSZ A;  4N3E A;  4BKC A;  2EJX A;  4JHH A;  1XUV A;  3Q64 A;  4Y31 A;  3OTL A;  4IGY A;  4C9C A;  2KCZ A;  3Q6A A;  4REH A;  1T27 A;  4A80 A;  4A8V A;  2L9P A;  4JDL A;  1TXC A;  4FPW A;  5E46 A;  3FO5 A;  2E3P A;  3NMP A;  2KTE A;  4JHI A;  3NI8 A;  4M9B A;  3F08 A;  3UJL A;  4C94 A;  4WVO A;  5BRL A;  1LN3 A;  2N4B A;  1TW0 A;  2QPV A;  4A83 A;  3ZVU A;  1FM4 A;  2QIM A;  3IJT A;  2IL5 A;  2E3S A;  4JHG A;  3TVQ A;  2LCG A;  3H3R A;  5E4D A;  4LG5 A;  2L8O A;  4XRW A;  2VQ5 A;  3P9V A;  2KEW A;  3KDI A;  4IHR A;  4RYV A;  3H3Q A;  3TFZ A;  3KAZ A;  2LPX A;  2VNE A;  3UQH A;  3NS2 A;  2FLH A;  3TVR A;  4OIC A;  3CNW A;  2E3R A;  3H3S A;  3K3K A;  1VJH A;  1FSK A;  2E3Q A;  4IGW A;  4XRT A;  1KCM A;  3C0V A;  3TL1 A;  2R55 A;  3KDJ A;  4M9W A;  4N0G C;  1ZXF A;  3WG8 A;  4LGB A;  3KB0 A;  3P51 A;  5JNN A;  4A8U A;  3NMH A;  4MNS A;  4REJ A;  3IE5 A;  4A88 A;  4B9R A;  5C9Y A;  4BKD A;  3KLX A;  2RES A;  1T17 A;  3RT2 A;  1LLT A;  1UW5 A;  3ELI A;  1BV1 A;  2BK0 A;  4IGX A;  3UID A;  3NMV A;  3JRQ B;  2REZ A;  3PU2 A;  2PCS A;  2K7H A;  4DSC A;  2RER A;  4MA6 A;  1JSS A;  3NR4 A;  3R6P A;  4A85 A;  1B6F A;  2I9Y A;  3RT0 C;  1H2O A;  1ICX A;  4C9I A;  5JO2 A;  3Q63 A;  2LAK A;  3NMN A;  1EM2 A;  2Z9Y A;  4MAP A;  4DSB A;  3PUT A;  4QIP A;  2LF2 A;  3OH8 A;  3JRS A;  3NJO A;  4JDA A;  4PSB A;  2WQL A;  2D4R A;  2M47 A;  4A86 A;  1LN2 A;  2FFS A;  2NN5 A;  4R7K A;  1Z94 A;  4A84 A;  2E3M A;  1IFV A;  2LDK A;  3KAY A;  3KB3 A;  3RD6 A;  3W9K A;  2E3N A;  4BK6 A;  4GY9 A;  5JO1 A;  2K5G A;  3GGN A;  4LGA A;  3KDH A;  2MOU A;  2LGH A;  2N4A A;  1XDF A;  3NMT A;  4REI A;  3W9R A;  2LE1 A;  3KL1 A;  5E4M A; 
#chains in the Genus database with same CATH topology
 5I8F A;  4IH0 A;  4A87 A;  2PSO A;  4IGV A;  3E85 A;  2GKD A;  4A8G A;  2KF2 A;  2Q3Q A;  2A1L A;  3H3T A;  1E09 A;  3QN1 A;  5AMW A;  2LUZ A;  2L65 A;  1XN6 A;  3P0L A;  2E3O A;  1QMR A;  3GTS A;  1LN1 A;  3NEG A;  4QDC A;  4A81 A;  4N41 A;  1XFS A;  4BK7 A;  4LA7 A;  3NEF A;  5E4B A;  4IH2 A;  2NS9 A;  4Z3L A;  4DS8 A;  4NCB A;  3OJI A;  3NJ1 A;  3K90 A;  3GL0 A;  4BTZ A;  2LIO A;  2ZYL A;  4KPY A;  5I9J A;  2Z9Z A;  1BTV A;  2M89 A;  2LEQ A;  1XN5 A;  4Q0K A;  3NJ0 A;  1X53 A;  3NQN A;  3OQU A;  3QSZ A;  3GB4 A;  4N3E A;  4BKC A;  2EJX A;  4JHH A;  4QDF B;  1XUV A;  3Q64 A;  4Y31 A;  3OTL A;  4IGY A;  3DLB A;  4C9C A;  2KCZ A;  3Q6A A;  4REH A;  1T27 A;  4A80 A;  4A8V A;  2L9P A;  4JDL A;  1TXC A;  4FPW A;  5E46 A;  5EKQ C;  3FO5 A;  2YH6 A;  3F73 A;  2E3P A;  3NMP A;  3GTE A;  2KTE A;  4JHI A;  3NI8 A;  4M9B A;  4QCK A;  3F08 A;  3UJL A;  4C94 A;  4WVO A;  5BRL A;  1LN3 A;  2N4B A;  1TW0 A;  2QPV A;  4A83 A;  4QDD A;  3ZVU A;  1FM4 A;  2QIM A;  3IJT A;  2IL5 A;  2E3S A;  4JHG A;  3TVQ A;  2LCG A;  3H3R A;  5E4D A;  4LG5 A;  2L8O A;  4XRW A;  2VQ5 A;  3P9V A;  2KEW A;  3KDI A;  4IHR A;  4N76 A;  4RYV A;  3H3Q A;  3TFZ A;  3KAZ A;  2LPX A;  2VNE A;  3UQH A;  3NS2 A;  2FLH A;  3TVR A;  4OIC A;  3CNW A;  2E3R A;  3H3S A;  3K3K A;  1VJH A;  1FSK A;  2E3Q A;  4IGW A;  4XRT A;  1KCM A;  3C0V A;  3TL1 A;  2R55 A;  3KDJ A;  3HJF A;  4M9W A;  4N0G C;  1ZXF A;  3HK2 A;  3WG8 A;  3HO1 A;  4LGB A;  3KB0 A;  3P51 A;  5JNN A;  4A8U A;  4NCA A;  2LAF A;  3NMH A;  4MNS A;  4REJ A;  3IE5 A;  4A88 A;  4B9R A;  3HM9 A;  5C9Y A;  4BKD A;  3KLX A;  3HXM A;  2RES A;  3GKE A;  3DLH A;  1T17 A;  3RT2 A;  4E6F A;  1LLT A;  1UW5 A;  3ELI A;  1BV1 A;  2BK0 A;  3GL2 A;  4IGX A;  3UID A;  3NMV A;  3JRQ B;  2REZ A;  3PU2 A;  2PCS A;  2K7H A;  4DSC A;  2RER A;  4MA6 A;  1JSS A;  3NR4 A;  3R6P A;  4A85 A;  1B6F A;  2I9Y A;  4N47 A;  3RT0 C;  1H2O A;  1ICX A;  4C9I A;  5JO2 A;  3Q63 A;  2LAK A;  3GOB A;  3NMN A;  3HVR A;  1EM2 A;  2Z9Y A;  4MAP A;  4DSB A;  4QDF A;  3PUT A;  4QIP A;  2LF2 A;  3OH8 A;  3JRS A;  3NJO A;  4JDA A;  4PSB A;  2WQL A;  2D4R A;  2M47 A;  4A86 A;  1LN2 A;  2FFS A;  2NN5 A;  4R7K A;  1Z94 A;  4JHY A;  4A84 A;  2E3M A;  1IFV A;  2LDK A;  3KAY A;  3KB3 A;  3RD6 A;  3W9K A;  2E3N A;  4BK6 A;  4GY9 A;  5JO1 A;  2K5G A;  3GGN A;  4LGA A;  3KDH A;  2MOU A;  2LGH A;  2N4A A;  1XDF A;  3NMT A;  4REI A;  3W9R A;  2LE1 A;  3KL1 A;  5E4M A;  3TGO C; 
#chains in the Genus database with same CATH homology
 5I8F A;  4IH0 A;  4A87 A;  2PSO A;  4IGV A;  3E85 A;  2GKD A;  4A8G A;  2KF2 A;  2Q3Q A;  2A1L A;  3H3T A;  1E09 A;  3QN1 A;  5AMW A;  2LUZ A;  2L65 A;  1XN6 A;  3P0L A;  2E3O A;  1QMR A;  3GTS A;  1LN1 A;  3NEG A;  4QDC A;  4A81 A;  4N41 A;  1XFS A;  4BK7 A;  4LA7 A;  3NEF A;  5E4B A;  4IH2 A;  2NS9 A;  4Z3L A;  4DS8 A;  4NCB A;  3OJI A;  3NJ1 A;  3K90 A;  3GL0 A;  4BTZ A;  2LIO A;  2ZYL A;  4KPY A;  5I9J A;  2Z9Z A;  1BTV A;  2M89 A;  2LEQ A;  1XN5 A;  4Q0K A;  3NJ0 A;  1X53 A;  3NQN A;  3OQU A;  3QSZ A;  3GB4 A;  4N3E A;  4BKC A;  2EJX A;  4JHH A;  4QDF B;  1XUV A;  3Q64 A;  4Y31 A;  3OTL A;  4IGY A;  3DLB A;  4C9C A;  2KCZ A;  3Q6A A;  4REH A;  1T27 A;  4A80 A;  4A8V A;  2L9P A;  4JDL A;  1TXC A;  4FPW A;  5E46 A;  5EKQ C;  3FO5 A;  2YH6 A;  3F73 A;  2E3P A;  3NMP A;  3GTE A;  2KTE A;  4JHI A;  3NI8 A;  4M9B A;  4QCK A;  3F08 A;  3UJL A;  4C94 A;  4WVO A;  5BRL A;  1LN3 A;  2N4B A;  1TW0 A;  2QPV A;  4A83 A;  4QDD A;  3ZVU A;  1FM4 A;  2QIM A;  3IJT A;  2IL5 A;  2E3S A;  4JHG A;  3TVQ A;  2LCG A;  3H3R A;  5E4D A;  4LG5 A;  2L8O A;  4XRW A;  2VQ5 A;  3P9V A;  2KEW A;  3KDI A;  4IHR A;  4N76 A;  4RYV A;  3H3Q A;  3TFZ A;  3KAZ A;  2LPX A;  2VNE A;  3UQH A;  3NS2 A;  2FLH A;  3TVR A;  4OIC A;  3CNW A;  2E3R A;  3H3S A;  3K3K A;  1VJH A;  1FSK A;  2E3Q A;  4IGW A;  4XRT A;  1KCM A;  3C0V A;  3TL1 A;  2R55 A;  3KDJ A;  3HJF A;  4M9W A;  4N0G C;  1ZXF A;  3HK2 A;  3WG8 A;  3HO1 A;  4LGB A;  3KB0 A;  3P51 A;  5JNN A;  4A8U A;  4NCA A;  2LAF A;  3NMH A;  4MNS A;  4REJ A;  3IE5 A;  4A88 A;  4B9R A;  3HM9 A;  5C9Y A;  4BKD A;  3KLX A;  3HXM A;  2RES A;  3GKE A;  3DLH A;  1T17 A;  3RT2 A;  4E6F A;  1LLT A;  1UW5 A;  3ELI A;  1BV1 A;  2BK0 A;  3GL2 A;  4IGX A;  3UID A;  3NMV A;  3JRQ B;  2REZ A;  3PU2 A;  2PCS A;  2K7H A;  4DSC A;  2RER A;  4MA6 A;  1JSS A;  3NR4 A;  3R6P A;  4A85 A;  1B6F A;  2I9Y A;  4N47 A;  3RT0 C;  1H2O A;  1ICX A;  4C9I A;  5JO2 A;  3Q63 A;  2LAK A;  3GOB A;  3NMN A;  3HVR A;  1EM2 A;  2Z9Y A;  4MAP A;  4DSB A;  4QDF A;  3PUT A;  4QIP A;  2LF2 A;  3OH8 A;  3JRS A;  3NJO A;  4JDA A;  4PSB A;  2WQL A;  2D4R A;  2M47 A;  4A86 A;  1LN2 A;  2FFS A;  2NN5 A;  4R7K A;  1Z94 A;  4JHY A;  4A84 A;  2E3M A;  1IFV A;  2LDK A;  3KAY A;  3KB3 A;  3RD6 A;  3W9K A;  2E3N A;  4BK6 A;  4GY9 A;  5JO1 A;  2K5G A;  3GGN A;  4LGA A;  3KDH A;  2MOU A;  2LGH A;  2N4A A;  1XDF A;  3NMT A;  4REI A;  3W9R A;  2LE1 A;  3KL1 A;  5E4M A;  3TGO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...