2LQ7A

E2 binding surface on uba3 beta-grasp domain undergoes a conformational transition
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
GSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8-activating enzyme E1 catalytic subunit
publication title E2-binding surface on Uba3 beta-grasp domain undergoes a conformational transition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 17
structure length 97
sequence length 97
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08825 E2_bind E2 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 2lq7A00
3KYDB 4W5VB 2NVUB 2LQ7A 3ONHA 1Y8QB 5FQ2B 1Y8RB 3KYCB 3FN1A 3ONGA 1Y8XB
chains in the Genus database with same CATH superfamily
5LMUD 1FKAD 2ZTBA 1N32D 2UXCD 3J81E 4JI1D 1C05A 4JI2D 2K6PA 2ISTA 4LGTA 2E5LD 4LFAD 4LF9D 1XMOD 4JI5D 4DV1D 4X64D 4DUYD 3J80E 2ZM6D 1C06A 1JH3A 3HP7A 4B3TD 3KYDB 4JI7D 3JAME 4DR1D 4LF4D 3J7AF 2I1SA 4KHPD 4II2A 5FLXE 4YHHD 4DV7D 4LFBD 4JV5D 4DV3D 4NXND 4JI4D 4LF7D 1P9KA 3CMMA 5IWAD 3ONHA 2JANA 3T1YD 1KSVA 1FJGD 2UUBD 1HNWD 5FQ2B 1HNZD 2UXDD 3FN1A 4LF6D 4DR2D 4GKKD 2UUCD 4OX9D 1XNRD 4DR4D 4DV2D 1J5ED 1KSLA 3ONGA 2VQED 4JI6D 1IBMD 4DV4D 4LF8D 4DV0D 3KBGA 1HNXD 2HHHD 4DV5D 2UU9D 4DR5D 4LF5D 3OTOD 1KSKA 1Y8XB 1XMQD 1N36D 4B3SD 5LMND 4JI3D 4JI8D 1Y8QB 1XNQD 1VIOA 4X62D 4DR3D 1N34D 4II3A 3T1HD 5BR8D 4X65D 4OUDA 4GKJD 5A2QE 4DR6D 1H3FA 1HR0D 4JYAD 2KTLA 4NNJA 4X66D 1I94D 1IBKD 4LFCD 2LQ7A 5IT9E 3DH3A 4JI0D 2UUAD 4B3RD 4AQYD 1H3EA 2F4VD 5LL6S 4NXMD 2VQFD 1Y8RB 2UXBD 4K0KD 4YY3D 4DUZD 1IBLD 4DR7D 4W5VB 2NVUB 1N33D 1DM9A 3KYCB 4DV6D 5KNLA 4B3MD
chains in the Genus database with same CATH topology
3KYDB 4W5VB 2NVUB 2LQ7A 3ONHA 1Y8QB 5FQ2B 1Y8RB 3KYCB 3FN1A 3ONGA 1Y8XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYD B;  4W5V B;  2NVU B;  2LQ7 A;  3ONH A;  1Y8Q B;  5FQ2 B;  1Y8R B;  3KYC B;  3FN1 A;  3ONG A;  1Y8X B; 
#chains in the Genus database with same CATH topology
 5LMU D;  1FKA D;  2ZTB A;  1N32 D;  2UXC D;  3J81 E;  4JI1 D;  1C05 A;  4JI2 D;  2K6P A;  2IST A;  4LGT A;  2E5L D;  4LFA D;  4LF9 D;  1XMO D;  4JI5 D;  4DV1 D;  4X64 D;  4DUY D;  3J80 E;  2ZM6 D;  1C06 A;  1JH3 A;  3HP7 A;  4B3T D;  3KYD B;  4JI7 D;  3JAM E;  4DR1 D;  4LF4 D;  3J7A F;  2I1S A;  4KHP D;  4II2 A;  5FLX E;  4YHH D;  4DV7 D;  4LFB D;  4JV5 D;  4DV3 D;  4NXN D;  4JI4 D;  4LF7 D;  1P9K A;  3CMM A;  5IWA D;  3ONH A;  2JAN A;  3T1Y D;  1KSV A;  1FJG D;  2UUB D;  1HNW D;  5FQ2 B;  1HNZ D;  2UXD D;  3FN1 A;  4LF6 D;  4DR2 D;  4GKK D;  2UUC D;  4OX9 D;  1XNR D;  4DR4 D;  4DV2 D;  1J5E D;  1KSL A;  3ONG A;  2VQE D;  4JI6 D;  1IBM D;  4DV4 D;  4LF8 D;  4DV0 D;  3KBG A;  1HNX D;  2HHH D;  4DV5 D;  2UU9 D;  4DR5 D;  4LF5 D;  3OTO D;  1KSK A;  1Y8X B;  1XMQ D;  1N36 D;  4B3S D;  5LMN D;  4JI3 D;  4JI8 D;  1Y8Q B;  1XNQ D;  1VIO A;  4X62 D;  4DR3 D;  1N34 D;  4II3 A;  3T1H D;  5BR8 D;  4X65 D;  4OUD A;  4GKJ D;  5A2Q E;  4DR6 D;  1H3F A;  1HR0 D;  4JYA D;  2KTL A;  4NNJ A;  4X66 D;  1I94 D;  1IBK D;  4LFC D;  2LQ7 A;  5IT9 E;  3DH3 A;  4JI0 D;  2UUA D;  4B3R D;  4AQY D;  1H3E A;  2F4V D;  5LL6 S;  4NXM D;  2VQF D;  1Y8R B;  2UXB D;  4K0K D;  4YY3 D;  4DUZ D;  1IBL D;  4DR7 D;  4W5V B;  2NVU B;  1N33 D;  1DM9 A;  3KYC B;  4DV6 D;  5KNL A;  4B3M D; 
#chains in the Genus database with same CATH homology
 3KYD B;  4W5V B;  2NVU B;  2LQ7 A;  3ONH A;  1Y8Q B;  5FQ2 B;  1Y8R B;  3KYC B;  3FN1 A;  3ONG A;  1Y8X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...