2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
molecule keywords Transcription antitermination protein nusG
molecule tags Transcription
source organism Thermotoga maritima
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
1VQLA 1JJ2S 2XHCA 2EIFA 3ER0A 1VQ6T 1Q7YC 3OW2A 1NJIC 2LVMA 3J81E 3CCRT 1VQ5T 2JOYA 3G6ET 1VQ4A 1QVGS 3CMET 1W2BA 1VQKA 1VQNT 3CCVT 1KQSS 1VQ7A 1SSFA 3PIOA 3I55T 1K9MC 1YJWA 3PIPA 3CMAT 5DM7R 3CCJT 1RL2A 3CCUT 1Q7YU 1IZ6A 3CC7T 2K06A 1UEBA 3G71A 1YBYA 2DO3A 5DLQE 2JVVA 3OW2S 3I56A 1S72A 3P8BB 5J3BA 3CCQA 1K9MU 1M1KC 3CC2A 3CD6A 2OTJA 4ZN3A 3CXCA 1M90U 3G4SA 2KDSA 3J80E 1VQKT 3DB3A 5HY6A 1XNIA 1YJNA 3DLLA 3J7AF 4RG2A 3H7HB 3CC4T 1YIJA 3CCMT 2QA4A 3LGLA 1Q82U 1K73C 3CPWA 3LH0A 1YITA 2MWOA 1KC8C 1YHQT 1VQPA 1M1KU 3CCLA 1YI2A 1M90C 3DB4A 2EXUA 3G71T 2MWPA 2KVQG 1VQ8A 1VQLT 1VQ6A 3QQCD 1JJ2A 3TREA 3I56T 1Q81U 1NZ9A 2OUGA 1Q82C 1VQOA 1KD1U 3CXCS 1K73U 2CKKA 4CRIA 2MI6A 1NPRA 1K8AU 1VQ9A 2E70A 4ZN1A 3CCEA 1W2BS 2L3RA 3OYYA 1KC8U 2QEXA 1VQNA 3CCVA 1VQ4T 1QVGA 1YJ9A 1XTDA 3I55A 5IT9E 2JNGA 1VQMA 1QVFA 4QQDA 1VQ7T 1Q81C 3CCJA 3CCSA 2JUFA 3CCUA 1YIJT 1KD1C 1Q86C 3LPEA 1YJWT 1K8AC 2OTLA 1EIFA 1BKBA 4YTLA 4X34A 1VQ8T 2G3RA 1M1GA 3JAME 2LCLA 1N8RU 3CPFA 5FLXE 1VQPT 1S72T 3LGFA 1VQOT 1M1HA 1NZ8A 5A2QE 1VQ9T 3CCQT 1Q86U 3CC2T 3CCET 3CD6T 3CCRA 1X6OA 1VQ5A 3G6EA 2OTJT 2IG0A 1NPPA 3KBGA 2QEXT 3CMEA 1QVFS 1KHIA 3G4ST 1YJ9T 1N8RC 3HKSA 1VQMT 2LQ8A 1YJNT 3CC4A 3CCMA 1KQSA 3CCST 2E6ZA 3CPWS 3CMAA 3EWGA 2QA4T 1NJIU 1YHQA 3CC7A 2OTLT 5LL6S 4TVRA 1YITT 3A5ZB 5J26A 5IAYA 3CCLT 1YI2T
chains in the Genus database with same CATH superfamily
2MEWA 3CULA 1IBKF 1VQ5S 4Q0BB 2B4UA 1GXUA 4B02A 4LBIA 1BD6A 1X75C 4LUBA 5J2QA 4X9DA 2A18A 4OHXA 2KZZA 3HJVA 5E3PA 4K11A 3WZ0A 4JZ4A 1VK3A 4AFZC 3OVBA 3VAIA 3BKFA 1P27B 5KFMA 1P9QC 4KH1B 3EZOA 5GADI 4RUGA 2ZBIA 3MURP 1VDHA 2KDSA 5GAMe 2AMCB 4RUHA 3FNNA 1DARA 2Y0BB 1IQTA 2J6FA 4K0KF 2ZH9A 2IA6A 3VTIA 4EIKA 2JZ2A 3PIPQ 4YFUA 3C15A 4J8OA 4C2MA 2PUOB 3W65A 3GIKA 3TJAA 3PW0A 2VC8A 5BXIA 3THVA 3SDZA 2E5IA 1LPLA 5KT5A 1R8AA 1VR6A 4XAKA 3PFSA 1NE8A 2AX0A 2E7XA 3HX9A 2K9GA 2QQRA 1YWXA 2OD6A 1TTHB 1WDXA 2VQEJ 1MROB 1KHCA 1GCPA 4NLRA 4FBUA 2PVOB 1NLKL 1M9SA 4ED2A 2A6MA 1YKWA 2BOAA 4DOVA 4I2PB 4CM2A 2JX2A 1BMQB 1EJ7L 2HEQA 1SEMA 1N36J 4WYLA 4V19X 3JSMB 3GYXB 1N6QA 3KK2A 1FKPB 4DFMA 3BBFA 4YDDB 3SIPB 3K8VA 1JB0E 4H4KA 3J80Y 1XK8A 2F1LA 3HULA 3KKFA 3GFZA 4ZPWR 2IDLA 3LUYA 2ZKTA 4J9MA 1HMVA 2C2KB 4URSA 1M5KC 1MMDA 2YHTA 4J9OA 2K3XA 1KBRA 1Q86T 1TAUA 4OJ3A 2QX0A 2PQWA 2JSXA 4NI2B 3OUYA 3HHLA 3BKUA 3QG1A 2F9JA 2VICA 3IM8A 1D1AA 4RTTA 2GNKA 5CYQB 5KG3A 3CIZA 2CT3A 2EWNA 1KHIA 2G4BA 4O4GB 1TOVA 3EH1A 1FRHA 2CP6A 4IDKB 3G8SA 1YG0A 3EGUA 1QJHA 2OEMA 4KRWA 2ACYA 4X1VA 1R27B 4CC7A 1ELOA 5F41A 4X4UA 3QJPA 2D3O1 4MH8A 1VQYA 3CC7Q 2KT8A 4DX5A 4OYPA 3MTKA 4L5GA 3JCMc 5F8GA 5J2MB 2ENMA 1N56A 3H5YA 1HK9A 2MMPA 1Q7YR 2EQKA 1Q0NA 3O5TB 2XK0A 5CH7B 1PBUA 1D0YA 3H8ZA 3SXLA 1I4K1 2R8IA 5L1KA 3RYLA 4DV0F 4M5GA 3V7SA 1S72A 4CO0A 1C1CA 3FUYA 2ZJPQ 3HRTA 1F60B 4ALZA 1S1UA 2D3OR 2K4YA 1YJNA 5KT2A 1LXJA 2KFZA 7AT1B 4C0BA 5HMZA 1PJ7A 2UUBF 4ZTFA 2J8SA 4C9DA 4QVCA 5JVGQ 1RT4B 3IR7B 5HI7A 1PWTA 1VQ4S 2M8DB 3T6BA 3IBCB 4CM0A 3NTKA 1YIJS 4PFPA 4WF9Q 2HK2A 4YY3J 4JI4F 4ZVGA 3PW7A 4Z7CA 2R7RA 1RTZA 3SCIE 2V26A 3VAGA 3MAAA 3VS1A 2D1XA 4RUCA 1B7FA 4LBHA 2RB7A 3M2UA 3OYHA 3J81U 1I0CA 3CDWA 3DHXA 4Z7YA 2XMFA 4IO9Q 3S6EA 4DR6F 3OYEA 4WZQA 2RH2A 4PJMA 3MEGB 3NS5A 4RNMA 3ER0A 4CRJA 4U8VA 1YBAA 3CJKA 3DHWC 1TVRB 1S59A 2L9DA 3ZTPA 1KQSS 2Q66A 1G8XA 5LJ3e 3DCAA 1KR4A 4X4NA 3QWUA 2K3BA 1TZ0A 2CP3A 3OSVA 2FUG9 2QIFA 1JIHA 2J0QD 5F0UA 2L5QA 2HBPA 3QSUA 5IV4A 2M88A 2HHXA 1WWHA 2BQUA 3OYNA 2PC6A 1PCAA 2E66A 1ZSZB 5GJVB 2MZRA 1Q8BA 2RRAA 2CQIA 3JCMW 3J81j 3G71S 3AJDA 4QYZK 5D0EA 4BC9A 4LF5J 1K8AU 9ATCB 3A4TA 3MHXA 4PXBA 1VQMA 2HHPA 3EJMA 4OVAA 4YMEA 2DR6A 4X64F 2JM9A 2HHHJ 5GAMd 4CYUB 4YDXA 3CJ4A 4NOYA 2D6FA 2KYBA 3VU3C 2H54B 3AQPA 3DMJA 3NFCA 3RTVA 1DTQA 4H4MB 1WJ9A 3T1HJ 1TV6A 4KUDK 4P73A 5GAMh 5CXTA 2DL4A 5KFUA 5FU7C 1GMWA 4ES2A 1MLAA 5GMDA 3JCMb 3QJYA 6FDRA 3OD2A 3BEGB 3HT0A 4PWUA 4IG3A 3MEEA 2O01E 4N0AC 1HBUB 4RW9B 1REGX 3QFWA 3HKZD 6AT1B 1SC1B 2NQPA 2AZ1A 1Q95G 2XBPA 4ANEA 1T02A 2QYGA 1WJQA 2NUHA 4TYBA 3QPIA 2E9RX 4DA4A 1K44A 2CWXA 1NEBA 3K17A 1N5YB 2K5IA 1FEHA 3JB9J 3CXCA 3RNJA 4USWA 3VV0A 5K20B 1SIZA 1PRMC 3A1YG 2ZJQQ 2C3YA 2XLIA 1WHWA 2FJWA 4OI1A 1PKUA 3KFWX 4MTPA 3LP2B 5KYXB 4B6MA 2CKKA 3FC9A 1A6LA 2BKPA 4N56A 2VG6B 3DYAA 3TAMA 1U26A 1UWBB 4P6QA 4XU0A 5FD1A 3ZZUA 4RUBA 1EIFA 3O3LA 4N76A 4J9GA 2B5JA 2MKCA 4NA3A 3AQOA 1S57A 2XNQA 1U1OA 4CH1A 4XDDA 4FBTA 3CC2T 3THPA 2FRWA 1QVFS 4G1QA 2G0JA 2AHJB 1Q8IA 2OTLS 1WZOA 2YPZA 3I0SB 3KUGA 4JI6F 3OYMA 5I42A 3VGSA 2VJUA 2HS0A 3JSRA 4JI2J 2E7VA 3NOGA 2XS2A 1XTZA 2OI2A 5IHKA 2DIGA 4LF1A 1TU0B 1VS3A 3HT3A 4ELUA 2QLWA 1WDDA 1GT8A 1M2OA 2DHXA 2RS2A 2DA9A 1K9MC 2IRUA 3H20A 3FRNA 3DOKB 3MZIA 1ZSGA 3EGNA 3G87A 2CPFA 3VHQA 3QT5A 2L0AA 2BDPA 1NB7A 5IT9Y 4A8QA 4LMZA 2FYKA 1NHVA 1XNIA 4ZGEB 3TEHB 3RESA 3ZZPA 4IUFA 4O3PA 3W2WA 2Y8YA 1YITA 2VWFA 3VAJA 5D8HB 1ZZNA 3JB9I 2HNYB 4Q8FA 4IFYA 3R7SB 2KO1A 3RAQA 4J5YA 4C5EA 4DR3J 4M7AE 3M8ZA 1J5OB 2MPXC 3DLMA 1M8VA 3EGDA 5I3PA 3ZXWA 4LR8A 1KG1A 1HXDA 4ED8A 4U7CA 4DV7F 2VPXB 1S72S 1MU2B 2KM8B 3TZYA 1M2VA 1PD0A 4RBVA 1JXLA 1QE1A 1YJNS 1DJ0A 3BM7A 3CWJA 2W4DA 1UA0A 4BB7A 1X0PA 4LUDA 2XWYA 2M8HA 1J5EJ 1OMSA 2BJ1A 2HQDA 2WVBA 3ZNUA 1FDDA 1X4AA 3D28A 3RDVA 1U7LA 1H92A 4B08A 2ZFHA 1WTFA 2DXEA 4NLYA 3PIPA 5GAOq 2BUNA 1IZ6A 1VJQA 1HI1A 2X4JA 4UOGA 3O2IA 2L48A 4DJBA 2QYCA 3Q8YA 1KC8T 3BGOP 2LDMA 1Q82U 3HSDA 2RJCA 1WKLA 5LJ3d 4DR7J 3L2QA 4DV6J 5LMNJ 2HS4A 1U5SA 4M95A 3TEGA 1KSWA 5IHNA 2R7TA 4CRIA 5IN1A 2CUYA 1UW9A 2KI7A 1B07A 1V6HA 3OS5A 3I5RA 2R8GA 4NLGA 2ZEJA 3P45B 3EDRB 5LJ3h 4ANDA 3PACA 4OGEA 2QLFB 3RIRA 4MK8A 1Z9ZA 2UV8A 1HNVA 4J5OA 5HMXA 4J6XA 2DTOA 3BS9A 1M27C 1S77D 2KVQE 2RM4A 1MMLA 3O8WA 1BQNA 2OFGX 2ATLA 1R6VA 2FVQA 1OPIA 2HQ3A 2BTTA 1V5IB 3BGRA 2ZWOA 2O9VA 1H73A 4F04B 4B9UA 2YNFB 2GHWA 2F7VA 3CCVT 1MHNA 2RDJA 2VDHA 4RL1A 2RNAA 3GWCA 2A28A 1NJWA 4M77C 4OGCA 2B8PA 3IWNC 2WVDA 2ZOGA 3NGDA 5DLQE 5E5NA 4RTVA 4KFBB 5C7PA 4OMFB 4RW8B 2X1FA 2R7VA 2XMVA 3N5BA 3LWLA 3OBWA 1NDPA 4B3SJ 4ZNXA 3DKMA 2AJ1A 4ANCA 1SPBP 3HHKA 2A1BA 4WKYA 4RTYA 5FLXY 3DOMA 5HAOA 1IGQA 1P9YA 3X3UA 1SKWA 4URGA 4QQBA 4PWDB 2FHDA 1YJTA 2B43A 5ETSA 3TUIC 1XR6A 1JX4A 1FK9B 3GLJA 4P7VA 2ZGWA 4B9SA 2IDEA 1L3UA 3TYTA 3HFKA 3FB9A 1WUUA 1FYNA 3ENAA 2RQ4A 1G6BA 1VQ8S 1SQEA 4DR5F 2CZVC 2DO0A 4GY5A 3T5JA 1HLWA 2DR8A 4R5PB 2JEGA 1S9GA 4GKKJ 5IT0A 1YP5A 1T0TV 1LOJA 2RT3A 4TLRA 5HP1B 3CJ5A 3QRQA 4B9TA 2QTXA 3DRXA 3CMEQ 2W9BA 2JOQA 2DPPB 3URGA 4OX7A 2CSQA 3BZQA 4GLKA 5T7LA 4ED3A 4FW1A 3M6WA 1VQNT 3KFVA 2AYBA 4CP5A 1BLUA 5FJ4A 1K1ZA 3PNIA 3MUTP 1T05A 4E7JA 3MHYA 4XTYA 2UVRA 1HNXJ 1PKTA 1U09A 2VFUA 2C1EB 3HD1A 3I5AA 1VC6A 3CCMQ 2DR7A 3UN3A 2HAXA 1IGUA 4AQYJ 4C8LA 2V2QA 1FRIA 1H3DA 4IH7A 2M02A 5H9EK 3OTOJ 1H38A 1SC3B 3ZZRA 3OB9A 3NGRA 5A8WA 1QAYA 1EP4A 3RB3A 1OWXA 2DGWA 3RUXA 4M78B 1Y57A 3TU4K 1FWKA 1ZBXA 1YJWQ 4N4GA 2L89A 1K8AT 1T0JA 4C8OA 5CIUA 4EMDA 4RKUE 3T5HA 2OPRB 2BM1A 4M7DE 2OPSB 2F9DA 1AT1B 3OYBA 2GHVC 2IHR1 2LEBA 2AQ4A 2DJWA 1WOOA 3FFIB 4DDFA 1JKHB 5E2QA 2OH2A 2W24A 3QWYA 1YITS 1SRMA 3H0PA 3OFEA 1S6OA 3JTNA 2NUPA 2QSWA 5C0MA 1H7XA 1D8ZA 1W26A 1WXTA 3VS0A 2B4VA 3ADAC 1XJWB 1VA7A 5L46A 1LXNA 3NAHA 2OX7A 3NEKA 3H2LA 1IKXA 3R9LA 2DPIA 4PPZA 3I5CA 2OLWA 4C8QE 1S76D 1NJIR 1X9WA 2HG4A 1RJJA 3HVTA 4K4YA 4G65A 4LFBJ 3VWSA 1RXOB 2MQQA 2EG1A 1CS4B 3C16B 3P8BB 2HGNA 4QOTA 2V8HA 4O0NA 3W61A 5C2GA 3GSDA 2BA9A 4ZCKA 5FWBA 1K9MU 4P71A 2DO4A 4JBCA 5D0HA 3AY0A 4MMLA 1I81A 2HQCA 1NJYA 5LMUF 2LMIA 4CO3A 5IM0A 2HQHA 4OB3B 1RT2A 2VG5A 3F73A 4JV5F 3W66A 1UEUA 3HVAA 2YVSA 2CPEA 2HURA 1QWFA 1VQOA 3UD4P 2FPHX 3QSIA 3EMTA 2ZBCA 4FP9A 1WKJA 3JAMU 3VAFA 5D15A 5CVIA 2ED0A 2HMIB 2ASLA 4YB6A 4DPTA 3MUMP 1OJ4A 2HMAA 5FWCA 3CCQQ 4U7UK 1EETB 4O5VA 2P9CA 2VVKA 3BR9A 3EVWA 5AXNA 4JV0A 3X28B 3MEDA 4DQPA 3VJPA 4B3TF 4USHA 4C0DB 3NGKA 2MQOA 1VIEA 2EVZA 1IO6A 2NSBA 1IBKJ 1B34B 5EC7A 3CJRA 3A3NB 4FXWA 4NYOA 3L9ZA 3T5LA 2KL8A 2J0XA 2LVWA 4IURA 1NK9A 4HVWA 1S12A 4OMOA 2JEFA 3TI0A 3I55T 1GX6A 3M0PA 1RL2A 3DOLB 4LN2A 1Y0HA 2GTOA 3HHTB 2VH7A 1NSKL 3RGIA 2M16A 3P8DA 3LP0A 2Y1RI 1YRXA 5ETTA 4ZN3A 2EJFA 4K0KJ 4M5KA 1CJVA 2WONA 1WTBA 5HO4A 2H4YB 4ZLNA 2GVZB 1NEGA 3B78A 3LH0A 2OEKA 2KY9A 3M8PA 4BWMA 2YKMB 4TLQA 4C11A 3EHQA 3SB2A 3H9NA 1LVKA 2HAFA 3U02A 3IA0A 3CO9A 1O8BA 3RU0A 5B0DA 1DJ7B 1O0PA 2RF2B 4FS2A 2WRMA 5C25B 5ETLA 3BQ0A 1IRXA 1AWOA 3ELHA 4HACB 4LIWA 4DZDA 1V5VA 4F02A 1Q86R 2MDAA 4LIRA 3LF0A 1EFNA 3LYIA 1HWJA 5B0EA 1XMBA 3HCXA 2FVSA 1Y96A 3G6EA 1T7PA 2DGUA 3KLFB 1BCMA 2ZHBA 2M4MA 4M7AA 4QIWD 4JRIA 2FJXA 4PJOF 4PJOG 1I1JA 1LKZA 2CVEA 4PNOA 5GAMf 2EQIA 4JI0F 1OZ3A 4PG6A 2KQWA 3KJVA 3Q8PB 1WXBA 4RLEA 2HBRB 3NTHA 4C4WA 2V4RA 4C8NA 2CREA 4V2SA 2YNHB 2J76E 2Y90A 3CC7S 4DSEA 2MTLA 2AKKA 2KKHA 2MY7A 4NZ7A 1M5PC 1OS5A 4EMKA 3BQ1A 2VFRA 3OXLA 4HHJA 2VL1A 1QP3A 1N5SA 5HKCA 1NM7A 2VG7B 4EYHB 2Y3YA 2ZZNA 2B3TB 4QIFA 5KFOA 1FDBA 5E3QA 5MLCV 3FBCA 5EWEA 1HI0P 1TUCA 1QDUB 1KD1U 2ADBA 4NLXA 4MMOA 1YRTA 2QA4G 1XTDA 1HQUB 4ZVTB 1UGPB 2XSFA 2XO6A 4QCLA 2YDLA 3HSBA 2V2KA 4YTLA 3QYYA 4EGLA 1LOUA 3MOZA 2J06A 4TU9A 2ZE2A 2BM0A 4YR3A 3KUHA 3C15B 2HQIA 1JLGB 2ZBRA 3SEOA 3DI6B 3V4IA 2WZ1A 3GB0A 2X51A 4XK8E 3D2WA 5EUHA 2YT6A 4ZGDB 3UA7A 3G82B 1NDCA 4M63A 1GL5A 2VXFA 3TJ9A 1SL0A 3LGHA 1KONA 4ZPCA 1X60A 4ZJOA 2CYYA 2YNGA 1ZM9A 4JI3F 4J9KA 3M57A 3T9ZA 2CJAA 4KBMB 3REBB 3FBFA 4RW7A 2DD4A 1KRPA 2IYIA 2BJEA 1CPZA 2RAQA 1NB2A 4ENOA 4MMKA 1QSLA 3EFOA 2JFDA 1M3CA 2EFPA 3SFUA 1M1KC 4LD9K 1S9EB 5GAGU 3EG0A 5L1JA 3CCTA 1N6QB 3TVKA 1UEKA 1PAEX 3DLJA 3RRGA 5B08A 1W1FA 4Y34A 1B99A 4O3SA 2GV1A 1D3BB 4ZLPA 2JS2A 1RT6B 3OYYA 4DLGA 2QEXA 3M59A 2CDTA 2V9KA 4JI4J 4QVDA 4DLEA 4ILRA 2FZGB 2HSPA 4P2MA 3GONA 3HHDA 2HVDA 1FNOA 3H4BA 1S6PA 3KLHA 2IVMA 3OV7A 1GK8A 1RTHB 3OR1A 3VS7A 4M7DD 4LF6F 1T3NA 4DR6J 4KHMA 1RZMA 3CMAA 4DSFA 3GPAA 4F16A 1NRKA 2WSEE 2LX7A 1S1WA 1VFJA 1VQOS 2FTRA 2MLZA 1T3SA 1Q5VA 5IOLA 2XMAA 1SH3A 1B3TA 1W4SA 2M5YA 4EBDA 2E5GA 3MR6A 3OFGA 3WX4A 3QXEB 4C8MA 4USKA 3GOXA 2R7XA 1OU8A 2QDLA 4WP9A 1C6VX 2A6OA 1YBYA 1HBMA 1WHKA 3HFZB 3CJ2A 2R7SA 1GBRA 5KYYA 2X3GA 3V6DB 3W8GA 2K5LA 4C5IA 2F63A 2GVDA 2BANB 4OYIA 1HNZJ 2XCAA 3VAMA 2BJ7A 1C0UA 5CKEA 2HK3A 5A6WA 3C6TA 3OL6A 2LQ9A 4X64J 3CCEA 2FG0A 3Q23A 1J27A 1OPLA 2WTFA 4C48A 3HP9A 3ZNJ1 4X4RA 2RA2A 4PKDB 2YWGA 4NZ0A 2G3RA 4ZVFA 1NSPA 2LCLA 5KE2A 2AHOB 5LJ3f 1FF2A 3G6VA 2BOPA 2PT0A 3IWXA 4NLDA 2IPOB 4FF3A 4CZCA 4XTWA 2CIMA 1PGZA 3RMSA 3CCMA 2MSTA 1UKUA 3S6WA 3D6MB 4H4KC 1RTIA 2YX1A 1Q4RA 3NHNA 5BYSA 3UA6A 1YVFA 3JTOA 3V6KA 1O5JA 2RHSB 4RWXA 4M7DA 5DDOC 4YHHF 4HYKA 4OZ5A 2WACA 1E6VA 2RQVA 4U95A 2SEMA 3LP1B 1YQHA 1YJWA 4YN3B 3ILJA 4UOHA 1IR1A 5IXFA 4KE5A 4A47A 5L1LA 1X4HA 4KR0B 1CQMA 5KFNA 1QD1A 1HW8A 2V1QA 1MWQA 5DQHA 3HHLC 4BDYA 1SH2A 5CK9A 4ZOSA 2JLGA 3G6ES 3VS2A 1U47A 1NH7A 2BBEA 3M1VB 2O2OA 5LJ3Y 4N77A 1PNJA 1ARKA 4RCBA 4BE2A 3KK3B 3WIUA 3MEWA 5M9OA 4LFCF 4LF2A 3TQEA 2M0YA 3RR8A 3DLLQ 2VFSA 4DX6A 1CKAA 2CNNB 3AJ1A 3Q8SB 1UA1A 4IKAA 4ZCIA 2QC3A 4Y28C 3MMAA 1VC5A 1QMCA 1YZ7A 1S1XA 4YR2A 3KHRA 3CC2Q 4BLGA 2DTIA 3N5FA 3NXZA 2QYZA 2QTWA 4ZHRA 1JU5C 4JI6J 2MJUA 4KQZA 2DYIA 3G4ST 3W9JA 3HK2A 2JC0A 1U1KA 1VQMT 1BXNA 2DNKA 4FXDA 4USJC 1WSRA 3IRWP 3Q0AA 2NR0A 4OJ1A 4OMNA 1KIKA 4CTAB 4PL6A 1VI7A 3THTA 4J9EA 2X4XA 4E2FB 1MWYA 4DSKA 2DD8S 1TV6B 4MIWA 1F6TA 2EC0A 1PG5B 3O6QA 1BIBA 3PNWC 5HVGA 4ZPAA 1IM6A 3CCQA 5GAMg 4ECSA 2R5MA 3ME9A 1UVLA 1Y9OA 2M52A 2C2DA 2DH9A 1WXUA 3CC4T 3OSNA 4H4OA 3PE0A 5GANj 2E7WA 3V5RA 4M75B 5KG2A 2NUZA 1KC8R 4IFVB 1HQ2A 4I6AA 3VVUA 4ED7A 4Q0BA 4DV7J 1G1XA 3I9ZA 1VQ7T 2DXUA 2J9CA 1U8WA 2OPQB 2V1RA 3ZFVA 2OFHX 4B9XA 3DC2A 2ROTA 4M77F 4M77G 2OSQA 1M1HA 2K3YA 3TAMB 1QUVA 2K8GA 2HNZB 2GHPA 2BKNA 3T1YF 1JQGA 4YEAA 4Q44A 1UVMA 2HRTA 4QWCA 3F0NA 4K4VA 2B5JB 1SJ3P 3EGZA 1ZA2B 1FESA 1W2IA 2XSJA 4TVRA 4X4TA 2FLLA 2PEBA 1WF0A 1TUGB 2NUTA 4QYRA 3GPLA 2KR3A 2NCKL 2EGAA 4RG8A 3A12A 1MUZA 2FY8A 5GAOl 3W8PA 3IBFB 4FF1A 1QAXA 1A9NB 3JQMA 1PYOB 1KQGB 2MB0B 1Q53A 1RBOB 2ZC3A 1TWBA 5KT4A 5LM7E 3SHWA 5I2MA 2AU0A 2E1PA 3E9GA 4NXMF 1HW9A 2H5EA 4OYAA 2LP5A 2UVVA 4CLKA 4YOEA 1M90U 3H6ZA 1KSPA 1SF9A 4M94A 2A08A 3V7CA 4B9VA 1S10A 3CMAS 4KHPF 1BWEA 3ZZ0A 4AE5A 1M1KU 3CD5A 3EVMA 2BABA 2KSSA 3IBWA 2AF6A 4TY9A 1EZZB 1JJCB 1HI8A 1MROA 5A2QY 1XEZA 2MZQA 2I2YA 1VRUB 2IM2A 1KD1T 1AA1B 4KT0E 4J7CA 3EG3A 2DNPA 2H1YA 2WHOA 2KTQA 5GAOr 1Y5LB 3W2WB 4DN0A 5ETRA 2EWHA 1PAUB 1DQAA 4DQRA 1JLBA 2DL3A 4I2PA 2V8GA 4J37A 3OW2R 2A3LA 3JSMA 2B9EA 2DXDA 3EGDB 1FKPA 1HSQA 2B6AB 2OGUA 1YGYA 3QNWB 5EWFA 3JXOA 3OA6A 3F41A 3AH6A 2IIHA 1WQ7A 4RNNA 1BIAA 1R0AB 2DEIA 2L08A 5H9FJ 5E3CA 1CLFA 3P8HA 1M2VB 3CCVQ 1ZA1B 2IRYA 3OFHA 2MAMA 1RU2A 1QVPA 1NHKL 3CMES 2CZ7B 2HVIA 3OTCA 3RKWA 2VB6A 2LCCA 2VHGA 4F36A 5ETKA 1M30A 2CUDA 2QQSA 2YWEA 4RO0A 4NI2A 1SRLA 2AEJA 7FD1A 2UVWA 1IKVA 3TQ1A 1XR5A 2CPIA 4C3KA 2VA3A 1KJWA 2FPEA 1HPZB 2F4FA 1RCOB 2LQJA 3KJFB 4OZJA 4ZVPB 3CCMS 3IM9A 3E1SA 3DLEA 4Z37A 4IDKA 2YQ1A 3GYNA 5DG8A 2QG9B 5F8NA 1PHTA 2DIVA 2QO3A 3TREA 1XWLA 3DDNA 8RUCA 4Q45A 1R6YA 3L95X 4DR5J 2UUAF 5CO7A 5B0BA 1S7IA 5J2MA 2E3IA 1YJWS 4KHRA 1X5TA 2CZ4A 2GMJA 2L9WA 3K58A 5THWA 2FEIA 4RU2A 1B0TA 5B7WA 3OL7A 3RBXA 1K8AR 2BYCA 3IGVA 3HLUA 3GTYX 4L72B 2HHQA 3GP9A 1UE9A 2BE7D 1IJFB 3TUPA 4CLLA 3JCMe 4DBFA 2KN4A 2GBQA 2LQWA 4LFAF 1Y3KA 2HVHA 1U06A 2DIUA 4Y91A 5I21A 1AUSL 3N01A 1W7WA 2MLYA 1LJOA 4X9CA 1IWAA 3RG6A 4B3RF 1VQNQ 3G6XA 1HNVB 3RRKA 3KUFA 3G86A 4BACA 5ETQA 3J81E 3OTEA 1RT4A 3QGHA 2K6DA 1BQNB 4QQGA 4Y6IA 1ZPWX 1KQKA 2I5JB 3FDSA 2ZZMA 2AV5A 1WF2A 1Y10A 1ZUUA 1KVJA 3PVLA 4I1TA 2HBQB 1TK5A 1GXIE 2MCNA 2RD5C 3IQLA 3MEGA 1HHSA 1BQMB 4DQ2A 3O1LA 3UNYA 2E5HA 2ABLA 1TVRA 3FC3A 2K57A 1RI9A 5J2NA 4D3HA 2EYZA 4M78E 1RWWB 1KP6A 1VRQC 5CQGA 4C0FA 3M0UA 4X34A 5E7OB 3M6VA 4PYDA 2L41A 3HRUA 3CPFA 3CCQS 3M55A 1LQ9A 2RJDA 5L39A 4ZA1A 3R5GA 3MMCA 1K1SA 2WCXA 1RI7A 4IOAQ 2VQFJ 1WC1A 2POKA 4DQQA 2LCSA 3FZ2A 1ZSZA 3N28A 4AL5A 3FMWA 3VF0B 3GZ7A 4OX9F 4DS5A 2EGCA 1CSJA 2ZITA 3AA9A 2ASDA 3BY7A 1RBLA 2QJ3A 1S1VB 1UECA 1SSFA 5HVHA 5HN0A 4A4GA 1G3WA 4RW4A 1F3FA 3CNQP 3CTRA 2HWTA 1VBKA 4CYUA 3TZZA 3JQJA 5JMNA 5LMUJ 2YPYA 3LW5E 4JV5J 3P49B 3HFNA 5DQIA 2GFUA 4QQ6A 1T05B 3RB6A 4RBUA 2AK5A 2C2EA 2DE0X 2X4YA 3BBBA 5A6PA 1UMJA 3BN4A 4RTXA 2M9UA 3NG8A 4DUZJ 4NLVA 5GMKa 2D69A 1RWKB 1HBUA 2MKHA 4RW9A 2EW9A 1GX5A 4LD6A 3B54A 2WBRA 2KI2A 4B3TJ 4NMXA 4NOHA 2BQ3A 1O75A 2Y4XA 2G2ZA 5MAOA 2OTJT 1M5OC 2GF7A 3A98A 2BRKA 4ZITA 2VU5A 5HCKA 2HGMA 4OHYA 1SXLA 2ZDPA 3MFHA 2CGHA 2MKIA 5KTQA 4OMMA 2B56A 3KHHA 1NO8A 3I55Q 2PEHA 1RACB 3LP2A 4I2QB 4JJBA 3SFGA 3FEZA 1SKSA 1Z2LA 4P7TA 2G1HA 2VG6A 3RBBB 5EX0A 1AHJB 1NCLA 2COYA 2NUPB 3DGPA 3TP2A 2HRYA 1JJ4A 5LJ5j 1BK2A 4BY6C 4ZLLA 1FXRA 3W2VA 5LXRA 2QLJB 3CC2A 4A8XA 4IRDA 2E4HA 3OT9A 2D41A 5GMEA 1UVJA 5AJ3F 3PEHA 5AYFA 3HJFA 4NLOA 3I0SA 5A0YB 5CAAA 2J7IA 3DB4A 2NYHA 4FYXB 2D7SA 3DRYA 1ABQA 2AZSA 3ITHB 3L2VA 3HHEA 5KFEA 4A4JA 3OQ2A 3Q86A 1IR2A 2YWKA 2BX6A 4IIMA 3R6NA 1YJ9A 1Q82R 4ZLJA 5EN1A 3TNVA 3LPEA 4IOCQ 5F3TA 4TY8B 2V8DA 8AT1B 1WI7A 1REVB 2XDPA 1IN0A 3NS7B 3DOKA 4BS2A 2NSCA 4U9RA 2GIQA 1NZ8A 1VQOT 4DEZA 3S3NA 1WC3A 4JI0J 2E12A 1RHQB 4A8KA 5A8KB 5IAYA 2LP4A 4EUVA 2B4PA 4PR6A 2VGMA 4USIA 3WC2A 3BH7B 2ERRA 5CAIA 1Q7YC 2CSIA 3ISND 3S3MA 4OMQA 3MOJB 4K4UA 1NYGA 2HNDB 4WU2A 4CT8A 3C46A 3JCMd 2RQWA 1SV5B 4DFKA 1LFWA 2X1BA 3PY8A 4ILMA 2I2LA 2BJ3A 2FJDB 1ZYQA 4DN9A 1R0BG 4TVAB 1SBRA 1MU2A 4WFAQ 3GR0A 5IC6B 1M90T 2Y4YA 1RYRA 3JCMh 2JFKA 3H42A 2DBKA 3SV3A 3J7YU 3M4YA 3IRXB 2MWPA 3NCQA 4NL3A 1WORA 3BSCA 1GXTA 3AB2B 1FFSB 1TL1B 2KYXA 2WONB 2DRMA 4KGXB 1QCNA 1VK8A 3DRSA 4CIOA 2C3PA 2AZVA 2RNEA 4PJOE 4C92B 4NCGA 4ZJQA 1S6QA 1PYTA 1FX7A 3O8VA 2V9WA 3EGWB 3MEUA 1CJUA 2W1BA 1NSQA 4A8MP 4MFBB 2DFUA 5FU6C 3V8JA 1M3BA 4EMHA 4NYPA 2ZPIB 2CP2A 1FNXH 3W5ZA 4ZP6A 4GO5X 4RPFA 4E6RA 1N4LA 2HYIB 5BR8F 2MQNA 1Q7LB 4JI3J 3ZTOA 2ZZTA 4OZNA 4WPAA 3NPFA 3V81B 3CCZA 1Y96B 3OYLA 1RA6A 3AT1B 5D6XA 3J81Y 2O01C 3GFXA 2DBBA 1C4AA 2EJGA 1SJFA 3G6ET 4M7AB 5IT4A 4LE9A 1CJKB 2GQ2A 4ESRA 4P52A 3NMAA 2ECZA 3NLCA 3DFEA 2PO4A 1HQEB 2DVEA 2AJ4A 4OJHA 2RO0A 1FRXA 1YJ7A 1RHKB 5IXUA 2MZSA 1DRZA 2CPHA 4TU8A 1LNQA 1WHLA 5KYWB 5KT6A 4XTXA 3DRRA 4O3NA 4OJGA 5ITHA 2NYIA 4IUQA 1OOTA 4FKYA 4HH1A 2EYQA 5FRMA 1KHWA 3A8HB 3I0RA 1N48A 1B4SA 9RUBA 2X7IA 3MKDA 3EGXB 3CCVA 2GMLA 3IGNA 1LNXA 2YNFA 2FY1A 2I6WA 4PABA 1UVNA 5DJBA 2R58A 4C5GA 1FE4A 4Y0FA 4HCBA 2EKYA 3M2RB 2VF3A 4KFBA 5GANe 3EICA 3HD2A 4RW8A 4M78D 4YQWA 3K0JA 5HROB 2I1RA 3PFEA 4OMPA 2QFIA 1H2VZ 4K7QA 4NLUA 4DPYA 1KQFB 4Z88A 3QLHA 2UP1A 1R3NA 2HPUA 1M0SA 3BDEA 5CQYA 3PTAA 1JEGA 2D8JA 1BI0A 1X4FA 3MTJA 3TVTA 3VS3A 1R77A 3OW2A 5KFJA 2JL9A 1Z4UA 2BR0A 2Y1JA 4QVZA 4PWDA 3FSYA 1FK9A 2L3MA 5KFGA 2OEJA 1Y0MA 5AT1B 4R5PA 4DMZA 1NK0A 4HA8A 2XCPA 2VBZA 4OZ3A 3UE2A 4NCBA 1RA7A 1C0TB 1LFPA 2J9DE 4ED5A 1WHVA 1FE0A 2DXTA 3EYZA 4LSLA 5D78A 1UJ0A 3EG2A 4OYXA 4C0OC 2EBGA 4F4KA 2E1AA 1QUPA 5IT9U 3TAPA 4N7TA 4M7AC 1HNIB 2DNUA 3H0HA 5DDPC 1G4CA 2P4RA 1VQNA 4L73A 2QE5A 4NX9A 4F25A 1Q79A 3GJTB 3M6XA 4A48A 1KVKA 3HXMA 5I3UA 3ULRB 2RU3A 5J1EB 1N8RU 1Q78A 4NXNJ 1YJUA 2QRRA 3CC2S 4I4BA 1I3OB 4CO4A 2QEXT 4EMKC 2UU9F 1IKYB 5DETA 4YHHJ 1N54B 4K4WA 1G7CB 4K5RA 2WB1D 1HWLA 4IR1A 4KPYA 2UUTA 1NK5A 4ZMMA 1GFDA 2N3LA 2EYWA 4M78A 1AEYA 2CADA 2YTCA 2ASYA 4FVMA 1X01A 2VOPA 3CMAT 5DM7R 3NCRA 3CCUT 4F4YA 4LDVA 2OPRA 3H40A 1RTDA 1N33F 4EK2A 2OPSA 4JI8F 3TEEA 1PJ5A 1M5HA 2MPUA 3R7NB 2U2FA 3JCMJ 2BVZA 3CXCP 2HSEB 1UPMB 2FJEB 4F7UB 1K9AA 3FFIA 3FJ2A 1HBMB 3U27A 4U96A 2IMWP 1KKHA 5F8HA 3C94A 3KK1B 2KT2A 3K7RA 4ZIWA 1Q81U 3ILOA 2YKPA 1GFWB 2WSCC 2JWNA 4OI2A 2CNOB 4DU8A 1C0UB 1WYXA 3V7RA 3W60A 4F4AA 3JAME 3G4SQ 5GAN7 1VQMQ 3OJUA 5L9XA 4PG4A 4P72A 4DR1F 1CS4A 3C16A 4DFJA 3CCET 2R2UA 5AXKA 3R3TA 4GC6A 1NPPA 4J9BA 5DM7Q 3JCMQ 4ZTJA 2CQPA 4KUIA 2W7OA 2R8KA 2YUNA 3PCOB 1SI9A 4F2RA 1S4EA 2K5FA 2F5GA 4QT7A 2VXEA 3A8JA 4IH6A 1RCXB 4UQGA 1I6JA 2GNCA 2WSFE 2LJ1A 5K9FA 3MM9A 1K0TA 1Q7YU 3EFRA 4YS2A 4W98A 4U6PA 2FLPA 2KRNA 2DRKA 1EETA 1YX2A 4MK7A 2C2NA 1TUVA 3CC4Q 3VKIA 1E6VB 3DLHA 4QR2A 3CJQA 1CKBA 3VUZA 1VIXA 3DB3A 5EDWA 4DI6A 1T11A 2DM1A 4KO0B 1GCQA 1B34A 1LWXA 1IQZA 1VQ7Q 2SXLA 2MI6A 4Q2MA 1SUQA 2V4JA 4LF4F 1DZ5A 4M8LA 3I55A 3GIMA 1RAFB 1GEHA 5FLXU 4C8QB 4M75E 4RJVA 3CF5Q 3D6TB 3DOLA 1JXMA 3D1QA 3FCWA 3T1YJ 3SEMA 1KD1R 4QR1A 2BXJA 3QRPA 5DLFA 3GG0A 1WI6A 4UF4A 3W63A 2V50A 1J3TA 2DCLA 3A1PA 1QKWA 3HF5A 1X6OA 4AFFA 1S1TA 1C1AA 1SVDA 1FXXA 2K7JA 4OI6A 2IM1A 2VPZB 4F67A 2QGFB 2HBYB 3ZZTA 3FLGA 2V8KA 4L59A 3X25B 2F8HA 2GVZA 1IXKA 3DDIA 4K4TA 2DITA 4B9MA 4Y00A 3BYRA 3D68A 3QIDA 3CCVS 1Y7PA 2XZWA 1JLAA 3QGGA 4FT2A 2L9NA 1YBTA 2O4XA 2RF2A 4NXMJ 2DD5A 2R2SA 5C25A 4HDGA 4C0GA 3QIIA 4J7IA 3I6PA 4D3GA 4HACA 4DUTA 3I56A 3AD8C 3PR4A 5CD4H 5D4OA 3JSCA 4KHPJ 4X65F 1S99A 2N4DA 1YWOA 5KCOA 4F0KA 3EUNA 3D67A 4ORZA 2FJAB 3KLFA 1B0VA 2OPPB 3SMZA 2PVDB 4OHWA 5D6YA 2BQRA 1HNWF 2XYPB 4M77E 2YXYA 3LH2S 1KQ1A 4CNYA 1AB8A 4CO2A 4UOCA 4D6WA 2P9EA 2P6SA 2Z4PA 5GAOm 2C0IA 2ROEA 2L3RA 2FHMA 4DSIA 4X66F 3M7VA 1IHWA 2YQ3A 3RRHA 3BDLA 4M7DC 5KFSA 2UUCF 2R8HA 3M8QB 2JNJA 3AHPA 5H1SV 2V8IA 1WG4A 2M2BA 3OMGA 2CZ1B 5KFWA 3CJ8A 5FW9A 4B3OA 4ZVUB 2HZAA 3WBZA 1RT3A 1D1CA 5GMKl 4DPOA 2KFNA 3R8YA 2J8AA 1FTRA 2VG7A 1OI1A 4LXCA 5KG6A 4RTZA 1URNA 1QCOA 4O3RA 1H74A 1T94A 5DG7A 5KFFA 4ERDA 4PJOA 1HYSA 3A8EA 3VV2B 2QLXA 1VQNS 2C3UA 1XERA 2P0KA 1M4ZA 2RS8A 4KB7A 4BI4A 2XSJB 1N9SA 2LU1A 1FFWB 3R5DA 3NNHA 1Z1ZA 1HQUA 3HHLD 2DNMA 2NUTB 1RDRA 1S49A 1UEBA 5HATA 4IRCA 2DGQA 1FA0A 1WIEA 1RHRB 4IRKA 1JLGA 1T9YA 5D0GA 1X2QA 4ETZA 1MMNA 3DI6A 2EFVA 4C0HA 5A0GA 1RE1B 2MGZA 3LGLA 3AHUA 1JJHA 1YHQT 4RWWA 3G82A 4CLUA 1WOPA 3NRBA 1K0SA 5IWAF 1K76A 1Y3JA 3R1HA 2ROGA 5LJ5e 2ZBPA 1RWXB 3MAHA 2KRMA 2JMAA 3JTPA 3CCSA 2VKZG 2WOMB 4ZPDA 2AZ3A 3UI3A 1T9VA 2H5JB 3H5SA 2QL9B 5C24A 3TRGA 2BACA 3SQOP 3HI9A 3QZ5B 4LFAJ 3C12A 3AFGA 4EEYA 1OQ6A 4G6VB 1HARA 1ITPA 1UFFA 2G6FX 2XGPA 1X27A 5GAGI 3T9NA 2DNOA 1RUSA 3BDPA 1GRIA 1S9EA 2C3OA 4B3RJ 2BJDA 1JLBB 4HKEA 3MP6A 1KOOA 3RBZA 1VQPT 2M51A 3CCLT 3PDNA 4Y2AA 2UV8G 4ECXA 4ELTA 3W5YA 1FJGJ 1NJIC 1N5QA 5B0CA 4JV1A 2DYAA 1D3BA 5KT3A 2VDIA 1TKTB 2ZHAA 3HSZA 1RT6A 3KLGB 4JB8B 2KYZA 2OO4A 4DL4A 4DXLA 3T19A 2HFZA 4PQUB 5BYRA 2ROPA 1JJ2R 4FKXA 1GTEA 3SBMA 4XQ3A 1U1PA 2BE2B 3R2DJ 2RU9A 2HD0A 4I64A 1RTHA 3D3CJ 1D0ZA 2E9TA 2D1CA 1C1BB 5AXMA 1FKAF 1IKVB 2YNIB 3CB4A 3JCMf 4ECRA 3THKA 3M58A 2KU7A 4EYIB 5FROA 3Q2SC 4YP3A 1HWIA 3DLEB 3JAMY 2MZJA 4QR0A 4DV4F 2HHVA 2QA2A 4CLFA 2J9DA 3OYAA 1N8RT 4M5MA 2DNNA 5D7UA 2HW3A 4LRCA 1ZAVA 2F5KA 3V6DA 1WD6A 1AVZC 4OX9J 2R7WA 1D0EA 2VGNA 2BANA 2W01A 2MYSA 3QJJA 2HHWA 3SQGB 2EEYA 4OQJA 4DU7A 4P75A 1JK9B 2R4FA 1VC0A 5GAN3 4DZ6A 1AFIA 4WWSA 2W10A 5KFXA 4I0WA 2KRBA 2Q79A 3I55S 3X1LB 4FXVA 1X4EA 1TUWA 3CPWR 3MM5B 3RMQA 2HVEA 5KFQA 2GFAA 2HKEA 3Q22A 1SQGA 1OULA 1M8MA 3VZIA 2V8JA 5IC4B 4DX8H 2XEXA 1VHFA 4HCKA 2EFIA 1FWLA 4WE1B 1GMWD 1SKRA 1TL3B 1V3ZA 4I56A 1I5OB 2X3WD 4PWWA 3MM8B 3UDLA 1VQ9A 2LDYA 1AWXA 3OQ5A 2G1DA 3SFMA 3DGVA 1H2TZ 5KG5A 1Q86C 3LP1A 2F65A 5DDQC 2ABYA 2OTJQ 1RK8A 3NCPA 3I9QA 4OIXA 5HBMB 1X5SA 4AG2C 3KLIB 2UXCJ 3D0IE 5J2NB 1L5UA 3LGMA 4XK8C 2FHJA 2O31A 2JRSA 3M0TA 2EKNA 3M1VA 4HDHA 2OELA 4Z2XA 1YI2T 3KK3A 2XHCA 2W7PA 3MMCB 4DR2F 1BE4A 2H3JA 4M5DA 4HCCA 1R8BA 4R0JA 4L76A 4B9WA 3HSJA 3OS2A 5LL6d 4PLLA 4MYTA 1D1UA 4ECZA 3ILLA 4BWJA 1RAGB 3TSWA 4LDWA 1QM9A 4DS4A 2ZPHB 3BBCA 2FPFA 1XNQF 2EGEA 1OU9A 4HT7A 2HKNA 3CBMA 1RT7B 5AJ3J 4ZGJB 5DGAA 2VD3A 1L3TA 3G4SA 4RW4B 4Y2KA 2D0NA 2MHNA 2CA9A 1C0MA 3PO5A 4MZPA 3R97A 3R6OA 5ETPA 4O23A 5DM6Q 1H6KX 1YJRA 3FIFA 3GFYA 4CTAA 3OVAA 1M90R 3OBYA 3HDSA 3PMIA 1KQSR 2JNGA 1BCOA 2Q1LA 2LQNA 1VQOQ 3I32A 2M0GB 2N7YA 1M1GA 2DLPA 4UTGA 2IBKA 4C7QA 1XMOJ 2E41A 3GV5B 1DTTB 4LT6A 3UD3P 1N52B 3CD6T 5KYUA 1W25A 1S6UA 2D9PA 4IQXA 3OS1A 2DGOA 3CC4A 4BDZA 3GP8A 1L3SA 5LJ5d 4J9QA 4MKBA 3HFVA 2GJIA 4X4SA 3NP5A 2LA4A 1EAYC 2HHHF 4KBIA 4WIQA 4LRAA 4M75A 1EHWA 1O6XA 1NKEA 4M5LA 3H41A 1KS2A 4IFVA 4ZP8A 1NEEA 1VQ7A 3V4MA 3HPWA 5LJ5h 2A2CA 1E6HA 2AJ0A 2XIDA 1FJCA 3M9OB 2OPQA 3CEDA 4PLIA 3N9UC 1UW4A 3T1HF 4O3QA 1KQ2A 3LLRA 4DV5F 1K73T 3FQKA 2HFUA 3SV4A 3NBPB 3JRZA 3CSKA 3DGPB 2HNZA 4LVNP 4JS4A 2LRQA 1HWKA 2ZPBB 5D4PA 2U1AA 1UUEA 1CC8A 3W2VB 2FB0A 3CUNA 3BR8A 2PE8A 5KYNA 1DBDA 1EX8A 3PYEA 2CFXA 1ZBJA 3HKWA 3I5BA 3W5XA 2RJFA 1UZHA 2CYZB 2V63A 4GVBA 2FL7A 1NJXA 1ZSZC 1BI1A 3UDCA 1ZM2A 3M0RA 2J05A 3JB9F 3JB9G 5ECAA 2CQBA 4XU1A 4L6V3 2KGTA 4UQTA 4L75A 1NK8A 4O6JA 2CS7A 4R0KA 5IQQA 4C92E 5BR8J 1YJ9T 3D0HE 1U49A 4DL7A 3C95A 1ZPVA 3EZUA 4RR5A 3MM6B 3FSIA 4KY3A 4MZMA 3G6EQ 4N8OA 4UOFA 1U48A 4JV2A 3AOAA 2ZH3A 3NOCA 3BKTA 2NXCA 3HP6A 4H54A 2B51A 2JOYA 1VRUA 2PA3A 2F3JA 4W90B 1CJTB 2R7QA 4X62F 3E01B 2MYFA 1XOVA 2VJVA 2DEQA 2AIRB 3KUEA 2ZH8A 1XC9A 4E7HA 1UGQB 1X43A 4BDPA 3W1YC 1OPZA 4BHQA 4J9NA 3M30B 1RTJA 4JI2F 3OMCA 2EC2A 4RU9A 1QVFR 2B6AA 3CBPA 4F7VA 4ZJLA 2Z58B 3M56A 3REAB 1G3TA 1R0AA 4DR4F 4JRKA 2OAUA 3TWZA 5C5JA 3CDBA 1TMMA 4FIBA 3UO0A 1OY8A 1D09B 3ET6B 2OUGA 3FEXB 1RAIB 2H4WB 4R25A 2BJ9A 2PIIA 2F5TX 3OYJA 3VYGA 4O44B 4E7SA 2IJNA 3TUJC 5F3ZA 5M2UA 4UC4A 2W9CA 1CULB 5IV3A 1BKBA 4CQ1A 3MP8A 5LOQA 1YK9A 3AOCA 8ATCB 1ZAWA 3DRSB 1N27A 3JCMg 4I6WA 3US5A 4F3OA 4HTIA 1HPZA 3EE3A 4X4PA 4NCGB 2QGGA 5CHCB 3RKXA 1S6QB 1G2BA 1FWPA 2GFFA 4WYWA 4WFBQ 1R7IA 4J83A 3ZZZA 1CJUB 4KKOA 4ME7A 2V5HG 3JS9A 1ZQ1A 2F2WA 4EFAC 1U0HB 2IC3B 1TFYA 1T3LA 3ZFJA 5D77A 1VQKA 3FCVA 1NG2A 3L42A 4ZVSB 3S1TA 4XIUA 1OQ3A 2E1MC 2ROLA 2I9SA 1TKDA 1VIOA 4PQAA 2KXNB 1DHMA 2HQEA 1WEYA 3AD7C 1A7GE 1VYUA 3GNGA 4N4HA 2W2PP 2AD9A 1PM3A 1J5EF 1LW0A 4B3MF 3KTQA 1SHGA 4QU7A 4CDIA 2XMTA 1X4DA 4IH5A 1RT5B 1AUDA 2QMXA 5GANf 2JXBA 2ZVIA 2QAZA 2KVQG 5HMYA 2L3SA 4MJKA 3BSNA 1B7TA 3PMTA 3DRRB 5LSLA 3GILA 3RW7A 3QDRB 4LRFA 5ADZA 2OI3A 3BO3A 2KT3A 3TUZC 2CJKA 3IG1B 2IVYA 2QEXQ 1OX8A 3IO1A 2I5JA 4A4EA 3I0RB 4KH0B 1H0HB 1G3OA 2UU9J 4KYZA 3OFFA 4QKUA 1Q86U 4RMOA 1VQ5A 4HLBA 5KG4A 3G4SS 3L2RA 5D0RA 1VQMS 4DR7F 5CCAA 2O88A 3BO4A 1DFDA 1H641 3LWMA 1FRLA 2KM8C 2BUDA 4AT1B 2ZOMA 3K5PA 3G6YA 3QYHB 4DL3A 4C5HA 1R8PA 4YR0A 1UFKA 1X6GA 4ZVRB 3CMAQ 3CVKA 2Z8QA 1BI2A 2HKQB 3CCUQ 4ZPBA 5KH6A 1T9TA 1BQMA 1G5VA 3MO8A 4E7LA 4C8ZA 1FRMA 1H2UX 1G3SA 1DAXA 4LSNB 1N33J 3QLHB 2E65A 1AZGB 4JI8J 2C2MB 2VKRA 4LQ9A 2NPIA 4TNOA 1ZHIA 3PRBA 3VAHA 3H4DA 1IUJA 3CEYA 5GAN6 2MOXA 2ZHOA 2DL7A 3GIBA 3CC4S 4I68A 3KMQA 3KLEB 3CQTA 2GQCA 2MWOA 1KC8C 3MCMA 4WK3A 1QW1A 2B0GA 2MQLA 2G9OA 1UETA 4ECTA 5AE2A 1JJ2A 3SI8A 3QJLA 4F7UE 3PIOQ 3CXCS 4QIEA 4KT0C 2F69A 1IB8A 4NEZA 4HL9A 2KRRA 4DV1F 1VQ7S 3ULHA 5KFIA 4LSLB 4UY85 2XD0A 3WXMB 5E41A 3DKDA 1S1VA 2VKNA 5A2QU 4DR1J 1F2HA 3CCEQ 2L3PA 2H3EB 3EPIA 2RE1A 1HBNA 1W6XA 2P4TA 4YB5A 3AB4B 1FWZA 5KG7A 4A4KA 4PKCC 4F4ZA 3J7AN 3ISNC 4USTA 3GFHA 5I3UB 2L2PA 4DL6A 3BPSP 2FLNA 1IVZA 3DRPB 1UFWA 1CG2A 1PJ6A 3QBCA 1WHMA 3CJSA 2CJ9A 2GO8A 5I3QA 2JTEA 3OSSC 3PRVA 2BW7A 3M32A 3VS4A 4PEOA 4CT9A 3GV8B 3U23A 4QIGA 2OHDA 1SB6A 2ZKUA 1RAAB 4FF4A 2DHAA 2KXDA 5KFBA 3GLXA 4M7DF 2AJ2A 5I2SA 4M7DG 4K59A 1FHTA 2OTJA 2WB4A 2PI5A 2ZH6A 5L1IA 3NKYA 1APSA 3UCGA 1NKBA 3MWBA 2KVIA 1EX4A 2ZNYA 4FVCA 3PR5B 1RTDB 1KFZA 1WGSA 3HO1A 3CPWA 3HPOA 3V8KA 2L8DA 3Q2TC 2ZD1A 1MGQA 3E3XA 3TA1A 4QYZJ 4R8UA 3VRYA 3C6UB 4DPUA 2F40A 3G8TA 2EK6A 2JC1A 3QWXX 4J6WA 2ACMA 4K4ZA 3EH2A 4QIVA 1WDTA 2LJ3A 4I2QA 5KFDA 4FF2A 2NZCA 3SSSA 2W9AA 2ZDOA 3RJMB 1QAJA 1E6GA 2H5IB 3M0QA 4Q2LA 4K4XA 2UXDF 1IREB 2G0IA 5J1PA 1KEKA 5GAHU 5DDRC 1U1RA 4A46A 3PVQA 1FT8A 3OTOF 2VUGA 4WTYA 1GBQA 3FGVA 4GC7A 3CCRA 3KLVA 3QDFA 2AW0A 4S0MA 4WTOB 3QSYB 2X1GA 1RLDA 3MPWA 4DCJB 2NXJA 4MIAA 3KNAA 2AEFA 4IKFA 1T9XA 2V2ZA 4HKQA 5J26A 1S0NA 1OX9A 5A0YA 3JB9D 2E5JA 2RF0A 2YRCA 2XZTB 2YLCA 4XDCA 3X26B 3ITHA 1C2PA 3QT7A 1YFNA 4U7UD 2KAFA 2IYGA 1AWWA 2R2TA 4X65J 4JYAF 4TY8A 5CZVA 2ILYA 3WVEB 1REVA 2KJWA 2CP5A 3E19A 2X1AA 1N0VC 3T3FA 5EGYA 1T9WA 2DNLA 4Y3CA 1HNWJ 3MM9B 1AW0A 1QTMA 1YIJA 3DM2A 4M7AD 2I8EA 2Z56B 3SCLE 1VQSA 3MDFA 4OV1A 4NYZA 5A8KA 2VPWB 3OYIA 3NMRA 3L09A 4X66J 5T41A 1JLEB 4RTUA 3VALA 2HWHA 3NGPA 3H8YA 4CNZA 5DZ7A 1RWVB 2LA6A 2QI2A 2JM8A 2ED1A 4M78C 1K8AC 2M9KA 2HNDA 2CQ0A 3FRZA 1N5ZA 3LGNA 2BZYA 1UJ4A 4N47A 1T3OA 1SV5A 4EWTA 1SUQB 5HQLA 2V4JB 2RI3A 3UD5A 4ELZC 2G0CA 1SL1A 3FSXA 4JUVA 5EG2A 3PW4A 1ZTTA 3MEKA 2MLXA 1KQSA 1OZ2A 2D8HA 4LNPA 5D3GB 3L1AA 3J7YI 1PRLC 3IRXA 1VQ6T 3R5CA 1N88A 1S1TB 1U4BA 2JLEA 2C0OA 1K1QA 3M8SA 2ZUAA 3K89A 2E1RA 1TL1A 2DY9A 2RPNA 3UQSA 3UVJB 4TU7A 4GBQA 3P3DA 2K79A 5IXBA 4C92A 3G71A 1QLNA 3H0IA 2LCWA 3POTB 4W4MA 3NNAA 5J3BA 3PVXA 2DR9A 2XICA 1JLAB 3LW5C 4QW8A 1M3AA 1YHQQ 3QMQA 5KFLA 4CO1A 3CD7A 3VR1A 3OTBA 1ZTWA 2EYYA 4MFBA 2O4XB 2BZXA 4LSZB 5GMKm 4UUWA 1N5VA 3OXGA 1ZLMA 3A8OB 5HK3A 4ID5B 1TK8A 2J5AA 4F4WA 1UTIA 4JI7F 5IWAJ 1RWOB 2GGPB 2CQDA 3CDEA 1XQIA 3MUVP 3LH5A 3I56T 5JXSA 4HXJA 2XNRA 3V81A 2EJ9A 4C3LA 1U8RA 1NH8A 3BGLA 2AGQA 2VUBA 4PYAA 3CIMA 4PG5A 1CJKA 1HKAA 3PGGA 2LEAA 4G1PA 4LDUA 4ELYC 1JNZB 1HQEA 5AE3A 2ESWA 2QASA 4DBRA 4MDXA 5HLFB 1X69A 5GANg 2R9LA 1NM2A 3CJ3A 1VQPQ 2GZOA 3CCLQ 1HJDA 5KFKA 4K2XA 5KYWA 2YRDA 1RAHB 4NA2A 1WX6A 1PBAA 3Q24A 1N8RR 3IFEA 2DILA 1JJ2S 1SJRA 4C0DC 1GAOA 3QIPA 3TZXA 1N0UA 1IBCB 4WCIA 4B3OB 3ZEHA 1RT3B 1GCQC 2HCKA 2XDDA 4FYVB 3EGXA 4FSSA 4JRPA 2HBWA 1Q82T 1T8EA 2FC8A 1CC7A 3QHSA 2DZ9A 2V8PA 4PJOB 5LJ5f 1MN9A 5GAN5 2JH3A 1HYSB 2CJBA 2OP5A 3FDRA 5FDLB 1V29B 2E1HA 4X4QA 2JS0A 4LF9F 3M2RA 4DCOB 1BC6A 4EMGA 4OI3A 5HY6A 2VYTA 1I51B 4J9PA 4WP3A 1E7OA 5HROA 4JJDA 2DNRA 5KFAA 2DGXA 2DEJA 5ETNA 3C14B 2QFJA 3QT6A 1YCSB 3PHTA 5CYMA 5I4MA 1I94F 2JEJA 2CDQA 4OI0A 3MMJA 1HA1A 3EHRA 3AA8A 1NDKA 5KOWA 1KC8U 2BIVA 2MGZB 3BFMA 4DEXA 1ZETA 5IT9E 4DV4J 4WKRA 1QVFA 4MK9A 3OJSA 3META 2AYGA 3I4HX 2OTLA 3BPDA 1RAOA 2XGQA 4IIOA 3DXSX 4OHVA 4QZVB 4GLMA 1Q81R 2PMWA 3QGPA 2MMYA 4DHVA 1XNRF 2OTJS 2PD1A 5LJ5Y 2KB2A 1U1SA 4DV0J 4LF7F 2QQ9A 2CPXA 3CCST 3CPWS 3EWGA 2OIHA 1C0TA 2QA4T 2NXEA 3VAKA 1GXLA 5C24B 3T5KA 4URQU 4RNOA 1RWMB 1VYTA 1WEZA 2XYGB 3EAEA 3GR1A 3LA0A 2COLA 2MF2A 1HNIA 2COWA 2UZAA 2UUBJ 1FDAA 2BE9B 2AGPA 3A3OB 3HRSA 1TKXB 4FSXA 1FMVA 2GW8A 1OPKA 5J1EA 4M5JA 1NBEB 4HVUA 3CCRS 2KT1A 2WK4A 2EVRA 2EI5A 4DG1A 2P5VA 1UHCA 1NK7A 4K2JA 4N5SA 2HWIA 3T1AA 2EYXA 2MXYA 2M1HA 1AOJA 2NREA 2CWKA 1IKYA 1F9EB 4JZ3A 2DKOB 3M0SA 3FEOA 3EXYA 2K7AA 4IYQA 4DQSA 1LWFA 1Q82C 2P6TA 4NRUA 5F9NA 1PYSB 3FEYB 1YZ6A 4KGMA 1EKRA 1HR0F 4PJOC 4P5NA 1HD0A 1TL4A 2V67A 1X4CA 3CCUA 2W2OP 2I38A 1RADB 5A0LA 5A8RB 4J9LA 3MP1A 1F5CA 4MDWA 3BQ2A 2P0PA 5FU7B 5J39A 3BSOA 4NWBA 1YI2Q 4V19J 2Y9HA 2F1FA 3CJTA 3V6JA 4F7UA 3BSAA 1VRTB 4DF8A 2GJFA 1SSHA 4DR2J 1MV3A 1NNDA 4CLYA 3PHEA 2PFDA 1ZH5A 4C8QD 3KK1A 3EPGA 1JLCA 3MEAA 3D9BA 3HZEA 2CQ4A 2ZZDA 2CZ6B 4Q7AA 2FC9A 3OL9A 3PIOA 2YUQA 1XNQJ 2HRUA 4NZ6A 2FPDA 2MZTA 1SQFA 1HFEL 3R5BA 2L3QA 3MAQA 2IFXA 2OMLA 3M4GA 4L74A 2RQTA 3C4SA 1TQLA 4MKYA 3GBQA 4BE1A 1TS9A 1RB0A 2XDBA 3ZTQA 4ZVHA 4M4ZA 5GAEI 3MXHP 3IS9B 1Z2ZA 3PJWA 4KULA 3OY9A 2PA8D 4USVA 2HIYA 2UVUA 3W3SA 5H9EJ 4C0ZA 2B8QA 3PKMA 4P2FA 2LNHB 2V4QA 2VBXA 1K73R 2JT4A 1U45A 2D9TA 3GNFB 4PRFA 3BB5A 2OJ3A 3N6MA 1UWAA 4DF4A 2YKAA 1UGVA 2O9SA 2GX8A 4RNFA 2RI2A 3P96A 4OX8A 3D1OA 2KJVA 1AXQA 3CD6Q 1WF1A 4HHUA 3TARA 4XTZA 2IY5B 4I7FA 1HNZF 1TH7A 2F4VF 1YSJA 4DL2A 4PJLA 5FLXE 1ZUYA 1VQ9T 1LWCB 3QPHA 4Q5WA 1Q8LA 4RZRA 1HBOB 4FDFA 1FTCA 5A0DA 4JS5A 4BUGA 3VS5A 4L6V5 2DGVA 3MPDA 3SSRA 3E8OA 2HFNA 1U02A 3BV8A 4KO0A 1VBYA 4RW6A 4KGVB 1K9MT 2FJBB 3PX6A 2ZAEA 2IRXA 1IBLF 1X8DA 2DISA 2XM3A 4C3MA 3HTRA 4FNHA 3KG4A 4FN5A 2N3OA 2RHQB 2MQMA 5DZ6A 4DV5J 5HMWA 4EPCA 3EDQB 4C8QA 1GMUA 2C2RA 4RNHA 4NPOA 4CLPA 4M5DB 5D4LA 1FXLA 2N7CA 4LJMA 2GQIA 1GH8A 4R56A 1NZAA 2KRSA 3S8SA 1RWUA 2CJQA 2DXBA 1FO1A 3L2WA 4I6YA 1M1FA 1PSDA 2W2MP 4TN2A 2ZC4A 3MPYA 1VQ8A 4CC2A 4M5IA 1SHFA 4YUDA 3IAS9 1DY3A 2XY6A 2ZUGA 3M53A 4LRDA 3LWIA 2J7UA 1SG5A 2GMHA 3QO9B 2VA2A 1LK7A 3EXCX 2ZPGB 2BZ2A 3PX0A 3VRZA 3R6LB 4QWEA 5ETOA 1V3RA 4XU2A 4JUZA 1YJ9Q 4EBEA 3ZTSA 1NKCA 3KJQB 3R6GB 4EZ6A 2B86A 4EBCA 1MNEA 2DPJA 5RUBA 2DXCA 2E44A 2OPPA 3A5ZB 3DLGB 2D9OA 5KYUB 2DR5A 2APOA 3WVDB 3MPVA 4TYAA 5JUMA 2LVMA 4UW2A 2KYMA 2H65B 4X62J 5SUHA 4ID8A 2HVZA 4O3OA 4AFUC 1RABB 3UFCX 2EK1A 4ETXA 4B9LA 3CCJT 2DB1A 4JI1F 5CQXA 1OY9A 3M8QA 2A7YA 1R89A 1SJQA 1TL7B 4ES3A 2UXBF 4DR4J 4DUYF 4AL7A 1R8OB 3QZ9B 3NNCA 3KXTA 3C2PA 3NGUA 4L3KA 5IHIA 2FQQB 4DV3F 4WZMA 2YX7A 2JN0A 2CRLA 5LJ5g 4DWIA 3ZL7C 1WKKA 2LTOA 1UHFA 1T03B 1NXIA 3M6UA 3AD9C 2VZ9A 3L2UA 1IKWB 2GO9A 3MR5A 1EKSA 2K2VA 3VGUA 2CNKB 4FNIA 4GVBB 2IAJB 1LCKA 3QJ6A 5K14B 1WC5A 2AWZA 1WA7A 5FIIA 2QEXS 3MECA 3BH6B 2AYMA 2K3KA 1WNLA 3LAKA 2EFOA 2FLOA 3P5BP 1WI8A 1YHQA 3TAQA 5LL6S 5JJBA 2E10A 5KG0A 4WFNQ 3BO2A 2W2NP 4M77B 3LX7A 1NDLA 1UTAA 3OW2P 2FVPA 3B8HA 5HK4A 2YRVA 5IZHA 4UY8T 3GF5A 2A3JA 3MM7A 2WSFC 2XYHB 3CCUS 3OS0A 2QQBA 3AOBA 3PYDA 5KT7A 1NAQA 4PCQA 2K06A 2WOMA 2YSQA 2RQMA 1CQNA 4B3MJ 1UGSB 2C22A 2V68A 1L3KA 2DRBA 2GTJA 1EB0A 2DZCA 1BQXA 4LBPA 2W4PA 1X7VA 3LALA 1ZAXA 5DS7A 5HK0A 2N4CA 3NY0A 4OYZA 3SDEB 1OYXA 1VQPA 3CCLA 4UZCA 4DCPB 1WFWA 4QPXA 2EQUA 2LFVA 4OI4A 3OL8A 4PK4A 1X9MA 1VQLT 3MEVA 4NLPA 4DBQA 1RTJB 1B3QA 1NPRA 3MR3A 1KVIA 2QL7B 1TSFA 1UVKA 5L8RE 3V8LA 1JXOA 3FK4A 1TKTA 2OSRA 2LLZA 3AAWB 1RGVA 1HD3A 4M75C 4WFYA 2H9ZA 3KLGA 3GE9A 2WBMA 2GAHC 1U2RA 5HJXA 2ZM6F 4PQUA 2W8LA 1V76A 3F44A 2V6AA 4F17A 3CCES 2YWWA 1Q16B 1KFDA 3VVTA 1OEBA 1HYOA 4PFOA 2M70A 3M2VB 5GAN2 2BE2A 3HMJG 2WSCE 3DLBA 3KBGA 2W9CB 2K2MA 4QU6A 1BI3A 1QVGP 2CXEA 3D0GE 2CPDA 5EX3A 5GJWB 4Z8AA 3B82A 1C1BA 2W0ZA 4TQRA 5G4DA 3BN7A 2YNIA 1S97A 1JLQB 2MKJA 2V8VA 1LWEB 4OMFG 4DV2F 2DERA 3MD1A 2M7SA 3DDKA 2EFNA 2EAYA 2DTHA 4KKOB 1U0SA 3NGSA 4IO1A 2QZ8A 1FKOB 1X5OA 3UF4A 2DVJA 4FU6A 3UNGC 4J9IA 4F3QA 4F0MA 2GGRA 1QVGR 2HZCA 1KTVA 1VQKT 2KH9A 4RCCA 1UJYA 3PG9A 1AFJA 5B0AA 3K5OA 3MMBB 1TKZA 2DRDA 3GIRA 3SQGA 3WDOA 3B6BA 4DV1J 4ZS6A 2Z0GA 1LW0B 1LW2B 2FIUA 3QKJA 1WHXA 3NTIA 2CH4W 2KROA 1UVIA 4FPIA 3RB0A 3DLKB 2E5LF 1KD1C 2HZVA 3EG9A 3UCUP 3MM5A 1WJSA 1V9OA 2MKKA 4WBFA 5G0RB 2QV6A 4ICLA 4IUVA 4XTTA 2MKSA 3L3CA 3QYGB 4JP8A 4P2SA 2RK1A 4F0HA 2CH4A 1FMKA 4A8SA 4L3NA 3CC7A 4DOWA 4USUA 2XKOC 1OQKA 2QSFA 4EU0A 1Q8KA 2HBZB 4WE1A 4J9UE 4U8YA 2WW4A 1UCNA 4FYWB 2V94A 2XMMA 1TL3A 5C42B 3PT9A 1QSYA 4GKJF 1WC4A 4OX6A 3VYHB 1GQEA 4J9SA 3HVRA 1VQ5T 3MM8A 3C3LA 1MWZA 1VLOA 1IM4A 3IC1A 3C66A 3JYTA 4MT1A 1L3VA 1W70A 1JWWA 4M78F 1OYEA 4M78G 4X84A 3OYGA 3WC0A 2C06A 3LTOA 1ULRA 2M3DA 5HBMA 4E7IA 4ZIVA 3KLIA 4OLPA 3N4WA 4ED4A 3UCZP 1KHVA 3RKYA 2BEFA 1YI2A 1F9HA 2K1RB 2VONA 5HSPA 1ZS6A 3V6HA 1BYMA 1FEEA 3FZBA 3Q1JA 1M5VC 5AXLA 3KMSA 3QFHA 1S0VA 2UXDJ 4G3IA 4WIIA 3FCHA 4ZP7A 2YUPA 4J9HA 2MSSA 2JMCA 3TSZA 2YKNB 1O51A 3UATA 3IXQA 1IR0A 1VBZA 3L7PA 4PUOB 2E64A 2F2XA 5F8JA 1G2EA 2RHYA 1YCYA 2I0NA 4IOBA 4KPCA 1RQ0A 4UZBA 1RT7A 4K5SA 3LAMA 2XWXA 2F2VA 2XHWA 3FVYA 1Y11A 1GTHA 3UPFA 2QL5B 1HBNB 2D74B 4WJBA 1RYSA 3OVSA 3G8QA 1DLOB 2DBMA 4Y2IA 4Y92A 2O3DA 1JB0C 1VLYA 3H59A 3IAM9 4LF8F 4IUUA 4JYAJ 2WAQD 2ZPEB 3VGTA 5GAN4 2E5QA 1EARA 2W7AA 3HZGA 3TVZA 2FD2A 1UPPA 4CO5A 3J80U 1FDNA 1YDLA 4PZVA 2VQFF 3PFOA 3TX0A 3M32B 2CUBA 3D6FB 3CD6A 1XBWA 2FZKB 1IXDA 4DSJA 1DTTA 2RHZA 3HL8A 2E6NA 2KK4A 1JLFB 2IM3A 4QWDA 1YHQS 2LXUA 4QW9A 5C6SA 4HI1A 2LC4A 2YH0A 1U2CA 4CH7A 3QQCD 2CKWA 3AODA 2BW2A 3Q83A 1RP5A 4AFSC 3EGVA 5T14A 4LVOP 2ZD1B 2ALYB 2LNVA 4R8UB 2J7WA 2ZNZA 3N79A 2O5DA 3M05A 2FVUA 3FMBA 3OR2B 1S1NA 2JW4A 2DNQA 2VBWA 3EM1A 3L7UA 1YWPA 2E5KA 1FJ7A 2DJZA 3G96A 3NBPA 1XQHA 1VQ6Q 1JXEA 4DUZF 2DL5A 4RBTA 4WXWA 1VQPS 1KLMA 3DN9A 3CCLS 5HVFA 3OPKA 2CAJA 4F3MA 4M5HA 2ZCFB 2LXFA 5K8MA 3CCRT 1NSAA 2F8MA 4OFZA 4DBHA 3P5TL 1MMAA 4R55A 2RB6A 1NLOC 1FVQA 3PEJA 3G9CA 4ECYA 4NLTA 2FO0A 4AFQC 2C3MA 3N6LA 4Q5VA 4JI7J 2HLUA 2B9WA 3FKBA 2HDAA 3D5MA 4KV8B 3I56Q 1E6YB 2A36A 1SC6A 4WFXA 4DFPA 2FVRA 2P2CB 2Q3PA 5DG9A 2O66A 3MM6A 4AD6A 1ACMB 1EIYB 4FYDA 2CJYB 2PDAA 2DK3A 2AKLA 4QWBA 4FW2A 5DLOA 4Q8EA 3I35A 4DPXA 3HM9A 1VQ4T 3DM2B 1OSDA 2FHOB 2WVCA 2LECA 1YIJT 1YLXA 2X4WA 1CJTA 2AYEA 2XTJP 1NU4A 3E01A 2C0TA 4EI2A 2SRCA 4G1IA 5J2PB 2VOOA 1SJ4P 4OZ0A 2B4OA 3M30A 2RD1A 3BYPA 1KNZA 3HKSA 1BGXT 4ANJA 3L4BC 2NWMA 3OSPA 5E33A 5EWGA 4PAAA 2AKWB 1WHGA 2O67A 3K5LA 3EX7B 3D54A 4E7KA 5LXYA 3H0FA 3ET6A 1JMTA 3PW2A 5I22A 3I82A 1FJEB 2LZ6B 4O44A 2ALZA 2AJQA 1RHUB 3X20B 3KOAA 2GCFA 1M1KT 3PRDA 2HFOA 3A3PB 3Q8VA 4LF9J 1CULA 4AXJA 1B0PA 3T41A 2XS7A 3BF4A 2FVCA 2M0OA 2ZH7A 2GAGC 4JDSA 4J9DA 1YTYA 3J7AF 2GA7A 3TR5A 1I94J 1TMJA 2ZWPA 4J9RA 4IG0B 1FX4A 4OLOA 4ECVA 3A8MB 2EXUA 3G71T 3A8KA 4A4FA 2DX1A 3U1LA 2R3VA 2ZH5A 1U0HA 2IC3A 3GJQB 5J2QB 4ZP9A 4N8NA 3U7JA 2K3IA 2EPDA 1XNRJ 1NHUA 3RAMA 4F2SA 3R5AA 3CCSQ 4LF7J 5GADU 2QA4Q 4JI5F 3UT1A 2JTFA 3IN5A 1M5SA 4IR9A 4K8RA 2PU9B 1QAIA 3FJ5A 2LJ0A 5KFYA 4ECQA 3TJ8A 2HAIA 2DRAA 5H9FK 1YI2S 1KWMA 1MV0B 1RT5A 3PYGA 3HVWA 3NAIA 2RDIA 5K8OA 4OYBA 4JOUA 1RWPB 1U1TA 1YRUA 4C98A 3RR6A 2D3UA 2W4CA 1VYVA 2CPYA 2PN6A 3PZPA 1UJ5A 2MJNA 4B9NA 3QIPB 1SCJB 3IG1A 4K50A 1QKXA 2J6KA 3I31A 2LT4A 4ZK7M 2RJZA 4M1KA 3MCSA 2VC0A 4J91A 3R1LA 1NUEA 4TXSA 2KG0A 1RKIA 2QN6B 5EHHA 1RAJA 4HT8A 2YX4A 1IHVA 1M90C 4KGZB 5L38A 4LF6J 2YH1A 2LXIA 4OV6A 4U67Q 1HR0J 4XTVA 3KG1A 1S4FA 1JO8A 3I96A 1WHHA 4I69A 5CCMA 1LK5A 2RUSA 2MIOA 2F8EX 3SWNA 3JCMX 4LSNA 5CYMB 2RK2A 1EQMA 4KJIA 2C2ZB 3RUBL 3OYKA 3M5AA 3KK2B 2VASA 3IR5B 2Z30B 2RN8A 4ZVOB 4NS5A 3LGFA 3CD6S 4NA1A 4A4HA 5A2QE 3BGFA 3ZZYA 4C92C 4WFZA 2G2YA 3CW2C 4OL8A 2OJ2A 3D4JA 4PJNA 3I4PA 1HMVB 3OLBA 3KLEA 2OTLT 1R8HA 1ZM4A 1S5ZA 2K2PA 4CLTA 4EO8A 4RX6A 2HHUA 4FCYA 2CQ2A 1X5PA 3J7Z5 2CT4A 1FFGB 5GMKj 3TO8A 4WP8A 3H5XA 3OUYB 3HHLB 2FGOA 2V69A 1X9SA 4I67A 4N4IA 5LT5A 1TK0A 3VGVA 3FBBA 2BMBA 5CD4A 2RHUA 4OZLA 3VCDA 4PXCA 4P10A 1QY7A 1K9MR 3M9QA 4KSEB 4XTUA 2ZH4A 2NZ4A 4NLQA 4NCAA 2RHXA 2MQ8A 1G83A 2YLBA 2EQMA 2YXLA 1KTQA 2EFGA 2P0QA 3H7HB 3PM9A 2D3ZA 2XU8A 3RB4A 2DYBA 1QCFA 3RR7A 4MAKA 1RWNB 2IJRA 4AG1C 1S0MA 1B70B 5K5MA 3JCMP 3DRPA 4QWAA 5DO2A 3KHLA 1WJRA 4II1A 3SD4A 4DG1B 1TFWA 2FYXA 1KOHA 3JB9H 4HR2A 3SCJE 3K57A 3CGIA 3M9MB 3DXBA 1QVGA 2XLJA 1PC0A 4QQDA 4A63B 2JUFA 2F4VJ 3RBEA 3KNGA 1VQ9Q 3RZAA 2KHCA 1LWFB 4CH0S 1ZBTA 1C1CB 4FL6A 5KFTA 4PG8A 1U6BA 5KFZA 1S72T 3U1MA 1S1UB 1FNMA 2JHEA 1FI4A 1YJ9S 1U1LA 3CMEA 1I5LA 5CKBA 4E98A 5M2RA 1YJNT 2EFQA 5IH2A 5KCHA 2IBOA 3PO4A 3M4XA 1N6AA 3TA2A 2EIFA 3E9FA 4Q43A 2PUKB 4ED0A 1IBLJ 3C6UA 4IQMA 2DK2A 2XI9A 4LFCJ 4NXNF 1DQ9A 1Y71A 1F5BA 1VUBA 2FB7A 4ZVEA 3A8LB 4A8WA 5GAHI 1JLCB 2JVVA 2AGOA 2XY5A 2R5AA 3MAAB 3KDNA 1D9DA 2EPIA 4ED6A 3D1HA 3M2UB 3WQPA 3SYZA 4RG2A 3Q89A 3NL0A 4AUKA 1RI0A 1H72C 1Y00A 3MFIA 2HLTA 1RLCL 3OYDA 2CQCA 3CJKB 4ECWA 2C42A 1MSWD 4BCAA 1XN9A 1LV5A 4OZ2A 4UT4A 2RQCA 1CBKA 2RI5A 3HSGA 4X2BA 4LR7A 2YUOA 3I9V9 1IJEB 3FBEA 5CABA 1G3YA 1JRIA 3I5SA 4CC4B 2RQUA 4AXIA 4VUBA 3TOQA 4OHZA 2IG0A 2V2VA 2DETA 2MK5A 2B9XA 1S79A 2J6OA 2XLKA 4I7FB 1N34F 2RKIA 3CO0P 1MG7A 1AZSA 2RRBA 5B0GA 4NEYA 3CCJQ 1Q1KA 2KMTA 4JI1J 1JLEA 3QATA 3GU0A 2R42A 2XULA 1RHJB 1TUDA 3B4MA 2XS5A 1RT1A 2XI3A 2HFSA 3R7BB 2AT1B 1Q5YA 4RW6B 2UXBJ 4M75F 4M75G 2J0SD 1WG1A 3DMJB 4DUYJ 3GCWP 4LREA 1NJZA 1DTQB 2EBPA 1SKUB 1ZX6A 4OYOA 1S48A 3UW1A 2MY8A 3W7BA 3EG1A 2A10A 3H5UA 4LQ3A 4DV3J 2J7KA 3D6HB 5D3GA 4IG3B 3PX4A 4OP0A 1VQ6A 3MEEB 5CCLA 4PJOD 5I11A 3PW5A 2FJVA 2RQRA 2YWFA 3A8GB 2R2RA 2BKOA 2EKHA 2X35A 3CBOA 4NRTA 3MGJA 3IWLA 2OAWA 1MMGA 2B8AA 3ZZOA 2DNGA 2P8IA 1B7YB 1NPKA 3UVJA 1VBXA 1WHYA 1D9FA 2CPJA 3K8WA 1VQ8T 3PYFA 4OYMA 4KGKA 5BYQA 3POTA 1RUWA 2GCXA 2FGCA 4KTQA 2Z2ZA 3LWHA 2HL5C 5GANd 4ATOA 2A0FB 2CG4A 3M8WA 4OB2B 4ID5A 1VHIA 4D8KA 3H2VE 1QP2A 2VBYA 3GYGA 3KHGA 3VZHA 3BJYA 3CMQA 2GGPA 3VQTA 3W64A 3H98A 1AROP 3DYAB 4BD3A 1MNDA 1KDNA 5GANh 3KXDA 4ATNA 1X6BA 3G7ZA 2YY3A 2LEPA 2Z2YB 1IBMF 3QZ7A 4J6YA 3OW2S 5HLFA 4HEA9 2HFVA 4G1QB 2LYVA 1W2BP 2ZOFA 4RKUC 5DRKA 1VQLQ 1N32F 5I42B 1A0NB 3M9NB 3NWRA 3C8YA 1WHJA 1F0XA 3RAXA 2R8JA 2Q6BA 1R0CB 2W25A 3GMGA 2DVIA 2HHTA 2KNBB 2MHEA 3M8YA 4JJCA 4MYUA 1RSCA 4A8FA 3ZC4A 5C2CA 2ZH1A 3JQKA 1PSFA 2ZM6J 5K8NA 3E2EA 4CLWA 1XMQF 5DY9A 1JXVA 1WOSA 1QTNB 2Z0WA 2NXNA 1D3WA 2JVRA 4QBUA 3BDUA 2IJFA 2LX9A 5FDLA 1W2BR 3K5MA 5D4NA 3NGTA 4C8QC 3IMQJ 4XO0A 2DF6A 2ZPFB 2JJ4D 2LQKA 1UDLA 4PXEA 1YITT 4IFYB 4DV2J 1DQ8A 2Z57B 4PPDA 3C14A 3MECB 1K47A 3EVOA 2XMKA 4M5NA 4J9VA 1X31C 3ZBDA 4FZVA 4PG7A 2O1PA 2J9EA 1QVGS 5DGBA 4FYYB 4HT5A 2EW3A 3BE3A 3HHNB 4OF1A 2DO3A 1VQKQ 1U1MA 2UUAJ 4DL0C 2KXCA 5F8LA 4KRTA 5E0OA 1QE1B 1T95A 3S01A 3MM7B 5CZXA 3UWNA 3ETOA 1QSSA 4O4RA 5KFHA 2QA4A 2QMWA 2P84A 2DHHA 5HJYA 4WK1A 2YBVA 4FPRA 3QRRA 3C0CA 2RUGA 1JJ2P 4UUXA 1VOMA 3GQCA 5FRNA 1BUXA 1P1LA 2E5LJ 4JLIA 4DQIA 4QJVA 1Z9QA 2Q6CA 2XI2A 1U1NA 1MN7A 1S0OA 4LR9A 5CYQA 3F56A 1S7HA 1X4BA 4O4GA 4F4XA 2DAQA 1TKXA 2LT1A 2OMOA 3LPYA 2OD4A 1NYFA 2KT5A 3RW6A 2Y1LB 2DMOA 3O44A 2IA0A 1FVSA 2LQ8A 5GMKi 3JB9k 2VC1A 4WCEQ 4GKJJ 1VQ5Q 1T9UA 2V34A 1X4GA 2QK0A 4NMLA 2D0QB 2Y1IA 4XPEA 2VQEF 4O0IA 1U25A 3KDOA 2DGSA 4ZVQB 1B64A 1UP1A 4J7FA 2PFFB 2COZA 2ASJA 2W8KA 2DY1A 3GJSB 5ETMA 2ZJRQ 5IQ6A 5A8RA 2LQBA 5IS2A 2PZ1A 5GAOp 1D9AA 1GNKA 3W62A 3SZ2A 1N36F 2HIQA 4A53A 5LJ3g 1F5AA 2DXFA 3VUBA 3RERA 5AE1A 5F8MA 2FHJD 1FJGF 3CPWP 4N0AA 3FQLA 1VRTA 3BGRB 1U1QA 3A13A 4HVZA 2CQHA 3H25A 1RKJA 2CVIA 4USMA 3MR7A 2V0NA 5SZTA 2VFTA 1J2VA 1ROFA 3QT8A 2PMZD 1D8YA 4DOZA 3OBIA 1TKZB 3P6YC 2PMHA 2KHDA 4WF2A 4MZTA 2DNHA 2CPZA 2BRLA 5KFCA 5HL7Q 2Y8WA 4WXOA 3N5BB 1KK7A 1HWUA 5CKFA 2LDIA 3OHAA 2PI4A 2E3HA 3EG9B 1BB9A 3MF5A 3KWMA 1ABOA 4N41A 3IS9A 2C2OB 2XY7A 4LF8J 3R5JB 3DOMB 3WIVA 1VQ6S 1PD1A 3M8RA 4ICLB 2EKOA 1BU1A 2XMUA 2C28A 2QLBB 4BY6B 2ILZA 1H8KA 2GIFA 2VV5A 5CR2A 2CNLB 4Z89A 1PO6A 4P2XA 2H8HA 1FD2A 3CC7T 3CCWA 3T6JA 5ETVA 2XO7A 1S9GB 2HQFA 3SCKE 1Q81T 2HQXA 1M5Q1 3QAUA 1U6FA 3VS6A 1LWCA 3E2UA 4XAXB 1FRKA 3JYTB 1HBOA 3ENQA 2DEUA 2DJQA 3UDEA 4JRQA 2FRYA 1HL6A 2W9BB 5CA5A 1XR7A 3I56S 2KXFA 3WX8A 3R2CJ 1RLPC 4ES1A 1NZ9A 5T7LB 3HFOA 1UB4A 2AP6A 2FHKA 4M75D 5L23A 2DHGA 2KDOA 4OB1B 4A54A 1CVJA 4H4MA 1FERA 2ZVSA 2AX1A 3TQ7P 2J6SA 2HGLA 1NLPC 3ISZA 2QTVA 3FJPA 3UN2A 3X24B 1N8RC 4YY3F 1KQSP 1WACA 5A8WB 4Y65A 1EP4B 1Q7YT 4EZ9A 4C8KA 1X0FA 3CCRQ 1D0XA 5GAMj 3INZA 3OYCA 1OY6A 2NXUA 2IVWA 1UL3A 1AYEA 4OMLA 3QBYA 4E8UA 3TA0A 1N5YA 3S3OA 1I1GA 5KG1A 1Y7XA 2DCUB 1I8FA 4F50A 3QO9A 6FD1A 5CKDA 5CYJA 2J6UA 2UXCF 2W2QP 3L7OA 2BKDN 2GS8A 4DX7A 1UFLA