2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
b'GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
molecule tags Transcription
source organism Thermotoga maritima
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
2OTJT 5HY6A 1VQMA 1JJ2S 3CCRT 1VQKT 1VQPA 3CD6T 5J26A 3CD6A 2CKKA 3G71A 1KD1C 3CC4A 1YITT 1KD1U 3G6ET 1XTDA 1YJ9T 4X34A 1VQ9A 2OTJA 1YI2T 1KC8U 3JAME 1QVFS 2JOYA 1Q86U 3PIOA 3CXCS 1S72T 3CC4T 3G4SA 3I55T 2E6ZA 3G6EA 3G71T 1VQ9T 3DLLA 2OTLA 3CC7T 3LGLA 2G3RA 1SSFA 1VQ5T 1VQKA 4QQDA 1M90C 1NZ8A 1VQ7T 3KBGA 3QQCD 2MI6A 2XHCA 3CMET 4CRIA 1X6OA 1KHIA 5FLXE 1W2BA 1K8AC 3CCET 3CCRA 1VQ8A 1QVFA 1IZ6A 2LVMA 2JUFA 1QVGA 3CPFA 2EXUA 2JNGA 1Q81U 1M1KC 3A5ZB 3H7HB 5J3BA 3CC2A 3CCVT 1BKBA 1YIJA 1Q82U 3CCQT 3I55A 3OW2S 1K73U 3I56A 2MWPA 3CCSA 1XNIA 1K73C 1VQ6A 4ZN1A 2KDSA 1VQ4T 3OYYA 3P8BB 1M1GA 3LGFA 1QVGS 1K9MC 1RL2A 1YJNA 3CCST 1YIJT 3I56T 3HKSA 2LQ8A 1VQMT 1W2BS 1KC8C 3CCMA 2MWOA 1VQ4A 1Q86C 1UEBA 3DB3A 2DO3A 4TVRA 1N8RU 4ZN3A 3LPEA 5LL6S 2E70A 1VQ6T 1N8RC 2QA4T 2IG0A 2LCLA 3J81E 3CCUA 3PIPA 3CCEA 2EIFA 3G4ST 1NPPA 1YHQA 2K06A 3EWGA 5DLQE 3CMEA 3CCLA 1KQSA 1YJWA 3CPWA 1M90U 4RG2A 1NZ9A 1VQ5A 2QEXT 2JVVA 3CCLT 5A2QE 3CCUT 1YHQT 3DB4A 3CCVA 5IT9E 1YITA 1VQ8T 1VQNT 3CCJT 3CCQA 1YJNT 1EIFA 1VQNA 3OW2A 1K8AU 2L3RA 2QEXA 2KVQG 1Q81C 1K9MU 3J80E 1VQ7A 5DM7R 1JJ2A 3CCMT 1VQOT 1VQLT 2OUGA 1YJWT 3TREA 1M1KU 3J7AF 3CC7A 1YJ9A 2OTLT 3CCJA 3CMAT 1NJIU 1NPRA 1KQSS 3CMAA 1VQPT 3LH0A 4YTLA 2QA4A 5IAYA 1NJIC 3CC2T 3ER0A 1M1HA 1Q82C 1VQOA 1VQLA 3CPWS 1Q7YC 1S72A 3CXCA 1YBYA 1Q7YU 1YI2A
chains in the Genus database with same CATH superfamily
2X9HA 3KK1A 1HNWJ 4UOGA 5JJBA 4FU6A 4C8QE 4ZGJB 1WC4A 2OTLS 4KY3A 4DQQA 1VQ9A 1UFFA 2E9ZA 1AZSA 2NXCA 4ECSA 4XK8E 2B86A 3T5KA 5DGBA 1PM3A 2CH4A 5A0DA 4CLUA 2W10A 5LM7E 2RRAA 1SUQA 1KQGB 1C6VX 2M0GB 2EWHA 4D8KA 4CO4A 1YJRA 3CJ0A 2C2ZB 5C24B 1X4HA 1U0HB 2EXUA 2GJFA 4CM0A 4QWEA 2JNGA 4IOAQ 3BH7B 5L38A 1JMTA 4C4WA 1H2TZ 2JL9A 2QC3A 5KFUA 3C14B 1KIKA 1U0HA 4OHZA 1HYSA 1S6PA 1Y5LB 3PX4A 1RL2A 2O9VA 2BACA 2OFHX 1UHCA 1JJ2R 2HFZA 2RH3A 3S1TA 1NKCA 1NG2A 5L9XA 2NYIA 5LMNF 4BACA 1QVPA 1OEBA 2C0TA 1NB2A 4MK9A 2IM2A 1GX5A 3UNGC 2VDIA 1SL0A 3PHTA 4IG3A 3NGTA 2RB6A 4MMKA 1Y0MA 4BE0A 2JDJA 2W7OA 2EJGA 1T3OA 2QZ8A 2I0NA 3PYDA 1VQNT 5K8OA 3HHNB 2JTEA 3Q22A 2F4VJ 3M8QA 1FXLA 2P5VA 2PQWA 2BZXA 2YNFB 2LVWA 5SUHA 4EK2A 5B09A 1H3HA 3KG4A 1E6YB 3MCAB 1LFWA 3BKTA 1LWFB 3MUTP 2V5HG 1GT8A 1S6PB 1BY9A 2LTOA 1Q7YU 4F4AA 2ZM6F 4B9VA 1PBAA 4LE9A 1VBZA 1ZA2B 5D3GB 2VG5B 1VQKT 2WVFA 4F0KA 1X27A 4RW7B 3L7UA 3CF5Q 1ZPVA 4Y6IA 2EFVA 4JV1A 2EFGA 1N4LA 1O0PA 4CTAB 1HW8A 4RW8A 1KC8R 3SIPB 2JMCA 4NL2A 3G8QA 4F7VA 1U1PA 2KYMA 5DG7A 1R8PA 2HL3A 1Z2ZA 1BBZA 1FNOA 3HP9A 3GFZA 3FJ2A 2NUTA 2GQVA 4JV5F 1KFZA 4R0JA 4BS2A 4PYAA 3PRBA 3CDBA 2DEIA 2VD3A 2ILZA 2RHQB 1P1TA 1WD6A 5IXUA 2H4WB 5DJBA 1K1QA 4QKUA 2DF6A 1UFWA 1URNA 1F9EB 1FF2A 1SVDA 4LFBJ 2EIFA 2MJUA 4K4SA 1CKAA 2AHOB 1OSDA 4OIXA 3HFVA 1F6TA 3EXYA 3E8OA 1SPBP 2CQ3A 4Y65A 3HKZD 3G96A 2XMAA 2CP5A 4F67A 3B8HA 2ASYA 3NCQA 3MEWA 2MK5A 1FX4A 2J0WA 3FDRA 4XK8C 3CIZA 2AJ1A 2BQ3A 4F02A 4YUDA 1Y3JA 1HQUA 4J5YA 3ZNUA 5GMKe 4RO0A 3ILJA 5E7OB 1I51B 3HJFA 2WONA 4F0MA 1H73A 1O51A 4ELYC 2DPPB 2CNLB 2DJZA 3MEUA 3D1HA 4M5LA 3OR2A 3V8KA 4RTWA 1KVIA 2KRMA 2JSXA 4EBDA 1VQKA 1YVFA 2R7UA 2QSWA 3FDSA 1TMMA 1Y96B 1WELA 1C0MA 1KHVA 4O4RA 4OX9J 1TVRB 3DRPA 3QRRA 2OPQB 4K0KJ 3P4UB 1SJRA 1AB8A 1X2QA 1C1BA 2Z4PA 4PPZA 3DRXA 1YITQ 1PSEA 3JTNA 1S97A 3M32A 1HWIA 2BJ7A 2XMUA 4KUDK 3PFEA 4FYWB 3RBDA 4CLTA 1EP4A 1LKZA 3IBWA 3G6VA 5L1JA 1M90R 3IWNC 4B3SF 4DZDA 1S59A 4TYBA 4HA8A 2QFIA 1MWZA 5D6WA 3WBZA 1IKXA 1J27A 4JRKA 1ICEB 2YUPA 2CQDA 1FEEA 2M16A 3MMCB 4QU7A 4IKAA 2H48B 5HMXA 5HVHA 1B7FA 4X66F 3GILA 1IJFB 2L9DA 5CZVA 4MAKA 4EI2A 1GFCA 1VYTA 2DZ9A 4MJKA 4Q7AA 4GLMA 4WFAQ 3WZ0A 3BFMA 2E7WA 4CCHA 1I5OB 3PY8A 2XG8A 3HXMA 1K9AA 1Z4UA 3PE0A 3KXTA 2DAQA 2EK6A 4J83A 2N7CA 4C0GA 2NPFA 3REAB 3KK3A 4C5IA 1QVFS 4HI2A 5AXNA 3R5JB 4WJBA 3L3CA 3POTA 2KZZA 2IBKA 2UVUA 4YY3J 4K5RA 1QTNB 3QIPB 3J7YU 4NCBA 2CNKB 1S79A 2DILA 3X20B 2AX0A 5JUMA 3D5MA 4F50A 2ZEJA 1B0TA 1RQ0A 3HSGA 1JBMA 4KGVB 4OF1A 1JB0C 1WLPB 5IC6B 3I56A 2MWPA 3VAKA 1Q8LA 1WF1A 2HBPA 2I5JB 4A4JA 1SL2A 1XMQJ 2H3EB 3KJVB 3PG9A 2E5JA 4OZ1A 3OSNA 1G3TA 1LWFA 3OBYA 2MKKA 4Q43A 2MWOA 4C0OC 3DLHA 2ZWPA 4ED6A 3VQTA 3DLEB 5AT1B 3UD3P 1RDRA 3S6WA 1WSRA 3EG0A 3AD9C 1HK9A 3LO3A 1WHLA 4DPUA 1T3LA 3H5XA 5KYYB 1RWVB 5ECAA 3UR0A 2FLNA 2C2MB 3NXZA 3MCNA 4OHWA 2HMIB 3IM9A 2JZ2A 5EC7A 1P6TA 3MMBA 1TV6B 5HQMA 3PVLA 2OTLT 5DM6Q 1MMGA 4NLVA 4NLGA 3IP0A 1NK7A 5CKDA 1JLEB 4NXNF 2VXFA 2C3UA 3I82A 4CLYA 4OYXA 1RT1B 3QWPA 4C3KA 4ICLB 3GV7B 2Y9HA 1HD3A 2QYGA 1HNIB 4N41A 2ASLA 2BJ9A 4FNIA 3LQVA 2UV8A 2Q6CA 3RDVA 2R2UA 2DB1A 2W9CB 2C3OA 2XSJA 2HSEB 4CQ1A 4ZJQA 3J7Z5 1M2VA 5M9OA 2DXTA 1NNDA 5I42B 5KG2A 3KLIA 2DEUA 3M55A 4UQGA 2RJDA 4RJVA 3AJ2A 4X66J 3H7HB 4C8QB 4C92E 3IS9A 5K8MA 1X4GA 2H65B 1TQLA 3C12A 3BPDA 1WDDA 4NLXA 2WBRA 1UVLA 4PJOE 1UTIA 4JPBW 1K0SA 2JN0A 2K3KA 4KSEB 1ZH5A 1LCKA 2XMTA 4PPDA 1SH0A 2FDNA 1HBUA 3MUVP 2GHPA 5EDWA 5C7PA 5EUHA 5FU7B 3L2QA 3I6PA 1RT5A 2B51A 4JJBA 4KHRA 1TZ0A 3ZNJ1 5HMWA 4DS5A 1QP2A 4HKQA 4F8RA 1I6JA 2CP6A 1T9YA 2DVIA 4YTLA 5CD4H 3D6TB 1AROP 1SQGA 3MDFA 3N28A 2CDTA 5B0EA 1YRXA 1FKAF 5HI7A 2ZH1A 1T05A 2JM9A 3V81B 2I1RA 4E7JA 4J37A 4KGMA 1TUVA 1EIYB 2CZ6B 3C4SA 4J7IA 1W7WA 4YHHJ 5L8RE 3W9IA 4OYOA 4V1Ak 3RKXA 3OQ5A 1NHUA 2JZ5A 2DYBA 3CC7T 2DGQA 2FPHX 2KM8C 2HNZB 1NCLA 2R2RA 1FDDA 3TVZA 2B6AB 3CMET 2DBBA 1H6KX 1G1XA 3F0NA 3D7SB 2X1BA 1PSDA 2NCKL 1VK3A 2V8IA 3AQPA 3NGSA 5GAGI 4WZMA 1XQHA 2RK2A 5KFJA 3OTOJ 4E98A 2KFZA 3BSOA 1DLOA 3JQKA 4Y0FA 2CGHA 2A10A 2VC0A 5KYXB 1D9AA 1N8RU 4M5MA 4RUGA 2JLEA 2VKNA 3PT9A 3CCLA 1LWXA 3F73A 1TK0A 4O3NA 2J6UA 4ID5A 1UVNA 2B43A 3LP2B 5GAOl 5DM7R 4IH6A 1WC1A 4MKAA 2E5QA 2BE2B 1L5UA 3CCJA 4J9CA 2E3HA 1M1HA 3MTKA 1T9XA 2OTJS 3CXCA 2VASA 1YRUA 5DRKA 4E8UA 2KRRA 2GQQA 1FX7A 5I3UB 3MF5A 1GXUA 1CKBA 5GAMj 2WAQD 1KLMB 2X3WD 3M0TA 2AP6A 2XMWA 1X9WA 2JFDA 2BRLA 4JS5A 2V8KA 5I3UA 3EGUA 5IWAF 2Q1LA 4C0FA 2LDMA 3RIRA 4YR0A 4CRIA 2DNKA 4FM4B 2DY9A 3R5CA 3Q8YA 5CK9A 2MIOA 2G1HA 1W70A 2R7XA 2F69A 5F8NA 2EFNA 3DLKA 1S0NA 2V1RA 1C2PA 1YIJA 2DGOA 2AZ1A 2JLFA 1WNLA 2FHKA 4ZP9A 4A8QA 3Q89A 4OMMA 1RWMB 5GAMe 1X5TA 3CD7A 3WIVA 3HKSA 1JX4A 4Z2XA 4JJNK 4Z8AA 1DTQA 1HWJA 1X5SA 1W2BR 2J9EA 1JK9B 1S0MA 3CTRA 2IRXA 2HGMA 2HGNA 3BH6B 3R9LA 5ETLA 3O1LA 5KOWA 4DXLA 1UWAA 2G0IA 3CPWA 1YJ9Q 1BQNB 5BYQA 5D4LA 4JI3F 2V8PA 2D3ZA 4KGKA 3H41A 1H74A 3BREA 3FGVA 2GC8A 3BO2A 4ZCIA 5KYYA 4XDDA 1ZA1B 3T6JA 4M63A 4I67A 1RBLA 2QQBA 3QG1A 2ZE2A 2CS7A 1VQKQ 1S9GB 1VISA 4PZVA 2F65A 4PFOA 3M30B 4C8ZA 4X65F 1U1KA 3V2UC 1M8VA 1YJ9T 3OL6A 3ZTRA 3H40A 4L3NA 5LJ3g 3CDUA 2VF3A 2KSSA 2FLOA 4OI6A 2BYCA 4R0EA 3GG0A 2XHCA 2VZ9A 1JXVA 1X31C 1VRTB 1S0VA 5EN1A 4M5NA 3JCMJ 2IMOA 3AHUA 4LF6J 1Q78A 5CAIA 3HHKA 1KS2A 1CG2A 1Q79A 2J0XA 2P9EA 3TSZA 2CG4A 4IUQA 3CJ3A 3TP2A 2V2ZA 3CCVS 3CCEQ 2IA0A 2RQCA 4N47A 3DDIA 4LDUA 4I7FB 4ZCLA 1JEGA 1OV3A 3K5LA 2J0QD 1VQ6Q 1I3OB 1VLOA 2RQTA 1SV5A 4Y28E 1NJZA 1RABB 2EGEA 2VIHA 1U02A 3I5SA 4FZVA 2MLYA 4NI2B 5CVIA 2YKMA 4LF9J 4R5PB 2HQHA 4LFCF 3H5SA 1TWBA 2BANA 1PJ7A 5IM0A 2KRSA 2BVZA 4PL6A 1D0ZA 2KXFA 3CIMA 4M75G 2DD4A 5GAN5 3TU4K 2CZ1B 3V4IA 1T7PA 4HDGA 1YRTA 2MHEA 1LWEA 1JNRB 3PTWA 3R2CJ 2BOAA 1WEZA 3SEOA 1WHVA 3M2VA 4C0DC 1CJTB 1WOPA 4C3LA 4EO6A 4E6RA 2E44A 2XLKA 2HEQA 1HFEL 1JLBA 3J80Y 3FRYA 3K5NA 8AT1B 1LNXA 1G7CB 1YCYA 5ETNA 5ITHA 3IGVA 2NUPB 3GOXA 1HBOB 3E19A 1WDTA 1XNRJ 4HH0A 3BGRB 2OPQA 4DV6J 5GAOp 4Z02A 3CSKA 4L74A 3H90A 2HAFA 1Q82R 4TYAA 3OA6A 2B6AA 5GADU 4RUCA 4C92F 1VGYA 2YRCA 3RKYA 4IO1A 4DFMA 1JRIA 3QXEB 4NRUA 1LJOA 3PIPA 2HVZA 1NPPA 3DC2A 1FRJA 3MFHA 1Y96A 3UN5A 2E5LF 5FRNA 3CJRA 4RNHA 1VYAA 1WHHA 1YITA 4RBVA 1LWCA 3P5TL 3UPFA 3C94A 3PEHA 1M90T 3BSNA 4NA1A 2DO4A 1VQ7A 1PYOB 4NZ7A 2MJNA 1VQLT 4H4OA 3PEJA 3LWHA 3PYGA 2ZUGA 5I3QA 2ZUAA 1S1VB 3SSQA 2I5JA 4QW8A 3BBBA 4EUVA 2HKEA 3WDOA 5H9EK 3MEEB 3EX7B 1BCMA 1HI0P 3VS5A 4RCBA 2D3UA 3J81j 5CKFA 4ZTFA 1VQ7S 1SSFA 5J1NA 3BBCA 3PKMA 5HBMA 2KFYA 3EG9A 4G65A 2M88A 5D0RA 4LSNB 2C28A 1Q8IA 4NLOA 1KOOA 4M5JA 2UP1A 3M53A 3W66A 3LW5E 5I11A 2YT6A 1AHJB 3FNNA 2OMLA 2Z2YB 2F5GA 2JHEA 2ZC4A 4QVZA 4RW4A 4BD3A 4AXJA 2HS0A 3E51A 3MP8A 3QAEA 2HNDB 1NK0A 2WSEE 2Z30B 3NRBA 5LSRA 5BYRA 1N5ZA 3MR3A 3LP1B 1S1UA 2XI2A 4JV2A 3NEKA 1RT4A 4K11A 4NYZA 3LF0A 6FDRA 1NZ9A 2L89A 3DLEA 3MJXA 3CJKA 4UY85 2ZH5A 4X64F 1N34J 5GAN3 4C3MA 3OUYB 5MAOA 5IAYA 1VRUA 4KPCA 5HQ8A 4RNMA 2UZAA 1N0UA 3T1YF 1FVSA 4IUTA 1NYGA 3EZ5A 5D7UA 2WSFC 1IQZA 3H2LA 2MKJA 5D15A 1KD1U 2Y8WA 2AMCB 3F44A 3JSRA 3VRZA 2FG0A 1YCSB 2CKWA 2OI2A 4N7TA 2XZDB 1Q86T 2EBEA 1T3NA 2V0NA 4WE1B 3PGGA 4QZVB 4J8OA 5J2QA 2MKSA 1HNXF 3BGUA 4FYXB 2D8JA 3CC7Q 1FCAA 2LVMA 1K47A 1Y9OA 5ETRA 3HP6A 4ELTA 1GBQA 1IGQA 4DHVA 3U27A 2AV5A 2ZPIB 4OB1B 1HBUB 3HT0A 2UU9F 3MR7A 1K0VA 2VBXA 1RU1A 1T05B 2GHVC 1RTJA 4ECXA 2E64A 1X01A 2B4PA 2IG0A 5LJ5g 4LD6A 2AWZA 2XULA 3DKDA 4U95A 2YRVA 1U6FA 1K8AT 1RLQC 4OMPA 2GQ2A 5FWCA 3HPOA 1VYVA 3M6WA 1LNQA 1KVJA 3W5YA 1UVMA 3M05A 1WXBA 4K0KF 5KYNA 3OYGA 3GFXA 5IHIA 3Q83A 4NXMF 1W2BP 3VVUA 2BANB 1BHNA 2LU2A 3FMBA 5IWAJ 4A4KA 4DEZA 1ITPA 3D0IE 4JJCA 3CULA 1SV5B 1F60B 5IOLA 2B3TB 5F8IA 1VLYA 2Q66A 3IFEA 4M7DA 3C6UA 5DZ6A 1WG1A 3EUNA 5CD4A 4NCGA 2B9XA 3PFOA 2V1QA 2VV5A 2LQNA 2QA4Q 2BM0A 3R2DJ 2LQBA 4NI2A 4DPWA 2ZJRQ 4RU2A 2MQMA 3UCUP 4JUZA 5M2RA 5E2QA 4CP5A 3ETOA 3MFIA 5GAN8 4NOHA 3CCSQ 2PEBA 2MCNA 2K7KA 1GMUA 4QR0A 3QT5A 4ZLLA 4F3MA 1NJIR 2PEHA 5GAMd 2DVEA 4YHHF 3VS3A 2DR7A 2Z0WA 4J91A 2AGOA 2XBPA 3CQTA 4DR2J 2CQBA 3HVAA 5GADI 3N6NA 1TVRA 3CVKA 2E29A 3Q2TC 3OW2S 4WXWA 5GANf 5KYXA 4M77A 3SFGA 1RKJA 1S57A 5FD1A 3O2IA 2COZA 3FBFA 3IBCB 4BDZA 2ZCFB 3W1YC 1G2EA 3RMQA 1MU2B 2DX1A 3PX6A 3UNYA 1H98A 4MDXA 1JJCB 1B99A 2W0ZA 1JLQB 4DR4F 5HK4A 4KRTA 3MPYA 1Q7LB 1ARKA 4QYZJ 2HLUA 2PI5A 4N0AA 3PV8A 1V1CA 1RHMB 3H2UB 1U0SA 3VHQA 2HBYB 1LEOA 5KYUB 2I0XA 3L2VA 3PCOB 4PKDB 2Z56B 4J9SA 1VQPT 2AGPA 3CPWS 5SZTA 2CJYB 1T94A 4DL5A 1J3TA 3JYTA 4WK3A 2QLFB 3UDEA 3OW2P 2OTJA 4N8OA 1U47A 3L4BC 2JEFA 2PMZD 4TVAB 3UD4P 5J1PA 2XNRA 2CRLA 1YFNA 4OB0B 1TKZA 2LXUA 1S1TB 4DWIA 2X51A 3FJ5A 2B4OA 5CH7B 5IT9Y 1LOUA 4J9KA 2HHWA 1OULA 4NASA 5CA5A 1JNZB 4ELZC 1D3BB 3I55A 2EFQA 2XMVA 2VKZG 3NLCA 1D09B 1MROB 2WSCC 4PUOA 2CYYA 1FEHA 1RTZA 1YX2A 2IVMA 3G1JA 4CT8A 2P8IA 3DLKB 2NREA 4H4OB 2GMLA 4B9MA 3MPDA 4LF9F 1MROA 2FY8A 1BWEA 3PHEA 3N79A 3I5RA 2HHXA 2WB4A 2YXLA 1YIJS 4JDSA 2IRYA 2ZHBA 1FRHA 5ETPA 1BU1A 4A4EA 4C9DA 3LA0A 4OLOA 3M4YA 4M77F 4O0NA 4X4NA 1AA1B 2P4RA 4RR5A 2LQ9A 2HBQB 5L9NA 2C2KB 2BQRA 1N6AA 4QIEA 2D6FA 1HYSB 1VIOA 4H4KA 3W60A 1W4SA 2KI2A 2DH8A 4GO5X 2MZTA 4IG3B 2CQCA 4XTYA 5CQGA 5RUBA 1N5QA 1X8DA 2AKLA 3EVWA 3ICLA 4ZVHA 1MHNA 4FXWA 4LMZA 1S72Q 3O8VA 3MM8B 4KTQA 2FB7A 2W4DA 4C92C 4HVZA 2DL4A 1OZ3A 2JS0A 1CC7A 2WBMA 3MCMA 2ABYA 1CJKA 1SKRA 3S3MA 3GSDA 2DR8A 2PC6A 1FD8A 2VODA 3O3LA 3PKYA 3ZTQA 3CCQS 1UZDA 1S49A 5F41A 3MPVA 1IBKJ 3JB9D 2DRDA 1M3AA 2HK3A 4U7CA 1G83A 1NBEB 3PR4A 4GC7A 4J9BA 3NBPB 1FDNA 2RDDA 2PVDB 5K9FA 1N8RC 1KFSA 4E7KA 2QI2A 2V34A 1HNZF 1ZLMA 2LEAA 4DCOB 3M2VB 4NEYA 2BX6A 5D0EA 4ZPDA 4ZP8A 3D2WA 1H3DA 3QZ8A 2B9WA 3BN7A 3FEYB 1WJSA 1SG5A 3NFCA 4RPFA 3QKJA 2FJDB 1LW0A 2RHSB 2OUGA 3GG1A 1GQEA 2Q3PA 3OYMA 2EYQA 3R7BB 1T9UA 1FRIA 3UCZP 2WZ1A 4NE9C 2DHSA 3R5DA 1YSJA 1HI1A 2EQIA 4DUYF 2BKDN 4F04B 3CC7S 3OS0A 2V9WA 2DMOA 4P6QA 2CUYA 4AG1C 2MQNA 3HF5A 3NKYA 4I2PB 4M7AE 4IUVA 4CC4B 3RUXA 2GCFA 3A3NB 3CPFA 4MKYA 1CJVA 2HKNA 4IRCA 4WKYA 1HARA 4ZN1A 2HQFA 3DM2B 2WK4A 3IBFB 3L9ZA 1EZZB 3RB4A 1TELA 2ZPGB 2EAYA 3RR7A 2OGUA 1VQMQ 4F0HA 4A4FA 4B3SJ 3N0VA 3UFCX 4Q2LA 3QRPA 3HVTB 2QA4T 4BC9A 4LF8F 1BI3A 2JC1A 1FMVA 1BGXT 4XTWA 5LJ5Y 1KKHA 4NLDA 1N9SA 2C22A 4YB5A 3ELHA 1EAYC 5CYQA 4DSLA 3TX8A 3U7JA 3W8GA 4B9XA 1UFKA 3WC2A 3M5AA 2ESWA 1XNQF 3NGPA 1UA1A 1RCOB 4XU2A 2HQXA 2HLTA 3R6GB 1B34B 5I21A 1KJWA 4PXBA 5J26A 3SQOP 3PXGa 2K6DA 3PMTA 4PG5A 2FPEA 2PFDA 1HL6A 2HQ3A 2ADCA 4C0BA 1SIWB 1KTVA 2E1MC 1K4US 1B0VA 5ETKA 2R3VA 4LJMA 4F17A 3I56S 4L3KA 2L0AA 5LJ5d 5KG4A 4DCJB 4USJC 1WF2A 3MGJA 4J9VA 1VQ7Q 4RL1A 2KG0A 1I4K1 2GCXA 2XY6A 1X5OA 4QIGA 4JI4F 3NS6A 3KJVA 4M5DA 3VU3C 2Y3YA 1B7TA 1RWKB 2C0IA 4C8NA 2EW9A 4CO1A 1RYSA 3T9NA 4U8YA 3BSCA 2QA2A 5A0YA 1WHYA 2RI5A 1R0BG 5KG1A 2KHDA 4B9TA 3HKWA 3LWIA 1N27A 3DFEA 4PYDA 4OV6A 3ILOA 3MMCA 5A76A 1IBKF 3O44A 2ZBIA 3HD2A 2ZH8A 4PWUA 2JVVA 2EKHA 1GK8A 1Y4ZB 2BEFA 2CQHA 2KRNA 3H59A 5ADZA 3DGVA 3NGKA 1F5AA 3LAMA 3PMIA 4WP8A 3T41A 2X4YA 4Q8FA 3PZPA 4YMEA 1QW1A 1K8AR 4LIWA 4WTYA 5HP1B 2GQCA 3OXFA 3GZ7A 5KYWB 4IUFA 1PAEX 5GAHI 2VB6A 5KFEA 5A0YB 1N52B 3A1YG 4ED0A 1TL4A 4X84A 5KG6A 3DOMA 3RJMB 2RNEA 3G71Q 3O8WA 3BR9A 3HHTB 1KNZA 4LSZB 2GGPA 1OS5A 4C0ZA 3HVWA 4F4XA 3MAQA 3OR1B 3M56A 4O23A 4QQDA 1EETA 2XS2A 1T3SA 2E12A 3WXMB 3L42A 4CTAA 4IQMA 5D6GA 3S3OA 2PA8D 1UJYA 1QVFA 5CIUA 1FI4A 2ENMA 3J7A1 3U1NA 4ICLA 5B0FA 3VF0B 2ZPBB 4CM2A 2HVHA 2QLBB 3T1YJ 4M7AG 4KR0B 4C5GA 2Q79A 1KONA 2VXEA 1WXTA 4BBYA 4U67Q 2F8EX 2BKPA 5AJ3F 4ZPCA 1OYEA 3VCDA 3QIIA 4DR6J 2HHSA 2CNNB 1M1FA 1UEBA 3IG1A 4FKXA 3JAMY 1RLPC 3G6YA 1V5IB 4IO9Q 1HBMB 1YJNQ 5J2QB 3ASKA 5GMEA 4XU1A 1ZM9A 2KYZA 1H2VZ 3M58A 3DGPA 1FTCA 3DXSX 3V4MA 1VQ6S 1Q16B 2DBKA 3CNQP 4ZVSB 2ZITA 3MI7X 2MQOA 1W6XA 1RTHA 2PD1A 4MYTA 4FT2A 4O3PA 2DJWA 3QGPA 3EICA 3H0HA 4F25A 4EYHB 4DR5F 2PN6A 2HCKA 3KG1A 4QR1A 4WF2A 1U2RA 5KT6A 1RB0A 4AXIA 2LXFA 4PABA 1R6VA 3CXCP 4RWWA 2OO4A 4JYAJ 5BR8J 4X4TA 3OTBA 4DI6A 2W25A 4JRQA 3V4IB 4KRWA 1TUDA 4JI4J 1FX2A 5LSOA 5LJ3j 2JH3A 1S7HA 4LBIA 2E6ZA 5E3CA 4QU6A 4Z88A 4PXDA 3W63A 5J2NB 2OP5A 4EWTA 1FWPA 2NYSA 3EDQB 1PSFA 4PJNA 1OPLA 3UD5A 5FDLB 4FXDA 1WDXA 4J9OA 3DU5A 4OZJA 3UA7A 3RW6A 2VKRA 4X62F 1OZ2A 3R6LB 1JJHA 3M9MB 2YKMB 4A48A 5HANA 2I2YA 2CJQA 4LBHA 5HO4A 1P92A 4K50A 5F0WA 1HJDA 1HWUA 2DIQA 4BWMA 2RNAA 4ED3A 3QYGB 3UN3A 4F4ZA 1APSA 5CCLA 2E1AA 3L1AA 4LF7F 1S1TA 4C8KA 4LF8J 1TUGB 3V5RA 2J0SD 3RB3A 2EQUA 4N4GA 4UW2A 2DLPA 5IHNA 1VJQA 1QQJA 3N5FA 4DV6F 4K4WA 1X4AA 2C2OB 3QWUA 3GR1A 5HVGA 1JLBB 4QIVA 4NLUA 3FMWA 2BE7D 3VZIA 3NAHA 1VS3A 1U1MA 4DV3F 2KXHA 1B07A 4PR6A 5LJ3f 2ZOGA 4EBCA 2PMWA 3I9ZA 2W24A 5JXSA 1X9SA 1N54B 4A8XA 5J2PB 3GYXB 4ZVQB 1KK7A 4C92G 3AJDA 3CJSA 3QAUA 4XIUA 3L95X 2QTXA 2HZVA 3LOUA 4E2FB 2JUFA 3GLJA 2FJBB 4R25A 1LK7A 2MKYA 2J5AA 2DXBA 2C3MA 2AZVA 1AD5A 4OVAA 2EJFA 4N77A 5KCHA 3VAGA 1HPZB 4ZVEA 2OH2A 3VWSA 1NSPA 2RVJA 1VHFA 2OTJQ 2ZD1A 4I6YA 1VQMT 2QMXA 2WVEA 2QL7B 2YLCA 1IKYA 5A8WB 4WK1A 1SJFA 3CCZA 2EFIA 4ZPWR 3ZZUA 5ETTA 3S8SA 3A3OB 4KT0C 3PX0A 1NLPC 3IN5A 2IJNA 1S1UB 2MPUA 2YQ1A 4NS5A 1QD1A 3NMAA 4LIRA 2NUZA 3QWYA 1D3BA 3AH6A 5F0UA 4FVCA 4XPEA 3I5AA 4G1IA 2LDYA 4Q45A 4WU3A 3C95A 1VQYA 2UXCF 3OJSA 1TUCA 4TY8B 1T11A 2DEJA 2GFFA 1OOTA 2WVDA 4LFCJ 4KGXB 3W5XA 2O67A 2C06A 2KEAA 1HD0A 1NLKL 3G82B 1OPIA 1H92A 1AYEA 5K8NA 5CKHA 1U6BA 3M8PB 1VRTA 4DQRA 1ZX6A 2DISA 5LJ3h 2BQUA 3CCRS 4JI7F 1HNIA 4CC7A 4QWCA 3M54A 9ATCB 4JLIA 3P49B 2R57A 3LP0B 2W7PA 2B9EA 3I0RB 3B82A 2KXNB 2RHZA 2HBZB 3MD1A 5DY9A 2I6WA 2QGGA 1RT1A 3W62A 5M2UA 4XU0A 3GLXA 3EDRB 1XNIA 3AT1B 1RI9A 1VQ4T 2W4PA 2UXDF 2HMIA 5B08A 3J7YI 3M7VA 3I56T 4RKUC 4EMKC 4FW1A 1KN6A 2DTOA 4WE1A 1ZUYA 2FYKA 1BQNA 4HVVA 2VL1A 2EQKA 1VQNS 1PD1A 2BKOA 4F7UE 2K4YA 1ACMB 1NHVA 3FKBA 4EO8A 1N5SA 4ZP7A 3CMAS 5JMNA 3K5MA 8ATCB 2AK5A 1HBMA 2DIVA 1SC3B 4LN2A 2MSSA 2AKWB 3OSVA 3CJ2A 3CCMT 3C16A 1WPYA 4M5IA 3ENAA 3LH0A 3JQJA 3BB5A 1NH7A 3CMQA 4LR8A 3OXLA 3TAMA 2JX2A 4ECRA 2YKAA 2ROGA 1E6VA 2PU9B 3HZEA 1NSAA 2AYMA 2LU1A 1YITT 2Y1LB 5LJ5e 2ZOFA 4J9UE 4FKYA 4U8VA 5IQ6A 3S01A 2V4JB 3VZHA 2RUGA 3QO3A 5T14A 3LGMA 3RKWA 1RUSA 1H8KA 3DKMA 4M78A 1FA0A 4AG2C 3SMZA 2W2OP 3OTDA 1KTQA 5F8MA 1TS9A 2BJ8A 3QJJA 4IUPA 2QV6A 3MR2A 2UUTA 1HQ2A 1GMWD 3KUGA 3GBQA 2OAUA 1H7WA 2R9LA 1Q81R 1G3OA 4OZ5A 2X1FA 1AOJA 2O4XB 4KT0E 5J39A 1M1GA 3N4WA 2K2PA 3MP6A 1IM4A 3PRVA 1RWUA 4KO0A 3BW1A 4A46A 4YB6A 1N48A 1RTHB 1CJVB 4Y2IA 1WC3A 2FVCA 2LJ0A 2VYTA 3TARA 5KFWA 1IUJA 1B0PA 1ZBTA 2H51B 1W2IA 1KD1R 4ER8A 5GAMg 3TCJA 2VQFF 1CPZA 4O3RA 1TKTA 1XERA 1RAHB 4RG2A 2QRRA 2E3IA 4RW9B 4J6YA 2WACA 3P3DA 4BHQA 1RAIB 2ZFHA 2CYZB 1VQ8Q 2F7VA 4M75D 1RTIB 4S0MA 3JCMX 5HK0A 1N88A 4ZLJA 1VQOA 3V6KA 5IN1A 4C8YA 4TU8A 4DBFA 4X64J 1N34F 4QQBA 1RAOA 4H4MB 1WC5A 4O4GB 3FEOA 3KFWX 4E47A 4OGEA 2BZYA 2AKKA 3SWNC 2PFFB 4JRPA 3LP2A 4M8LA 2ATCB 1EQMA 1CBKA 3KG0A 3CD0A 2K5IA 1Q5VA 2A37A 1REGX 2G1DA 5K8PA 2GFUA 4BI4A 3META 4GVBB 3I4PA 3QYHB 4M78G 1ZAXA 3CCVQ 2K7JA 5KFCA 1M1KT 3M59A 4MKVA 3DOKA 4A8MP 2PE8A 2RU3A 7AT1B 4PJOD 3HDSA 5F3ZA 3OW2R 1NDLA 1WFWA 4M7DG 2YHTA 4DV0F 3W2WA 2A7YA 2K2MA 2FLPA 3OYLA 1TAUA 2DL7A 2DO3A 3NS5A 3EAEA 4EMKA 1ZM3A 2GZOA 5LJ5f 5KFPA 1ZSZC 4M7DF 2VG6B 4C8MA 2LDIA 4NLPA 1ZSZB 1FFWB 3AODA 2AD9A 3FSYA 1M5VC 3TA1A 1O5JA 2NZCA 4IR9A 2GGRA 3HSBA 3BO4A 1YGYA 4ZA1A 4HL9A 1VQKS 2RI2A 4OX8A 2VHGA 5DG9A 3CDEA 1MWQA 2L5QA 4DUTA 5LJ3d 1NEBA 1U8WA 4MIWA 2HZCA 5A2QY 3TUPA 5E3QA 2MEWA 1VQPA 2CIMA 2ILYA 4CI0B 2APOA 4L76A 2E1HA 2HW3A 5HJYA 3JAME 4PG4A 4B3MF 4P9SA 4CWBA 3KDOA 5K5MA 3V6DB 3OVAA 4ZCMA 3GNFB 4IFVB 3M9NB 4RTVA 3N6LA 3SCJE 4N8NA 2XYGB 4RTZA 1PNJA 1M27C 4M1KA 2R58A 4XO0A 1C0TA 4UQTA 2K7AA 2ROLA 4PG8A 4PQUB 1AZGB 2F4VF 2FGOA 2X4XA 1YK9A 2HFNA 1UVIA 4FYDA 3OYAA 5AXLA 4URQU 1GXTA 1J5EF 1WI7A 1NLOC 2AZ3A 1QAYA 5BYSA 1IHVA 3R5GA 3E9FA 4DBRA 1PYSB 2BBEA 3SHWA 2AJ2A 1IHWA 4MT1A 1M2VB 1CS4A 1WHKA 3BEGB 1C0UB 2OPRB 2DL3A 4UF4A 1QJHA 1WJ9A 1AEYA 3KKFA 4WPAA 3OPKA 3W5ZA 1XOVA 2QMWA 4M77E 3BGFA 4JZ3A 2RQ4A 1JLEA 3TREA 2DZCA 2DRMA 4TU9A 4J9QA 5KFYA 2MLZA 3C46A 3FSXA 1D0EA 3VAMA 2EBGA 2YNFA 4W4MA 1RCXB 2YX7A 3QUIA 2O9SA 3GFYA 1I1JA 1YI2T 2XS5A 3SV3A 2CP7A 1RXOB 2XWXA 4L75A 3JB9I 4C92B 2WTFA 5HATA 4ANDA 2RQRA 2YUNA 4M7DE 1JLGA 1G4CA 3KBGA 4ATOA 1NPKA 4X4UA 1FKPA 3MPWA 5GANh 3E01A 4BDYA 2V8JA 1Q7YR 1HD1A 5JVGQ 4J7CA 5HROB 1SKUB 2FVQA 2RQMA 2CT3A 1YWOA 3CCJS 2CADA 4OV1A 5G4DA 3TO8A 2K5FA 4FP9A 1UHFA 5FLXY 3GQCA 3NL0A 4DR3J 2R42A 2AYBA 3LX7A 2B8AA 4O0IA 2YSQA 2A2DA 4B9UA 3L09A 1WIEA 1EJ7L 4RBUA 2PSZA 4F7UG 4FL6A 1VQ4S 3PNIA 3U1LA 4DU8A 2FGCA 4DSEA 2DXFA 2XZTB 4OFZA 3J81Y 3D6HB 2D1XA 1YJWQ 4IOCQ 3WHIA 1M5OC 2RM4A 2IVYA 3JCMe 3U23A 1C1CB 1QCNA 5IQQA 3KMQA 2VOPA 2MQPA 2ZC3A 2KMTA 1TKXA 2JVRA 5B0GA 2MTLA 2IY5B 2RD5C 3GPAA 4KB7A 2M51A 3M32B 2PI4A 1WGSA 2N3OA 4G6VB 1ZTWA 1ZBXA 2BE2A 5LSLA 3QJLA 1U5SA 2ZOMA 2KYBA 2NXNA 4F3OA 3G6XA 4J9RA 1QUVA 1X4DA 2B8PA 2G2ZA 3JB9J 2D8HA 1ZSZA 4UZBA 1X7VA 2W8KA 4K4UA 1U1SA 1UFLA 3AXKA 3BYRA 4ZTJA 1S9EA 3CT9A 2HAIA 1MMLA 1L3KA 4DPYA 4LRAA 1FMKA 2DNUA 5C42A 2PMHA 1RI0A 5L39A 1ZUKA 2IM1A 5ETVA 1YJWS 1IQTA 4DJBA 4LFAJ 2FVSA 4BY6B 1X60A 1VQ4Q 4X62J 3CBMA 5J2PA 2LCLA 2JOQA 2ASDA 3MPUB 2KFNA 2BXJA 1HA1A 4DOZA 3PW4A 1SPKA 2Y90A 3DRRA 3KK3B 3LP1A 1NDCA 8RUCA 3K5OA 3VUBA 2V2QA 1XK8A 2OJ3A 3FB9A 2FD2A 4P71A 2UUAJ 7FDRA 1VRQC 1M8MA 3ZEHA 1P8GA 4NRTA 5KOXA 1VRUB 1S77D 3Q2SC 4HHUA 4LXCA 4YB7A 1MN9A 1TUWA 4C11B 1FT8A 2CPZA 1SEMA 2FRWA 3M1VA 2HHTA 2QL5B 1FJCA 3LALA 1SUQB 3KUEA 2W2MP 3E1SA 1WKJA 3CCRA 2VG5A 1AWWA 1HWLA 3IC1A 2W9AA 1UJ6A 4PUOB 4RWXA 1X5PA 2PUOB 1LV5A 4ETXA 3VS2A 2MQQA 2XHWA 4HKEA 3JCMf 2KGTA 2YBVA 3HRTA 3MAAA 2UXBF 3BDUA 2COYA 2HBWA 3QO9A 1UGSB 1U1LA 1SJ4P 3TEGA 2BUDA 1H72C 4KV8A 3PJXA 1AWOA 4ZJOA 2A0FB 2BMBA 3DHWC 3CC4Q 2E7VA 2YKOA 1BB9A 3TX0A 2C42A 3SSRA 4NLTA 4FVMA 5BJRA 5KFLA 1ZZNA 3H5YA 2VBWA 4WFZA 2CDRB 1IO6A 3CC7A 1WHWA 3B54A 2GFAA 4U6PA 2QA4A 3E2EA 1Q82C 2DGUA 2ZPFB 5KT4A 4RUBA 1WOOA 4HCCA 5I42A 3P45B 1M9SA 4PFPA 3URGA 1MMNA 4JI3J 1VA7A 1VC5A 1G3SA 4M7AF 4I64A 2HHUA 3IR5B 2GNKA 4FT4A 3X25B 3DXBA 2HWIA 3FVYA 3PO5A 3NS7B 2DYAA 2KT2A 1UEKA 2QEXS 2OIHA 4MK8A 1F3VA 1U1QA 1T0HA 3IAM9 2HQCA 3BDPA 4IG0B 1OSCA 3NMZC 1VQLS 1FJ7A 3DM2A 1DY3A 4TQRA 4ERDA 1XEZA 3TAMB 1KLNA 3C15A 1I8FA 2ZH6A 1DTTA 2CA9A 5L1LA 2OI3A 5KTQA 3H20A 3QNWB 5EWGA 1K0TA 3LWMA 5IZHA 1QCFA 2LA6A 4M75C 5L8RC 2BM1A 5LT5A 3BJYA 1HNXJ 1R7IA 2UXDJ 2DR9A 5DETA 1YP5A 1TXQA 1AT1B 3P6YC 1BI0A 1GXIE 3JSCA 4KHPJ 1R31A 3QSUA 3OFEA 2ZZDA 2CZ4A 3FJPA 2YWWA 2RF0A 2RHUA 3BO3A 2KXCA 4Q0BB 1MV3A 3HI9A 4DR4J 1WG5A 3CCUT 4GLKA 1XIQA 4F4KA 4YOEA 4NCGB 4OX6A 4HR2A 4ZHRA 3IM8A 3I55S 5FLXU 2PT0A 2RHYA 2BE9B 1OO0B 1XBWA 1TKTB 1ELOA 1U6ZA 4ZPTR 4IIOA 2CPYA 4M75E 1BQMB 2FTRA 1S0OA 2HNYB 4K7QA 1QTMA 3JV3A 3B4MA 3MOZA 4MYUA 3MAHA 1HQEB 3RYLA 3MEGA 5T7LB 2YWHA 1EB0A 2RO0A 4RW6A 3R8YA 1W25A 4M77G 3G6EA 2DKOB 1S6QB 3MM7B 1OIAA 1C1AA 3IQLA 5GAEI 3OSPA 4Q0BA 2EC0A 5AE1A 1Y07A 4R8UA 4A63B 4YDDB 2V69A 3MEGB 1D8YA 1QWFA 3N6MA 2HS3A 3AOBA 2R2SA 1B34A 3UA6A 2JEJA 3K2YA 3RAQA 2BZ2A 4LRFA 2W2NP 4J9HA 3L7PA 2NQPA 2FHOB 4BC7A 4KBMB 1VK8A 4UUXA 3P8BB 2A3JA 3IRWP 3M6UA 2A6OA 2Z8QA 2KTQA 2MMPA 1VQ8S 3BPSP 4CT9A 1W2BS 1OQ6A 4L6V3 3EVMA 4J9GA 4LF2A 4CC3A 5B0CA 3GIRA 1NJYA 1LWCB 2P6TA 5CYQB 4DX6A 2DD5A 4WCEQ 4RUAA 2KAFA 1IRXA 1R0CB 3EHQA 4PXEA 3CCJT 4I68A 5ETQA 2CAJA 5I22A 3VS1A 4J9LA 3A8JA 4V19X 4RZRA 4O3OA 2XU8A 4DSFA 1Y0HA 1K9MU 1OMSA 4NZ6A 4DG1B 1PC0A 1TFYA 1VHIA 1XC9A 4LT6A 1QVGR 1ZAWA 2ZBQA 3M2UB 2O66A 1KHWA 1UCNA 4X34A 2BDPA 3V6HA 1N6QB 3PW2A 3G4SA 2RD1A 1HXDA 3M8PA 2HRTA 4KV8B 2ZM6J 3UN2A 1N8RR 5KYWA 4ED5A 4C6AA 1YN8A 4ESRA 1AZEA 2HFUA 1IZ6A 1PCXA 4Y2MA 2YUQA 4LREA 3PJ9A 3CCUQ 4DR3F 3G82A 4OGCA 1XJWB 4HTIA 4N76A 2MZSA 3QHSA 4CRJA 1YJUA 4GMKA 3MXHP 1R27B 3CCTA 2KDSA 1RUWA 5KT7A 4OX9F 4HH1A 4R56A 3GMGA 2E6NA 3JB9k 2DGVA 1QVGP 2FIUA 4AFZC 4TY8A 4FPRA 2QK0A 5IXFA 2R7RA 1UWBA 1MWYA 2U1AA 1FNMA 3CMAQ 2BUNA 2LXIA 2AF6A 1IBMJ 3M1VB 3H4DA 1TOVA 4QVCA 3ENVA 3SFUA 2ZWOA 3BSAA 3BS9A 2J6FA 1VQNQ 5D4PA 3Q8RB 4D3GA 1YWXA 2XICA 1FKOB 1RTJB 5I2MA 4K2JA 4UZCA 2X7IA 3NBPA 3NG8A 1WI8A 2KBTA 2HQIA 5BR8F 1Y71A 3SZ2A 4FBTA 4JYAF 3WQPA 1E6VB 2ZNZA 1DBDA 4Y2KA 2VUBA 2HIYA 1N8RT 1JXLA 4RUHA 4USTA 2LX7A 3OHBA 3DDKA 4DV7F 3QDFA 3CCRQ 1VI7A 3QZ7A 3DHXA 5DQIA 1IBMF 4MTPA 3FQKA 4YDXA 3OS2A 1M1KC 5LMUJ 4B3RJ 2EKOA 2O1PA 2HSPA 2IJFA 5GVQA 4WU2A 1RHKB 3WX8A 1V6HA 1PILA 3ET6A 1AUDA 2R8JA 2P0PA 4DSKA 4J9EA 1D3WA 3G9CA 3K0JA 2MZQA 2ROPA 2VQEJ 1RA7A 2JW4A 4IIMA 3ONQA 4CLLA 4RTUA 3KLEB 4J9IA 2CQ2A 5GAMh 4WFYA 3NGUA 2J6OA 4USMA 2DETA 3VVTA 4C7QA 3VAHA 3B6BA 2Z2LA 4LDVA 1V3RA 2MZRA 3GONA 4QT7A 2Z2MA 1UL3A 1HW9A 1B4SA 5IV4A 4LF4F 1CSJA 1XR6A 4AYBD 3DLGA 1RHRB 1RWXB 4RW9A 3N5BB 3C3LA 1U1OA 2HGLA 1ZOTA 2DNYA 2RHIA 3Q8QB 2XI3A 1KOHA 3N9UC 5E3PA 3SV4A 1JO8A 1ZSGA 1X9MA 2F5KA 4ED1A 1NM7A 2I2LA 1M5PC 4JUVA 4RNOA 1SQEA 2M0OA 4CO2A 2KRBA 1KP6A 1E6GA 3RGIA 2BZ8A 3G4SS 1WQ7A 4DV0J 1S9EB 6FD1A 2RKIA 3RW7A 3X3UA 1JLCB 4F2RA 2F40A 3CE8A 3ZL7C 1M5Q1 4ED2A 5EGYA 2E70A 2K3BA 2LQKA 2HYIB 1TU0B 1JQGA 4JI8J 2K06A 3M2UA 5DO2A 4UUWA 1BYMA 3GJQB 2VFSA 1KHCA 3HO1A 2R5AA 4DPOA 4DV3J 2QTWA 3C14A 1AXQA 3A8EA 3GSIA 1Z9QA 5IT9E 2ACMA 4BY6C 2VJUA 2VFVA 3HHLD 3QMQA 4M7DD 4B6MA 1S9GA 3VQSA 3E2UA 3K8VA 4ZKAA 2VFTA 3AJ1A 3JYTB 2ZD1B 3BQ2A 3M4XA 5D6XA 4DV1F 2ZZMA 2GJ2A 3EGVA 3PJWA 1UGVA 5KT3A 1XR7A 1K73R 1RHQB 4Q5WA 1LQ9A 2G6FX 2VPYB 3ETMA 3OMGA 4IH7A 2G0JA 4OHXA 3NHNA 2V26A 3FEZA 3LP0A 1XNQJ 2VH7A 2G3RA 3OR1A 1RT3A 3HD1A 4A8KA 2K3IA 4A8SA 3IR6B 4Q44A 2EFPA 3OYFA 5HP1A 5L46A 4OZNA 2E5GA 2NUUG 5EWEA 2VC8A 2X35A 4C92D 2KL8A 2ZBCA 4RU9A 3K8WA 1DTQB 4GBQA 2NUHA 2HFSA 2KROA 2MOXA 5ETOA 1DQ9A 2OFGX 2NZ4A 4DV2F 2F1FA 1UAWA 4IFVA 2A2CA 1ZUUA 1Y10A 2YPZA 4ECZA 1IKVB 3DLBA 4F36A 4G3IA 4ES2A 1GNKA 3NTIA 5IFMA 2KH9A 4I69A 4OMLA 4ZIWA 2QEXT 2IRUA 1YJNS 4GC6A 3CJQA 3HHLB 2F8HA 3PYFA 2RQKA 3H5UA 2DITA 4AFQC 3CW2C 4FF2A 4DEYA 1YJ9A 2QQRA 1XR5A 4GRSA 4TXSA 3OTCA 5EX0A 4DR5J 3W64A 4R55A 1OWXA 5K14A 1YNZA 2K5LA 1U7LA 2AYGA 3HFOA 3QIDA 3KLGA 4Y00A 4H4KC 2B4UA 4O44B 4HVWA 4Q2MA 4EYIB 4RBTA 2AQ4A 3EFSA 1D1UA 3S6EA 2V63A 1QAIA 4OZ2A 1Y3KA 2DL8A 3THKA 3QPHA 1RWNB 4OI0A 2C2NA 2WHOA 4OI2A 2PZ1A 4U7UD 1DTTB 5AJ3J 2Y1JA 5C25A 5GAEU 3OFGA 1K1ZA 1YDLA 2LP4A 1LFPA 3M6XA 2HMAA 2KY9A 4FDFA 1RGVA 4HEA9 5J2MA 3OR2B 2K9GA 1SIZA 4A53A 1H7XA 4Z7CA 4CH7A 2HRYA 1VOMA 2E1CA 4B9NA 3I0SA 3QT7A 3OBIA 1K76A 3JXOA 2ABLA 3W2VA 3CCEA 4FF4A 4OMFG 4WCIA 3L2RA 1E7OA 4DFKA 1OQ3A 4KKOA 2XSFA 3MKDA 2QJ3A 4P2MA 3MO8A 4USVA 3MECA 2XWYA 2DXEA 3VGSA 3EZUA 2KI7A 1VUBA 2FHDA 4DQIA 1P9QC 4CH1A 2JS2A 2WONB 2IVFB 1UVJA 1NE8A 4ANCA 4YR2A 2JTMA 1FFGB 3EG1A 1U09A 4DR1J 1UJ4A 2HBRB 2KG1A 1S72T 4PJOB 3I55T 5FIIA 2PVGB 3UF4A 3I87A 4I2PA 1Q4RA 1AZSB 1WUUA 3LAKA 1RBOB 2W9BB 3QT6A 1TKZB 4TN2A 2OD6A 1S6QA 1LOJA 2E1RA 1ZETA 3SI8A 3DYAA 4CYUB 4PRFA 2VICA 2OX7A 5GAOr 3W2WB 1LK5A 3CCVT 4OHVA 3CCQT 2HFOA 4X1VA 3THTA 4AL6A 3D68A 3K5PA 4YR3A 4OX7A 2HS4A 4K5SA 5C0MA 4JP8A 2LQ8A 1S12A 4I1TA 1U3OA 2EKYA 2D69A 1CLFA 4TQSA 4OZLA 3J81E 2F4FA 3IGNA 1QUPA 2MZJA 3BBFA 4WZQA 5FU7C 2CREA 4OB2B 2HRUA 4QPXA 2FZKB 2WW4A 2AJ0A 3R7SB 1Y00A 3JAMU 3M0QA 2CVIA 1VQMS 1PO6A 2WRMA 2J6SA 3O6QA 4BI8B 2DRKA 2IMWP 2BV3A 2ED0A 3EH2A 1V76A 1B7YB 1Q8KA 1FESA 4Z7YA 5B0DA 3CD6A 1NJIT 3LANA 4P2FA 3T1HF 1DQ8A 1FJGJ 2BW7A 3M9OB 3ILIA 5A6PA 1TV6A 5H9FK 2D9OA 1JLCA 1M4ZA 4Y92A 5F8HA 4JI2J 2CH4W 1JLFA 2IHR1 1VQSA 2V4RA 3A8GB 1IWAA 4M7AC 2O88A 3UCGA 4Y34A 2GGPB 2F8MA 2F1LA 4TLRA 3M0UA 2WOMA 3KLHB 4NXNJ 2B7BB 1XQIA 4WKRA 5KG3A 1DJ7B 1RJJA 3LGFA 3JCMV 3SB2A 3V7CA 1BC6A 4LF5J 2P0KA 1NU4A 4P2SA 2F2VA 2G9OA 2CPEA 4FSSA 1MMDA 3MM5A 2MZ1A 1FO1A 4ZP6A 3ZZOA 4LFAF 4OYIA 3X28B 2G2OA 2DVJA 1N36F 4IRDA 2GJIA 3OSSC 1ZPWX 2VJVA 3IR7B 2ZGWA 3G8TA 4MKBA 1PKSA 4BCAA 5DDRC 2YPYA 1YJNT 4C8LA 2DGTA 3C6TB 3K57A 4UOFA 2D41A 4KUIA 1DJ0A 2MGZB 1Y5NB 4P74A 3ITHA 2LNHB 3TUZC 3TUIC 5K14B 3EVOA 4NLWA 3CCWA 3FBCA 4K4TA 2NSBA 2H9ZA 3OYCA 3M8SA 1UW4A 2GA7A 5F8GA 1UUEA 3OFHA 2XSJB 2VPXB 1VQ9S 1NH8A 2V4JA 4AD6A 3Q8PB 2E4HA 1WHJA 2GTJA 1FVQA 1VMBA 1OX8A 2YH0A 1S72S 1NK8A 3NNCA 2XGPA 2GVDB 2WSFE 2UVRA 2QLXA 1UB4A 3FCWA 1Q82U 4FSXA 4RLEA 3GE9A 5LMNJ 5DDPC 2DTJA 5J2MB 4ILLA 3ZZYA 1WQWA 4NMXA 3QDRB 2G4BA 2FPDA 1VQ4A 1YI2Q 2XC9A 4ILMA 1RU2A 3D6MB 1JLGB 5F9NA 3KHHA 3HRSA 3VS0A 2CJ9A 3BKFA 4M78F 1SKWA 3J7AN 4DV4F 3I32A 5CQYA 1RT2B 4AFUC 3A12A 3UT1A 1Z9ZA 1KSWA 1DLOB 5LMUF 1SBRA 1UW9A 3KLVA 4X9DA 2L3SA 5F8LA 4H54A 1UVKA 3GCXP 3Q1JA 4RG8A 1BQMA 3HZGA 1I94J 2QLJB 3BGOP 1P1LA 4GY5A 1VQOQ 3CBPA 3CB4A 4RTTA 3FCVA 4OYPA 4EGLA 1NHKL 4YN3B 4RW6B 2CPJA 3HULA 3MEDA 1FTRA 3L2WA 3M57A 4HLBA 5J1EB 4ZMMA 1ZBJA 2HQGA 2QG9B 2VBZA 2AHJB 4FYVB 2DM1A 4USWA 3RESA 2H4YB 4KPYA 5GMKj 4M77B 1IB8A 3HHEA 3EXCX 2RKIB 3IA0A 2LCCA 3CMEQ 2KM8B 3LWLA 1V9OA 5AE2A 1VQ6A 4NLYA 3TEEA 2J8SA 5C6SA 1UPMB 1H38A 2CT4A 1FWKA 3AOCA 4I56A 3A13A 2O01C 1TK5A 1B3QA 1BWVA 3R5BA 5HLFB 1N5YA 5H9FJ 4C2MA 1GRIA 2RUSA 2XKOC 4ID5B 4ZGEB 2WB1D 4NL5A 2YNGA 2HQEA 4PK4A 3ZZPA 2E41A 4HT9A 1WC6A 2ZZTA 2CSIA 3DB4A 2PA3A 5GAOq 4PJMA 2JC0A 3LPYA 3QJYA 4LF1A 2V8HA 3H8YA 2FHJA 1QKXA 3N01A 3UDLA 5GAN6 3FZBA 2R2TA 4U7UK 3REBB 3BQ1A 2Q6BA 5C42B 3OYJA 2LCWA 1MW7A 2IVWA 2YNIA 3G86A 3MCSA 4G1PA 5KFKA 2LJ3A 1EFNA 5LJ3Y 3ZFJA 3M0PA 2D7SA 2E10A 3BZQA 4LRBA 4DG1A 2EWNA 6AT1B 1QAXA 5B0AA 3A8HB 3DOKB 2V8GA 2FHMA 3CXCS 3MM9A 3GPLA 4PJOG 2JTFA 3JQMA 2B5JA 3SXLA 2CUBA 3MM5B 4DFPA 3D0HE 1OPKA 2MQLA 3MM9B 1CQNA 2QA4S 2QGFB 4PJOF 4WXOA 2GS8A 3AD8C 2FC9A 2AGQA 2G2YA 1Q81U 3NCRA 1QSLA 2R5MA 2JNJA 4ATNA 3M8WA 1RLCL 2ZBPA 5KCOA 3QPIA 1JB0E 5CABA 3FCHA 4DBHA 2RJZA 2L3MA 4OQJA 2KU7A 4ELVA 3PW0A 4OYWA 4M5HA 1NJWA 2J8AA 4WBFA 3NNAA 5DDQC 4ES1A 4OHYA 1A6LA 2O01E 2HZYA 2VFRA 2QA4G 2MB0B 1YBUA 4I0WA 5KFDA 4QVDA 4OYBA 3M8RA 3JTPA 3QSIA 1C0UA 4JI8F 4A4GA 1IXDA 1YJTA 2P84A 4I6WA 3RAMA 2XZWA 3TW0A 4DSJA 2L3RA 1RT4B 2VDHA 3HSZA 1R0AB 2YXYA 4GO7X 1R8OB 2VVKA 1HSQA 4CLWA 2VWFA 3EG3A 3HHLA 1TL7B 4P72A 3G7ZA 4QW2A 2YNHA 3OVBA 1I07A 1R0AA 2OTJT 3KXDA 2IYIA 2M70A 3GYNA 3ZZTA 3HX9A 4PQUA 3IXQA 3EYZA 2C1EB 2F63A 1KQKA 2R7OA 1VQ9T 5JVHQ 4ZVOB 1VQPQ 2K79A 1JXMA 3C6TA 1X4CA 5IH2A 4IRKA 3A98A 3I9QA 4FW2A 2EQJA 3VGUA 2B56A 3CCLS 1UP1A 1WOSA 3NPFA 2K1RB 2KJVA 4WP3A 3OYEA 3HK2A 3MTJA 2CDQA 5CO7A 1F5BA 4II1A 2CNOB 2ATLA 4LFBF 2M52A 2HKQB 1VIEA 3QWXX 1HNWF 1RT7A 2D0NA 1K73C 3NY0A 3NOCA 1PKUA 5FDLA 1VYUA 1N56A 2JFKA 1UMJA 2F9DA 1EARA 5T41A 3MURP 4C92A 2BW2A 3SSSA 1XMQF 4E7IA 1T9WA 2E5HA 3GV5B 2UUWA 4EMHA 3SFMA 4PJLA 1Z2LA 4PJJA 1FYNA 1T03A 4NLQA 2RAQA 3ULHA 3IG1B 5KFOA 1RK8A 4B9WA 1MG7A 2XD0A 1EIFA 5CAAA 3PFSA 2CPXA 3DU6A 4X9CA 3FK4A 1AUSL 4Z37A 2H8HA 3M4GA 5FROA 2D9TA 5IS2A 1TTHB 1QMCA 2GIFA 3UW1A 4DL2A 2V4QA 4NYPA 1YI2A 1IR2A 5KFVA 5GMKh 2GVDA 4N5SA 3KJFB 4DPTA 4MK7A 4CO3A 1IR1A 1UEVA 5IHKA 3CD6Q 4QWDA 2QDLA 2UXCJ 3G71T 4XPCA 3E3XA 2HHPA 2AYEA 3OMCA 2CVEA 3A3PB 3Q23A 1U06A 2E9TA 2C2EA 4D3HA 5HLFA 2GO8A 2EPDA 2QYZA 4XDCA 4ES3A 2AX1A 2OJ2A 1S1WB 2QAZA 4JZ4A 1Y5IB 3PW7A 4UOCA 2L08A 1NMEB 4DS4A 3KNGA 3D0GE 4RX6A 1RTDB 3ZO7A 3JSYA 3NOGA 3HRUA 2MYSA 1ZHIA 3WVDB 4ZNXA 4DL7A 1NKBA 1H2UX 3EGDB 3AA9A 1RT6B 2A36A 2XLJA 3H0IA 3ZTSA 1C4AA 2DPJA 4C97A 2FJVA 2Z2ZA 2F2WA 3EG9B 2JVOA 2LQWA 2DGSA 3EE3A 3TQEA 3UDCA 3MEDB 2I8EA 2FEIA 2GHWA 4IR1A 3CXCR 2XB2D 1D1CA 3M9QA 1OJ4A 3GTYX 2DNOA 1G8XA 3OFFA 1IKYB 3DMJB 3THVA 1SL1A 1WYXA 3Q86A 1BE4A 5A2QE 3CCVA 1CULB 2QFJA 3ZTPA 4WFBQ 3DLGB 1KLMA 3JCMc 2O5DA 1QSYA 3DI6A 2EYWA 3RRKA 3MOJB 3ISZA 1SB6A 3RZAA 3VAIA 2ZJPQ 5J1EA 3SEMA 4WIQA 4AUKA 3H0FA 4JV0A 4OMQA 2V94A 2YWEA 1Y11A 1SRMA 3CCRT 3VGVA 4ID8A 4JI7J 4ED4A 1HBNB 5IT9U 2LFVA 5IC4B 2CQ4A 5HBMB 1MV0B 3CC4T 3DMJA 3CGIA 3PYEA 1Q81T 4IQXA 4OLPA 3V7SA 1N32F 1XMOJ 2ZNYA 1EX4A 1OYXA 4C8QF 3THPA 4C0DB 1TR0A 2FVPA 2H5IB 2K57A 3BE3A 2QL9B 3M8YA 1FJGF 2ED1A 2HG4A 4I2QA 4EIKA 3A8LB 1XNRF 4M7AA 4WP9A 3TZYA 5KG5A 3CCUS 1TKDA 4ZJLA 3PDNA 3PM9A 3DDNA 4RNFA 3QYYA 2R8KA 1GCPA 1X75C 3CCMA 2COWA 2MKIA 1Q86C 2E66A 5CCAA 1GCQC 5A0GA 4K4VA 1IJEB 4LUDA 5IT0A 1F2HA 5EWFA 3OYHA 3CMEA 1IKWA 2VGNA 1VQ5A 5LOQA 1QKWA 2Y1IA 2DNGA 1MNEA 2R7WA 2OD4A 2VA2A 4X4VA 1RWOB 2M8DB 2B9YA 4U96A 4DPXA 1FJEB 3ITHB 1LXJA 3D54A 2EJ9A 3LTOA 1PC5A 4GKKF 2CPIA 2C0OA 4QOTA 1AFIA 1VQ5Q 3EGXB 3LLRA 2DCUB 1GAOA 2CPFA 2HL5C 2CKKA 2RQVA 2NUTB 1UWBB 3QGIA 1SSHA 2RMLA 2FQQB 1WZOA 4ORZA 4NMLA 4U9RA 4FBUA 2QQAA 3K89A 4ZLPA 1UA0A 4LRDA 3UQSA 3H42A 3TA2A 2EYXA 2L9WA 1YKWA 2P9GA 1Y7PA 3CO0P 2RRNA 3TVKA 5J3BA 1J5OB 2QSFA 2J7KA 3TJ9A 4RTYA 2IPOB 2V8DA 2CP0A 2RT3A 4CC2A 2NXEA 1A7GE 2UU9J 2H5JB 1J5OA 3D66A 3L2UA 2RHXA 3S7RA 2R8IA 3TUJC 3NMRA 5HROA 1RAEB 2OAWA 1O75A 4N0AC 3JTOA 4CO5A 3JSMA 4P2XA 3HMJG 4Y28C 1YHQT 3NNHA 5KFGA 3ZC4A 5EX3A 1H3ZA 4FS1A 1QLYA 5KFHA 4AMCA 3CMAT 1ZM2A 3G6EQ 1YZ6A 5KG0A 1U2FA 2P2CB 1YBYA 1RTDA 5C25B 1F9HA 4DV5J 2ADBA 3GIKA 4B3OB 1S9FA 1S6OA 5E41A 4QIFA 1FKPB 5KFZA 2HPUA 2HDAA 1M5KC 5A6WA 2YNGB 5F9LA 2HK2A 5KFQA 5FWBA 3W2VB 4KE5A 4X4SA 4LBPA 1QLNA 2WSCE 1BI2A 2E5KA 5C2CA 4HCBA 2ZH4A 2RQWA 3TAQA 3DOLA 3CCSA 3TZXA 1SI9A 4XTVA 1SF9A 2DNZA 3DI6B 2W2PP 4JI5J 1HMVB 3LYIA 4PJOC 2NUPA 4V19J 4EDUA 3X24B 3KUFA 5L1KA 4HTJA 3GB0A 5C24A 1JJ4A 2GV1A 2DNLA 2EYZA 3QT8A 1YTYA 2AU0A 2E1PA 4CDIA 2XGQA 3IWLA 4F7UB 3V8LA 1WHMA 4NA3A 2K2VA 4DV5F 4FXVA 1KQ1A 3J80E 4W98A 2YNIB 4IOBA 1C1CA 1RAGB 3L2ZA 4BB7A 4CLZA 1WC0A 2CZ0B 4ITSA 4M4ZA 3H25A 4QJVA 3J81U 3DLLQ 3BR8A 3EMTA 5GMKi 7FD1A 4ZGDB 4TLQA 2MF2A 3VRYA 5GAGU 1TL3A 3F56A 3T1HJ 3SWNB 1M0SA 3Q0AA 3W8PA 2DNRA 3CC4S 2KT5A 2Z58B 1REVB 3TI0A 1ABOA 1N6QA 1M90C 2HHHF 3C19A 3QQCD 4JRIA 1TL3B 3ENQA 4BI3A 1NKEA 1X6OA 2GVZB 2AIRB 1SHFA 2YX4A 2ZZNA 2VG6A 2UUBJ 4RW7A 3H9NA 5U47A 4B17A 1YHQQ 2YKNB 1VCTA 1F2GA 2BIVA 1KQFB 1RISA 2RSQA 3VAFA 2IIHA 1NSKL 1Q1KA 2AW0A 3OL7A 5HQLA 1XN9A 4QPTA 3OV7A 1I81A 2QX0A 3R6OA 1QWEA 4LVOP 3UR3C 4AFSC 3I0RA 4DU7A 1D8ZA 2MKHA 1VQ6T 5GJVB 1JLFB 3RG6A 4N56A 1IM6A 1IVZA 3MMAA 4UC4A 3TAPA 3LH5A 3CCLT 5CZXA 2J05A 2B4VA 5D0HA 1CEZA 2QEXA 2EVZA 1Q81C 4NWBA 2GIQA 2DERA 4A8WA 4UY8T 3SQGA 3OL9A 1KSPA 3FFIB 4DUYJ 2IC3A 2ZHOA 1FKOA 2D0QB 1LXNA 2M5YA 1K9MT 2MGZA 2V2VA 1JKHB 4ME7A 4UTGA 1BIAA 3UE2A 2AJFE 2HEKA 4QR2A 4ECQA 1BQXA 2DEQA 5GAMf 2YDLA 3GFHA 2RIJA 1ZTTA 1VQ5T 1YQHA 4B9LA 1FXXA 3LH2S 3IWXA 5FJ4A 3HT3A 2MXYA 1VR6A 2RS8A 4DR7F 4BE1A 2XIDA 1K44A 1L3VA 2DPIA 4M78E 1LVKA 1VC6A 2LQ5A 2O4XA 4M95A 4Y2CA 1WACA 2G0CA 3TOQA 3QGGA 4P10A 1HNZJ 3KHRA 2VOOA 2LLZA 2ZAEA 2DD8S 1KD1T 1FNXH 3QFWA 2RH2A 3TQ7P 3JCMP 5L1IA 2O3DA 4ETZA 1L3UA 2RQUA 4DFJA 1RAAB 3UVJA 5GMDA 5A0LA 3GJTB 2X3DA 1PWTA 1IKXB 1S4EA 3HHLC 1SXLA 2G13A 5GMKm 1Q95G 4IFYB 3RB0A 3LUYA 2VGMA 2N4CA 3HLUA 5A8KA 4DUZF 4PWWA 4LF6F 3H4BA 3OYNA 5CYMA 3SBMA 5HK3A 2C2DA 4DN9A 1SKSA 4E7HA 5A2QU 2FVUA 4RKUE 2LZ6B 3SYZA 2SRCA 1IN0A 4EBEA 2CJXB 4E7LA 1IBLJ 2GF7A 1NEEA 3GP8A 4K4XA 4LDYA 5CYJA 2JLGA 5HMZA 5LXYA 3JCMg 3CD6T 4DCPB 1QP3A 3MR5A 3AQOA 2W9BA 4GVBA 3KLEA 4OZ3A 2L48A 4JI0F 2L3PA 4W92B 3MCOA 3OQ2A 3M2RA 3O5TB 2MQ8A 2DE0X 2FJAB 2DYIA 3CCJQ 3FZ2A 2RF2A 3D1QA 1HR0J 4PFZA 4E7ZA 2RA2A 5LJ5j 3CJ4A 3DRSA 2XCPA 3LGHA 1TSFA 3FBBA 1UEUA 2PO4A 3GJRB 1FRMA 2KN4A 1ZS6A 3OVSA 2XM3A 2DNHA 2LC4A 2JEGA 3EGNA 4UOHA 3D67A 3CEYA 2LQJA 3UPUA 4JI5F 3UO0A 4DL6A 3KLFA 3TANA 2SXLA 1KFDA 4P5NA 4YY3F 3GNGA 1I5LA 4M77D 3M2RB 2R7VA 2PGCA 5D6YA 3KDNA 5KFSA 2QASA 1M90U 1DURA 3VGTA 3CCQA 4XU3A 1WXUA 3W61A 2V68A 2HNYA 4C48A 2XI9A 2K3XA 4WF9Q 4YB1P 2X3GA 1TFWA 4H4MA 1NXIA 5DQGA 1DAXA 4B3TF 2QE5A 1T02A 3M6VA 1YITS 2L2PA 2YKNA 3R1HA 5GAN2 1PJ6A 3V6DA 4YQWA 2LA4A 1UGRB 4LRCA 3TZZA 4FYYB 3CCMQ 2RN8A 2CSQA 3VKIA 2DXDA 3GYGA 2ZVIA 3LGLA 1MUZA 5THWA 4DEXA 2PIIA 4KULA 4Y91A 3W7BA 5DS7A 3HFKA 2OPSB 4J9MA 2R7SA 3J7ZT 2BJDA 1EQ0A 1FRKA 2LP5A 4HCZA 1HLWA 3EPIA 4UT4A 2N3LA 3M8QB 2NPIA 3VALA 4M7AB 3RERA 3RR6A 2VUGA 4LDWA 1GMWA 2JXBA 2W9CA 2CZVC 4GKJJ 4ZCKA 5LXRA 2EI5A 2H3JA 4EZ6A 2HHQA 3CCMS 3RU0A 1IKVA 2J9DE 2H1YA 2J9CA 4WYLA 1RE1B 4PNOA 1B70B 2E5IA 3HFZB 4KHMA 2KR3A 1H0HB 3DRRB 5GANd 1JJ2P 1VQOT 1FDBA 2QIFA 5GAN7 3EGZA 5BXIA 4ZOSA 2LECA 1VQLA 3QZ9B 2X4JA 3TR5A 3SQGB 1X0FA 3EM1A 4IH5A 4LSLA 3A1PA 4CH0S 3MM6B 3FFIA 2OPRA 4K59A 3VAJA 2FHJD 2O2OA 1O8BA 1C4CA 4MMLA 2V2KA 2HVEA 3G6ET 2QQ9A 1FFSB 3DGPB 5KFRA 1KC8U 2JOYA 5M2PA 3V7RA 4O3SA 2KVQE 2B7CB 2XMJA 3PRDA 4TKTA 1BI1A 2OTLA 4X4RA 3KYLA 2H54B 2KT8A 2M9UA 2MI6A 3F70A 4MIAA 4ECWA 5AXMA 2XG8D 1ZM4A 4JB8B 4V2SA 2HFVA 4K4YA 1I1GA 1K73U 1UGPB 4JV5J 3BGLA 2UUBF 3H0PA 1SC4B 1RT7B 4M78D 3VS7A 2M4MA 1BXNA 2E7XA 4DZ6A 4MMOA 3Q8VA 2FUG9 3E01B 5HMYA 2HHHJ 2WVCA 4AL7A 4RTXA 3FQLA 3JSBA 3EWGA 3GIMA 4NCAA 5K20B 5E3AA 2KZMA 4C5EA 3RAXA 1NJXA 5HJXA 2KHCA 1FD2A 5KFMA 5KAKA 1PCAA 1U8SA 2N82B 1NPRA 2Q43A 1WG4A 1NYFA 3ER0A 1EKSA 2LNVA 2EVRA 3RTVA 1Q86R 4HT5A 2X1AA 4F7UF 2IDEA 4MH8A 4WIIA 5HY6A 2K1RA 1R8HA 5ETMA 1VQMA 2XMKA 3DRPB 3PVXA 3ISND 4PWDB 1RT2A 1B64A 3M0SA 4ECVA 5CKEA 4ZVUB 1UKUA 5FW9A 2RMOA 4XTUA 2Z57B 1Z1ZA 3V6JA 2EYYA 1WTFA 2IYGA 4PJOA 4F4WA 3CJ8A 2UVWA 3TEHB 1KQ2A 4W90B 4NYOA 1UG1A 1KHIA 1HHSA 1EHWA 1P9YA 1VJWA 3CEDA 4JBCA 1Y57A 2LT4A 2HURA 4JLGA 2OTLQ 4FF3A 2CJBA 4Q8EA 1D0YA 1X4BA 4ZPVR 3TNVA 3GJSB 4OYMA 2OLWA 3CCST 1WEXA 4XTZA 2MSTA 4USHA 4P75A 4CNYA 4C8QC 4FS2A 2EGCA 4F26A 4KYZA 3CCUA 2AEFA 3RBXA 1M3BA 3GCWP 2HQDA 2HNDA 1OYDA 4DX8H 1J5EJ 2F3JA 2QXFA 2RI3A 3AFGA 2KVQG 4ANJA 1SH3A 2DA9A 3B78A 3I9V9 3AB4B 4PQAA 5LL6d 5CQXA 1F1BB 1R8BA 3JCMW 3AHPA 2J6KA 4MZTA 4QWAA 2XCAA 3WVEB 3DYAB 4CYUA 3H2VE 2P9CA 1WWHA 1UETA 1PG5B 2GMJA 3OB9A 1REVA 2J6TA 3NGDA 2MDAA 1XTDA 2W01A 5HSPA 3I5CA 3F41A 2I38A 4FPIA 2KDOA 5GMKl 3OBWA 2MMYA 4DX5A 2QYCA 3DCAA 3MEEA 3V8JA 1U45A 1SJQA 3O5ZA 4OJHA 2L3QA 4DA4A 3MM7A 3G8SA 1K8AC 3CDWA 1QDUB 1S1XB 1WHXA 2M9KA 5DQHA 3CD6S 2GX8A 2XNQA 1OI1A 3BF4A 1YHQS 4QYRA 3BDEA 3HVRA 1HHQA 1KRPA 1FK9B 2W4CA 3IAS9 4QQ6A 3OHAA 3D6FB 1PAUB 3IS9B 4RW8B 1E6YA 2OKQA 3MZIA 4URSA 3UWTA 2AEMA 3U02A 1PRMC 3FRNA 2DNMA 4RCCA 2W8LA 2XYPB 2UXBJ 3D3CJ 1WTBA 2CXEA 5GAOm 2MYFA 2JEIA 1N36J 2MY7A 3KLHA 4J9PA 3HM9A 2HVIA 2KYXA 4LQ9A 4O5VA 5B0BA 4C8QG 1UECA 3J7AF 2XDPA 1NJIU 5D3GA 3CC2T 2BR0A 3NWRA 2JT4A 4HVUA 4ZITA 5I4MA 2F2XA 1TL5A 3OUYA 2CQ1A 1OY8A 2KO1A 4DLGA 1BMQB 1CJTA 1RT3B 1R43A 4M5GA 5G0RB 3QZ5B 1OY9A 2HNIA 3AY0A 1KG1A 1BUXA 5E0OA 4ZPBA 1VDHA 3SD4A 4L5GA 3ZZ0A 3CJ5A 3P8DA 4MFBB 2IA6A 1HBOA 1XTZA 2WCXA 4J6WA 5H9EJ 3KTQA 3DRYA 5I2SA 1RP5A 1MGQA 3BGRA 3ENWA 2XQCA 5KE3A 1CQMA 4KO0B 2FJWA 1RWPB 1T9TA 2UUCJ 3ULRB 5L23A 4TU7A 1RT5B 2Y4XA 1YLXA 3ZZRA 1QSSA 5CXTA 1E6HA 4ANEA 2GIRA 1JXOA 5E5NA 4DLEA 3K17A 2CG8A 3GIJA 2LEBA 1ULRA 3UATA 2FC8A 4P7VA 1K1SA 1A9NB 2CZ9A 4IFYA 3OS5A 3VS6A 1R8AA 4KFBA 2XY5A 3AD7C 3FC3A 2YNHB 4CNZA 1N33F 3G6ES 1V3SA 3VUZA 1NB7A 5J2NA 1FERA 1GFWB 1FWZA 4X65J 2QLWA 4J9FA 3ADAC 5C2GA 1PD0A 4M7AD 2KXDA 1SQFA 3SCIE 4LSNA 2ZKUA 3BQ0A 4DQSA 1WHGA 5KG7A 1QAJA 2AJQA 4M7DB 3C6UB 5KFNA 2XLIA 3D4JA 3OS1A 3A4TA 3TQ1A 1FWLA 4DDFA 3QJPA 2YLBA 2EFOA 3I31A 2J76E 1SJ3P 1WEYA 2J7WA 3INZA 1NK6A 1RADB 2NXJA 5E33A 3FLGA 4TNOA 2D1CA 1DQAA 3T3FA 1HR0F 1ZQ1A 2KE9A 3DOLB 2VQEF 3JRZA 1F0XA 3G2XA 2VPWB 2B8QA 2OPPA 2WW8A 4JI1F 5HN0A 1YWPA 4WYWA 2JRSA 5GANj 1MU2A 1MLAA 1RLDA 1R8CA 2L41A 1VC0A 3IRXB 2XY7A 5DLGA 4AFFA 1VBKA 2NLUA 4RW4B 1M1KU 4LF5F 2C3PA 2H5EA 3RNJA 1GFDA 1VQ5S 5ETSA 1U48A 1IGUA 2RK1A 3PIOQ 2XMMA 4O4GA 3MEVA 2ZKTA 5C5JA 4NLSA 4LUEA 2QTVA 1R3NA 4ED8A 3I5BA 1TMJA 4WFXA 1GXLA 3HHDA 1PHTA 1X43A 4R8UB 1OY6A 2KB2A 3QIPA 4Y2AA 1WX6A 3CJKB 4EPCA 5EG2A 1PIEA 1TKXB 1PJ5A 2EG2A 4QBUA 3KHGA 3QBYA 2DHGA 2FPFA 3EZOA 3AOAA 1S48A 2B5JB 2GNCA 3T5JA 2XEXA 1W2BA 4B3MJ 3BV8A 5A8WA 3D9BA 1UPPA 2GTOA 1URRA 3QBCA 1VQOS 5GAHU 1KDNA 4AT1B 2YWFA 3EGDA 1TP7A 2ZDPA 1GBRA 3MHXA 5AXKA 2XDDA 2CQPA 1X6GA 4JI1J 3R3TA 2DR6A 2AT1B 3SDEA 2L8DA 1RKIA 1Q7YT 2JJ4D 1B3TA 1FK9A 1VBXA 4Y3CA 1PYTA 1CJUA 1TL1B 2LJ1A 1FHTA 3JCMb 2ACYA 4YFUA 3G4ST 1UJ0A 1CULA 3PW5A 1S10A 4LVNP 2D3O1 3MMJA 2EPIA 3Q8SB 4NEZA 2IM3A 2XO6A 2J7IA 5FU6B 2YRDA 3G71S 2DHXA 3HJVA 3NP5A 4DN0A 3EJMA 1YI2S 2PVOB 4TY9A 4DV2J 1NO8A 1JIHA 2MHNA 2LYVA 1UE9A 1X2KA 3D3BJ 2EW3A 3K7RA 4ZVPB 1YJ7A 1TG0A 2AZSA 1YZ7A 5GANe 1TL7A 3OYKA 1PKTA 1NK4A 1CSKA 1KQSP 4XAXB 2KT3A 4ZK7M 2AJ4A 3MMAB 3HL8A 4M78C 2ECZA 1TAQA 1NZ8A 3A8MB 1VQ7T 4MIBA 2BA9A 4A54A 2VG7A 2PUKB 2XO7A 4KGZB 1HYOA 2NR0A 1S99A 3HSDA 4OB3B 2EK1A 3CPWP 3ET6B 1Q53A 3RR8A 1HKAA 2CFXA 4NL3A 4HHHA 3OJUA 1LW2A 4XTTA 2M7SA 3MM6A 2CQIA 1D0XA 1DHMA 2ALYB 2GQIA 3VR1A 4OI1A 1K73T 3C16B 3C8YA 4QIWD 2MPXC 2UUCF 5LL6S 4A47A 3I56Q 5GJWB 1DARA 4J6XA 3I96A 4C0HA 2VG7B 4NLRA 1NK5A 3W3SA 3TYTA 3OTOF 1V29B 2VC1A 3EPGA 1T03B 1VQNA 1A0OB 4OZ0A 1OQKA 2XYHB 2PTKA 4DL3A 2LMJA 3OXGA 3FRZA 1G2BA 1T9VA 2Z0GA 1WKLA 3K58A 3U1MA 3OYBA 2F5TX 2QDYB 1Q7YC 2FJXA 1M1KR 1SRLA 3DNCA 3CPWR 1KD1C 3M8ZA 1R6YA 4B3TJ 3ZBDA 4KBIA 1U26A 4LR9A 3MWBA 4USIA 2F9JA 1WA7A 3JCMd 3FEXB 3GV8B 3QLHA 2DNNA 1H641 2DXUA 2CQ0A 3UWNA 2FVRA 2IDLA 2QQSA 2ERRA 1YJVA 1Q8BA 4DSIA 2NWMA 3PTAA 1LPLA 1VQ8A 1RHUB 4P73A 3PO4A 1SHGA 4JOUA 2R8HA 1X69A 1I94F 2ZPHB 3AA8A 3RBEA 1KQSR 1HNVB 3TSWA 5A8RB 2MKCA 1ABQA 4N4IA 3MHYA 4M5DB 2P6SA 2IM0A 1RI7A 2LKZA 3KUHA 1DFDA 5IV3A 2N4DA 3CCLQ 1RBAA 1YIJT 2VQFJ 2GW8A 3TRGA 1GCQA 3KK2B 2FL7A 4RNNA 2CJKA 2V50A 1RT6A 3NAIA 4F4YA 5KH6A 5HAOA 1X4FA 4O6JA 4AQYF 2Y4YA 2IAJA 1IR0A 1VQPS 4F7UA 3I0SB 4QW9A 3C0CA 3WX4A 2COLA 4B08A 1TK8A 4FF1A 1D9DA 2RJFA 3UDVA 1PRLC 1K8AU 2MY8A 3GR0A 2HHVA 1F9FA 4JI0J 3VV0A 4HACB 4NZ0A 2DJQA 1T8EA 2OEMA 1MMAA 4WTOB 2DFUA 2D3OR 2NS1B 3MMBB 2DGWA 2WVBA 4XAKA 3EH1A 3DRSB 2M02A 1K9MR 2GVZA 3AXMA 1NUEA 2M8HA 4A8FA 3IRXA 4OYAA 4LDXA 1CJUB 1TL1A 2DTIA 2OPPB 2FO0A 2DR5A 4EZ9A 3RBBB 3TJAA 1WORA 3DN9A 1GL5A 1VIFA 1ZAVA 3VYGA 3CCQQ 3PNWC 2GAGC 1T0JA 4AQYJ 4PG7A 1S1XA 4P7TA 3HTRA 3EGWB 1YJNA 1W26A 4PLLA 5D4OA 3D1OA 3GF5A 2D9PA 1AW0A 3KOAA 1AVZC 2NYHA 4DV7J 3EFOB 1D1AA 2DO0A 2BRKA 2ZJQQ 2ZVSA 3EFRA 2W7AA 3FC9A 3CC2Q 1EKRA 4USKA 3OT9A 1XMBA 3JS9A 1G3WA 1KQSA 1VBYA 1S7IA 1O9SA 5KT5A 2CUDA 1HI8A 4OMNA 5DLOA 2CP2A 1W1FA 5GMKa 2DRBA 2GO9A 2CPDA 4WWSA 2J9DA 1M5HA 3QFHA 5KFXA 2ASJA 4KQZA 4LD9K 4ENOA 2DHAA 3PACA 3M30A 4CLPA 4BUGA 3Q24A 4F3QA 3C2PA 4FIBA 2DTHA 4YP3A 5F3TA 5D4NA 4EMGA 3I4HX 3P8HA 2YQ0A 2HAXA 5AE3A 3OYDA 2VFUA 2RDJA 4MFBA 1YIJQ 3RBZA 3BYPA 4JI2F 1X0PA 1RACB 1RYRA 1WJQA 1LW0B 4OI4A 3GIIA 1RZMA 1RWWB 1XMOF 1OX9A 1WF0A 4J90A 2FZCB 4R0KA 2ROTA 4ZS6A 4Z89A 3A5ZB 3CMES 5D8HB 3FBEA 3KJQB 1MN7A 4CI0C 2M0YA 2E5LJ 1U4BA 3KFVA 1NRKA 2U2FA 2HZAA 5KFAA 1PBUA 2WOMB 1U1TA 3KJNB 3HPWA 1KC8C 1HQUB 4HT7A 3LPEA 4IG0A 4OI3A 4DF8A 3R6NA 1UDLA 2UVVA 3B4DA 4E7SA 2DNPA 3V81A 2BKNA 2ZH3A 2IBOA 4NPOA 1X4EA 3CD5A 1KR4A 2HNZA 2RS2A 3TA0A 2IFXA 2DBMA 4E0DA 4OMFB 1JLQA 3CC2S 1RTIA 2WSEC 3I35A 3BY7A 3UVJB 3T5LA 4PCQA 1KQSS 2KQWA 1JU5C 3QATA 3K59A 2KVIA 4F2SA 2E65A 1G6BA 3QRQA 3JCMh 3H6ZA 3DLJA 5CYMB 4DR2F 3WC0A 3MUMP 4IKFA 3JSMB 4ZHRB 2FLLA 4QCLA 4M94A 3RUBL 2BJ3A 1NM2A 2E9RX 4I6AA 4BLGA 4URGA 4KAIA 4BE2A 2LX9A 1Q5YA 1WJRA 5CHCB 1IREB 4KJIA 1HQEA 3CC2A 3R5AA 2LT1A 3M0RA 1FDAA