2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
1Q81C 1RL2A 3CMAA 1VQ5A 2MWPA 3CCST 3CCLA 3ER0A 4ZN1A 1VQ5T 3CMAT 1NPRA 3EWGA 3G6EA 1YJNT 2OTJT 3G6ET 1YJNA 2OTJA 1N8RU 1VQKA 2OUGA 1QVGS 4YTLA 1VQKT 3PIOA 3OYYA 1KC8U 3CCEA 2OTLT 3CCET 3CCUT 1EIFA 2QEXT 3CCUA 2JUFA 3CXCA 1KQSA 3JAME 5DLQE 3OW2S 1K8AU 3DLLA 1VQLT 5IT9E 1M90U 1QVFA 3DB4A 1M1KU 1VQOA 1VQMT 1JJ2A 3KBGA 2XHCA 1KHIA 1X6OA 2E6ZA 3CCLT 1VQ8A 1VQ8T 1KC8C 1VQ4A 4ZN3A 1NJIU 3A5ZB 1VQ4T 5A2QE 4CRIA 3J81E 3PIPA 2QA4T 2QA4A 2MWOA 2OTLA 1S72T 3I56T 2QEXA 1BKBA 3I56A 1UEBA 3J80E 3H7HB 2EIFA 1Q7YC 1NJIC 3J7AF 3LGLA 1VQLA 3LGFA 2LCLA 1K73U 2CKKA 1IZ6A 3LPEA 1YIJA 1SSFA 1K9MC 3I55T 2JNGA 1JJ2S 1YIJT 3HKSA 1K73C 1VQMA 3CC4A 1QVFS 3CC4T 1KD1C 4TVRA 1Q82C 4QQDA 3G4SA 3DB3A 3OW2A 5LL6S 1KQSS 1VQNA 3CXCS 1VQNT 1NZ8A 3CCRA 3CC7A 3CCRT 2JVVA 1YBYA 1N8RC 3CC7T 3CCQA 1QVGA 1S72A 3CCQT 2LVMA 3QQCD 3G71A 1YHQA 1XNIA 3G71T 2KVQG 1YHQT 1KD1U 1VQ6T 3CCMT 5IAYA 2DO3A 2G3RA 3LH0A 3CCMA 3I55A 2L3RA 3CCVA 3CMET 3CCVT 1Q82U 2KDSA 3CPWA 4RG2A 5HY6A 2IG0A 5J3BA 5DM7R 1YI2A 1YI2T 3CCJT 1YJ9T 3G4ST 1M90C 4X34A 1M1GA 3CCSA 1Q86U 1NPPA 5J26A 1XTDA 1VQ7A 2K06A 1YITA 1Q7YU 1VQ7T 3CD6T 1VQPA 1YITT 3CD6A 1W2BA 1VQPT 2LQ8A 1VQ9A 1W2BS 1VQ9T 3TREA 1YJWT 1YJWA 3P8BB 1VQ6A 3CC2T 1Q86C 3CC2A 2E70A 5FLXE 3CMEA 1Q81U 1K9MU 1M1HA 1NZ9A 3CPWS 2JOYA 2MI6A 1VQOT 3CCJA 1YJ9A 1K8AC 2EXUA 3CPFA 1M1KC
chains in the Genus database with same CATH superfamily
3CJ3A 1YDLA 3D1HA 2HVHA 2XWYA 1WNLA 3TP2A 2VC0A 4F7UG 1RT2A 2CXEA 3VGTA 1MSWD 2B4VA 5AYFA 1I5LA 2QAZA 4I4BA 4KC5A 1KP6A 4PR6A 1VYUA 4DV1J 2K79A 3AXKA 3VS6A 1TV6B 4NZ6A 4F14A 3SWNB 2X3GA 2MHEA 2Y8YA 3ILIA 4F3MA 4ECUA 2DNYA 3M9NB 2NXJA 5LMNJ 3SDEA 1X2QA 2LCWA 2ZHBA 3OTOF 2LCSA 4KE5A 2QTVA 1BLUA 2QV6A 5LJ5Y 2XMWA 2KM8B 3TCJA 4J7FA 4TLRA 2KR3A 2ZDOA 2BW7A 5FWBA 4C8KA 2J6SA 1XERA 3K5PA 1I81A 1OYEA 2XHWA 5KG0A 4K0KJ 2YXYA 5LJ3e 5B0EA 1KLMB 4XTVA 4KB7A 3EG3A 2C2KB 2HVDA 3CCZA 3AD8C 3MMAA 2YVSA 2PVGB 2B0GA 2EEYA 2HZCA 2LEBA 2GMLA 5RUBA 1XQHA 2GNKA 1N5VA 1NK7A 2RI5A 2DJWA 3KLEB 4M77A 1R8BA 3BO3A 4J7IA 2MZRA 1NK6A 1MN9A 3DLJA 2ZH7A 2D8HA 1DLOB 2OTLT 2Q43A 3VGSA 2FVCA 1E6VA 3KK3A 1UTIA 1IWAA 3CC4S 2ZH4A 1FK9B 1FXLA 2NXUA 3MCOA 2KL8A 1VQLQ 1VQ7Q 2W7PA 3EPIA 1TAQA 1ZH5A 4WK1A 3DOLA 3E9FA 1QDUB 3M8ZA 3E9GA 3KJQB 4AE5A 2EC2A 4B3MJ 4DFMA 1RA6A 1Q82C 1NMEB 2KVQE 3CCQQ 4QIGA 5A0GA 5LL6S 4LD6A 3SIPB 2K8GA 2BKOA 4WZQA 1YBYA 2M1HA 4C3KA 4QQBA 2PE8A 3BQ1A 2V69A 4QVDA 4XTXA 4H4OA 4C9DA 1X6BA 2LX9A 2N3OA 1KD1T 3DLHA 3NS7B 3OVAA 1FJGF 3O6QA 2JFDA 1IO6A 2DCUB 2M5YA 3QIPB 4RG2A 4B9LA 1YI2T 4USIA 4K2JA 4KYZA 3LH5A 1NPPA 4RTUA 2WB1D 2PFFB 3OYAA 4N56A 1E6GA 1NJYA 5GJWB 4Z7YA 1LK7A 1EAYC 2DD5A 2QA1A 3S8SA 4RW9A 2L5QA 1VBYA 2J5AA 4QWAA 3CCWA 1VQOT 3PZPA 4DSEA 1NCLA 5CYJA 2GGPB 3DGPA 3I5SA 2XSJB 3E1SA 1G3SA 4WP9A 4RKUE 4IKAA 2XC9A 2DR5A 3DLLQ 4ECTA 1VFJA 1BB9A 3GIKA 1R7IA 1S77D 2NREA 2KRRA 5KFJA 2QA4Q 4N8OA 2JZ2A 2ZM6J 4Y00A 3GR1A 3TUZC 1WTBA 3TZWA 4DXLA 2GJFA 2CZ4A 4TY9A 2RNEA 3KDOA 1VRTB 4JV2A 4N0AC 1VRUA 3V6DA 4FF1A 1WC4A 2XZWA 1QE1A 5IM0A 5EGYA 1RT1A 1WHKA 1AD5A 3MM9A 1M5VC 2FVSA 4HKEA 5CA5A 3VV2B 2O2OA 1RT4A 1WHHA 3UN3A 2KI7A 4K5SA 1VBZA 3MEAA 2LYVA 4E2FB 5LMUF 3JB9J 1U1MA 4OP0A 1G1XA 2VPWB 1Q86U 3I5BA 5DDRC 1VQPA 2V67A 4G1QA 4UUXA 5DY9A 5K8MA 2JLGA 1SC4B 2BJ3A 1OJ4A 2P9GA 4HCKA 3ILJA 4X4TA 5E5NA 3DLGA 3VALA 4WFAQ 3CCLA 1RWXB 1PCAA 1GBRA 5THWA 1UJ0A 2CUDA 3JAMY 2YDLA 1NDCA 1HQEA 2DGUA 2CQ3A 3CCUA 2KKHA 3ZTOA 1QUVA 2LTOA 4M7AD 3F70A 5GANe 4ZVQB 1GT8A 2EVRA 5C42B 4K4UA 2BIVA 1UFWA 4L3NA 2H4WB 2QA4S 5IHNA 1DTQA 3T6JA 3LO3A 2F5TX 3RB3A 4NLVA 2ZHAA 2QO3A 4A4FA 4NL5A 4HH1A 3I55T 3C4SA 1GFWB 1WGSA 4M5NA 1FMWA 2GW8A 2RQMA 3OD2A 4DMZA 1HIYA 1SC3B 1N32J 2CPYA 2XYHB 4K8RA 1FDBA 1RWOB 1NRKA 3V4IA 2C1EB 3FSYA 3I9QA 1XNQF 4HDHA 2DHHA 3TZYA 4RW6B 2Z58B 4P6QA 1IB8A 3OY9A 3RAMA 4HYKA 1A7GE 5KT7A 3GE9A 2PQWA 1RAOA 2KY9A 3AFGA 4U7UD 2QJ3A 1JEGA 4FYVB 5ETKA 1FKOB 3MM6A 2XY6A 2ZKUA 1HNWJ 4AYBD 1OX8A 4EZ6A 4B3TF 3CCSS 2H51B 3R7NB 4ZJOA 1KQFB 2HQDA 4RWWA 2LDMA 4HVWA 3E3XA 3V81A 2HS3A 2DD8S 2K3IA 4Z37A 3H20A 3QLHB 1SQFA 4PQAA 4DUTA 3MR5A 1ZLMA 1Q8KA 4C2MA 1Y10A 2PO4A 2R7UA 2ZZTA 4JI1J 2DBKA 2BJ8A 2JZ5A 1DTTB 4I6AA 5A8WB 4KKOB 4FYWB 2I9SA 5IV4A 1SJ3P 2LRQA 4I6YA 4AQYF 2MKJA 4N7TA 3KLIB 3Q8RB 1SQEA 2C0OA 4DBHA 2PSZA 5AXKA 2XIDA 3LANA 2EJGA 3AB4B 4AXJA 2OTLA 2HHXA 2D8JA 1HWIA 1S1VA 3JSYA 3CJSA 4FS1A 1WC3A 3JQKA 1JXOA 4RTXA 4IRKA 1NH8A 2WVEA 2VPYB 3CCRT 3W65A 1HD3A 3FBBA 1NKCA 1JO8A 2NSBA 2CKWA 3D1OA 3K8WA 4ZGJB 1OU8A 3QJPA 1NJXA 2KVQG 2E5KA 2VG6A 4NL3A 1KQKA 4DSFA 1J5OB 4EZ9A 1B0VA 2UVUA 1G6BA 4CYUA 1RYSA 5A8RB 2RHSB 2J9CA 1XMQJ 4PKCC 5DLOA 4OHXA 3QZ7A 1YN8A 2L3SA 2YSQA 3QGGA 2RAQA 3SSSA 2IJNA 2MQ8A 4G6VB 3I55Q 1VIXA 4X64J 2MHNA 2M51A 2J7WA 2P2CB 3CPWS 3N5FA 1IKYA 1FVQA 2W8KA 2KEAA 2HAXA 3PVXA 1Q81R 5IOLA 2YWWA 2F40A 4PYAA 2VU5A 1MMNA 3CCQS 2QEXT 2DXEA 4CI0C 1S6QB 4PKDB 4ZPAA 1UKUA 2JLFA 3QGHA 2BOAA 2B9YA 1ZZNA 5E33A 4IFYA 3D0IE 2W2OP 1G2EA 3TNVA 4H4MB 1Y5LB 2HKQB 3VYGA 1B7TA 4R5PB 1QVFS 4DL2A 1KRPA 4QQDA 2AZ3A 2ZGWA 1TXQA 1M5PC 1OYDA 3CCQT 4I6WA 1MMAA 2CT3A 3ENVA 3MOZA 1QTMA 3G6ES 2X3DA 3OJUA 1HI8A 3GJTB 2DXFA 3M1VA 2L3RA 1NHKL 3MZIA 4CLUA 2CH4W 4E6RA 1XNRJ 4CH7A 2FHDA 4KGXB 1YITA 4ZTFA 1C0TB 4BDYA 1CJVA 3MP6A 2CUYA 4FBUA 2CPJA 2FB7A 4JI6J 3RRHA 2DGVA 1IKWA 2XMMA 1YRXA 2ZJRQ 2GJIA 3UW1A 3CC2A 3M9OB 1WEYA 2QSFA 4NCBA 2CNNB 4PQUA 5LJ3h 3EWGA 1XNRF 3SQOP 4W92B 4QIWD 4RNOA 4K2XA 3Q23A 4WIIA 4B08A 3R9LA 2B9EA 3AQOA 2OIHA 5ETSA 1RWMB 5IC6B 3M05A 2QI2A 2V8KA 1RBAA 2ATCB 3T1HF 4GY5A 2Q1LA 1QCNA 3QRRA 1FMVA 2DKOB 2QLJB 3REBB 4ANEA 2VFTA 3VS1A 4QIVA 1T03A 1SB6A 3RR6A 1GEHA 2RHXA 1OULA 5KE3A 2XLKA 4UC4A 2PMZD 1FJ7A 2LQBA 2GHVC 3HVTB 5LJ3j 1T9YA 1KONA 2N3LA 2BQUA 3RYLA 1PSFA 1SC6A 1FJCA 1U25A 3M6WA 4Y28C 4A8FA 2JTEA 2VIHA 2WZ1A 1H6KX 1WTFA 3PW4A 2JX2A 4ED7A 2DL4A 4ILLA 3VAIA 4I0WA 3TX8A 4P2MA 2QMXA 4ILRA 5KG2A 3ZZRA 4DL3A 1S72A 1GXLA 1V6HA 3C14B 3MMCB 2EG2A 3FC3A 1PJ6A 3OBIA 4X4UA 3OPKA 4FSSA 4NLYA 1RQ0A 3JCMf 5GAMe 2W25A 5D7UA 2Y8WA 5GAEU 4O44B 5D3GB 3CJQA 1M1KT 3GFXA 3J7ZT 2E5LF 4FW2A 4NLGA 2QLWA 1HLWA 1R6YA 3TRGA 2MTLA 1KVKA 4MKVA 3PKYA 3N9UC 2ROLA 3GG1A 1R0AB 3MEGA 1LV5A 2FPDA 3OL7A 2LJ1A 2IRXA 4QT7A 4J9SA 1VI7A 4LREA 5G0RB 2W4PA 4M5GA 4RX6A 2CZ9A 4I1TA 1IR1A 1P27B 2X51A 3G4SS 3N6MA 2M02A 3I0RA 1TL1B 2P0KA 3RBDA 4KHMA 4OI6A 4OMFB 5E2QA 1KHIA 3FCWA 3FCHA 4NLPA 1S6PA 1KC8T 1IKVB 2NYSA 2JJ4D 4M5DB 4JI6F 1N36J 4I2PA 1WI6A 5GAN7 2ZH9A 1RLCL 1GQEA 1VQLA 2AZSA 5D4NA 4HT7A 4ECWA 3HVAA 2R8GA 3M8WA 3LA0A 3MM5B 4E7LA 1K9MT 3G4SA 1ZM3A 2GC8A 1VIEA 2HL5C 4DPUA 1JQQA 4BC9A 4JRIA 2GFUA 3W63A 2X3XD 3QYHB 3O5ZA 1ULRA 2F69A 5CXTA 1F5BA 3ZZPA 3OYDA 3V6HA 1WEXA 3FEYB 3UN2A 3B54A 5D15A 1PHTA 5FLXE 4LIRA 1Q0NA 4P75A 1M27C 4PEOA 3HT0A 3CW2C 2MQOA 1S97A 1RB0A 3LAKA 2RMLA 3TAMA 2EJ9A 3KJNB 2H54B 2G0JA 2W4CA 1IBKJ 1SPBP 2HRTA 4LF5F 3F41A 4DCJB 1U06A 3WQPA 4QW8A 4B17A 2RH3A 3HVTA 4J9LA 2FIUA 4NX9A 2W9CA 3QIPA 5F41A 5F3TA 2E7VA 5GAOr 1FRIA 4ES2A 1MWZA 4ED1A 1RLQC 1HWJA 5CKDA 1N4LA 5F8IA 3QGPA 1GXIE 1G83A 1U1NA 2ZPIB 1KD1C 2B4OA 3BPSP 1YCSB 4FDFA 1BWVA 4LXCA 3EH1A 4YFUA 1GFDA 1VDHA 1AFIA 5D3GA 3I4HX 2OLWA 5EC7A 1EARA 1K1ZA 3TEHB 2RJCA 1N6AA 4M7AG 4M75D 4PK4A 5BR8J 1LXJA 2CZ6B 3Q8QB 5H1SV 1WXTA 3POTA 1N36F 3CD6T 3BBBA 1T9UA 2V2ZA 1FRJA 5LJ5e 1VQPT 2DTJA 2PA8D 4OMMA 3OL9A 3H42A 1W2BR 1F6TA 2LDYA 3M8YA 2GQQA 3UO0A 2XCAA 3JRZA 2RF2B 2FLLA 1AWWA 1MMDA 1SKSA 1REVA 1KSPA 2GQ2A 2X1GA 2ILYA 2IDLA 4L76A 1WKLA 3L2ZA 3PR5B 3DLMA 4OMOA 2JW4A 1WXUA 1S1NA 4BI8B 3DRSA 1QUPA 2FRYA 2C42A 2KBTA 2JUFA 4ZCMA 3PW2A 1KHWA 1L3UA 3G86A 4WFYA 2ZVSA 5HAOA 5K8OA 3Q8PB 2C06A 2P0QA 4PRFA 2OPQA 4LF1A 3C0CA 2FL7A 2XDBA 2DTOA 4FP9A 5IH2A 3M8QA 3UD5A 1KQSP 1IREB 2QA2A 3VS5A 3Q86A 4DSLA 1VQ4S 1Q7YR 3TZXA 3VVUA 1SJ4P 5HL7Q 3A13A 3U1MA 1N9RA 1QVFR 3K7RA 2OI3A 5CH7B 2Y4YA 3CC4T 4OHWA 1JJHA 1ZX6A 1RAEB 4OYIA 1Q86T 1P1LA 1WOSA 3CC7T 2LA4A 3UQSA 1QVGA 2XMJA 4ZVOB 5A8KB 1RWUA 4DL5A 1W70A 3QSUA 2R7RA 3BSNA 4DPWA 2K2PA 3HHLB 5G0RA 4J9NA 2ZCFB 5LSOA 2LC4A 3CPWA 2XG8A 3NWGA 1QJHA 3T9ZA 4ANCA 1GX6A 1JLQB 1S7HA 2EKHA 2K06A 2YKMB 1KIKA 2VHGA 1SQGA 2UU9F 1PKUA 5L46A 3NBPA 2RRBA 1XTZA 2Z30B 2JOYA 2F9JA 2J0QD 4PG6A 3CPFA 5FU6C 2VGMA 4ICLA 1MMLA 3CCST 4PZVA 2OTJT 3PNIA 1M1FA 3QHSA 2YRDA 1RT6A 2VBXA 5D6XA 2L48A 4JI3J 3V6DB 1JMTA 1IBCB 5CYMB 5F0UA 2YQ0A 2ZNYA 2N7CA 3K89A 2O5DA 5A2QY 1HMVB 1MROA 3CD6Q 4M63A 2NXNA 3EAEA 3ZTPA 2VD3A 2GVDA 2YQ1A 3GR0A 1C0UA 2LZ6B 4FYDA 1UG1A 3DHWC 4Q5VA 2E10A 2ZKTA 3L7OA 4U9RA 1WHGA 2EG1A 4ELVA 2ZDPA 4HR2A 1T02A 2ASLA 1JJ2R 4X9DA 1S1WA 2ZZMA 1FHTA 2MKSA 4FVCA 5F8NA 2MIOA 1EZZB 3IR5B 1FXXA 1M5KC 2CYYA 4EFAC 4C92F 4IO9Q 4HI2A 4ZNXA 2AJQA 4LVOP 3MFIA 1U47A 1HW8A 3G4ST 4ZITA 2DX1A 2PEHA 4E47A 4QCLA 2UXCJ 4X62J 2LMIA 5HATA 2KQWA 2AK5A 3VAKA 1F3VA 2RQ4A 4Y6IA 2VBZA 5CIUA 2GHPA 4B3RF 2RDIA 4W90B 4C48A 3E01B 4YUDA 3UPFA 1Y0MA 4C8MA 4BDPA 3MCSA 3BSOA 4LF8F 4YR3A 1ZSZA 2MYFA 4KBMB 3CC7S 5KYYA 2L9NA 3X24B 1VQYA 2DO0A 1G4CA 2YH0A 2XMFA 1A0OB 1DTTA 4QWBA 3QJLA 2DIGA 3JQJA 3Q24A 4RNFA 2FVUA 1X5OA 2JSXA 4OI1A 1UEBA 2HNDB 1SH2A 3AY0A 4PWDB 1U1TA 4B9NA 4UQGA 2QE5A 4OYOA 4DV2J 4PPDA 2MQMA 1YIJT 4DV1F 3QNWB 3LH2S 1GL5A 3RNJA 3CCUS 5IXUA 3HHNB 1OX9A 1SHGA 2GVZB 4C5EA 4I2QA 1HSQA 3H5SA 1VHIA 2HFOA 4DBFA 4X4VA 4DR3F 2QT7A 3FMWA 4NYZA 4WCEQ 1KSWA 3ETMA 3B4MA 4F2SA 3BB5A 4NLDA 2FVPA 3G9CA 1RAAB 4IH6A 4Y2AA 2MSTA 1UMJA 4RTWA 4R8UA 2O4XA 3NNCA 5HO4A 3PFOA 3LOUA 3NTIA 1UEVA 5D77A 3AJ1A 5FDLA 2Y1IA 4K7QA 2LQ8A 2RHZA 1N5ZA 2HBWA 1ZSGA 3CC2T 2ZUGA 1T05A 4ZVUB 4IR1A 3BGLA 2C2EA 2XBPA 2NUPB 2GF7A 3Q8YA 1VJQA 1M5OC 3L95X 4LF6J 4DFJA 3CPWR 3B4DA 1FA0A 4R0EA 3WBZA 1RE1B 1F2HA 2CFXA 1G2BA 2DL7A 4N0AA 2YLCA 3RU0A 1RI7A 2YQ3A 4USHA 4PPZA 4TQSA 4JI2J 5GMKl 3A98A 5F8MA 4RBUA 2JVOA 3QXEB 1H0HB 4DR1J 4F4XA 3DMJA 3ELHA 3VAHA 3OFHA 5HK4A 3NHNA 1MHNA 5HVFA 1J27A 4LSLA 2LQ5A 2V8DA 3CULA 1MUZA 4F4KA 2GQIA 1NK0A 4B3MF 4IOAQ 3W5YA 3UA6A 5GAMj 4LR8A 3M0PA 4WBFA 3UI3A 1M5Q1 2PU9B 5HMXA 1RT2B 4A4KA 1GXUA 3DB3A 1SUQB 3FRZA 2RK1A 4OMPA 2ZE2A 2WVBA 4ZP7A 5DETA 2IMWP 1YQHA 4GC6A 2JTMA 1RTJB 3OLBA 4II1A 4P10A 2KFNA 1KOHA 2VV5A 4RW9B 4DWIA 1SG5A 3N79A 3L1AA 5ETVA 4C98A 1DBDA 4RW7B 2VG5B 1VLYA 3M0TA 3NP5A 3JTPA 3R7BB 5L9XA 3V81B 2WBRA 1M2VB 4ZPWR 3VUZA 3KLHA 3LP0B 3M32A 3LGMA 5I3PA 2B8QA 3QYYA 2KT3A 3LALA 1C4CA 3LX7A 1QAIA 4U8VA 5T7LB 3IBCB 2GVZA 1X43A 3RR8A 2F9DA 4V19X 1RK8A 3EZ5A 5LM7E 3AJ2A 3M2UB 1BU1A 2MQPA 4E7KA 2IYGA 2YX1A 4AL5A 1S9EB 2MZSA 3V4IB 2EQJA 1I3OB 2EBEA 4KFBB 4A48A 3R2CJ 2OFGX 3GJRB 4KV8B 2ADCA 5D8HB 1V3ZA 3VS0A 3OTDA 3PYFA 4XU0A 1XN9A 1YITQ 1R8CA 4YB1P 4JB8B 2CPEA 3H5XA 5M2RA 2I38A 3OS2A 2DGTA 2AJ0A 2CJQA 1WF0A 4EU0A 1LWFB 1SHFA 1N9SA 1VQ8S 1NJIC 3KLGA 3MEEB 1CLFA 3D6FB 3OYBA 1N34F 5LMNF 2RHYA 5C5JA 2YWEA 5FW9A 4PJMA 3PEJA 3PMTA 4JRQA 3FJ2A 1EIYB 1H2VZ 2FC9A 2P0PA 1T3LA 1M3BA 3CMAQ 2ZC4A 2MMYA 2LA6A 1RYRA 4DR7F 3TW0A 2D1XA 3JAMU 2UUAF 2QQ9A 1VQ5S 3THPA 5IXBA 3ZTRA 2H5IB 5HJXA 3PNWC 1DJ0A 3LP2B 4RW8A 4CH0S 2JEJA 1HPZB 3FGVA 3MEWA 2HWTA 4LF9J 3I5AA 3OQ5A 3NAIA 1F3FA 2QRRA 2DYIA 1RTIB 1KDNA 2DHAA 1A6LA 3EVWA 1NXIA 5I2MA 2JS2A 4BBYA 4D6WA 3M57A 3OR1A 4J9IA 2A3JA 2HL3A 1K0VA 5B0FA 4YY3F 4F16A 5IN1A 2EWHA 4DPXA 3TANA 3HCXA 5SZTA 4FN5A 1EFNA 2LNVA 4B6MA 3P5TL 2C2OB 1KC8U 4C92G 4KPYA 2M4MA 4KV8A 1RABB 3RB4A 2YT6A 1FESA 2ZBPA 3V8JA 1YZ6A 4K0KF 2EQKA 1FWZA 3V7RA 3BSAA 4LNPA 2LJ0A 4P71A 1TU0B 1UPPA 1YVFA 2RQVA 2YNHA 1WELA 3HZGA 3O8WA 3NXZA 4C8LA 3MD1A 4NI2B 4M77G 2QIFA 1OSDA 1RT5A 5HMZA 3MOJB 4N77A 5BJRA 4KGZB 4HCZA 2B51A 5GMKe 1PKSA 1X9SA 5HROA 2L9DA 3N6NA 3SMZA 2B3TB 3C16A 1LXNA 1XR7A 1NDKA 4GMKA 1FT8A 2H3JA 1BQNB 2D74B 2ZD1B 4DG1A 3VWSA 2VQEF 3PVLA 4QW9A 3ZTQA 1JJCB 2F5KA 3ZL7C 1ZYQA 3K5NA 1VYVA 4J9CA 2OKQA 1OY8A 4ED6A 1WX6A 2X7IA 3M53A 2UXCF 3BBFA 4WXOA 3F56A 1KOOA 3JYTA 1W2BA 2WHOA 5DLGA 1TR0A 1I07A 4K4SA 2OSRA 3I0SA 2DE0X 3MTJA 2HAFA 3W8PA 1JXLA 5D4OA 4J90A 2GTOA 3CCJA 1K8AR 1NSKL 3OW2R 3G6ET 1N33J 2KXNB 4FF4A 4ES3A 2W2NP 3CCET 5MLCV 3QPHA 1YBTA 4RTTA 5IT9E 2F4VJ 1Z9ZA 4EYHB 1T9XA 3G7ZA 3GBQA 3W2VB 5KFWA 1ICEB 2V1QA 5DG8A 3FB9A 4F4ZA 4Z02A 2E5QA 2LXUA 4USTA 1NJZA 5CCAA 1FFSB 1JX4A 4LQ3A 2CQHA 1FD2A 2DETA 4ZCKA 1FTCA 4B9UA 5AJ3F 2YX7A 4NA3A 1IKVA 1VQOS 3PE0A 3A1YG 4TYBA 4OV6A 3K58A 1YIJQ 1WSRA 5HCKA 2VQFF 4HCCA 2BRLA 2MJNA 3JSMB 3BPDA 2PT0A 1NK5A 3N4WA 2IAJA 2J9EA 9RUBA 3ZZTA 4QR1A 3W3SA 2CPIA 2F8EX 5J3BA 4WJBA 4ORZA 4HT5A 3PRDA 3T1AA 4K50A 2HW3A 3Q8VA 2AJFE 5HSPA 3BH6B 4X84A 3MXHP 3E51A 1QP3A 4MKBA 4RR5A 3TREA 4QPXA 3NTKA 3CQTA 3M8PB 3HD1A 3KJVB 5IWAJ 4Q43A 2E70A 1TAUA 2CPXA 3TA0A 3HJVA 2CYZB 4DV0F 2VG5A 5M9OA 1VQKQ 2EK1A 3I9V9 4DLEA 3IM8A 2P6TA 1PG5B 1ZA2B 1M30A 3DU6A 3OR2B 5C24A 1YWPA 2DIVA 2RJEA 3OW2S 3BY7A 3JCMd 1VRTA 4AFFA 2YKAA 3QBYA 3GV5B 3MM8B 3DRRA 1ZSZB 2UZAA 3HP6A 2E1HA 5D78A 5L1IA 3QJ6A 3BBCA 2NYIA 1WDTA 3D6MB 2L0AA 3T19A 3IS9B 4M5MA 2JS0A 3RG6A 1NKBA 2CWXA 3L2VA 2KNBB 1QWEA 1H72C 3M59A 4USUA 4Z7CA 4LRCA 2DILA 2PDAA 2EAYA 3HXMA 1PAUB 3U02A 2LQKA 4EGLA 5LJ5g 3V2UC 1W1FA 2MZQA 1Q7YT 2Q3PA 5CK9A 3CCMA 2XNRA 1Q82U 4M4ZA 3MP8A 1OS5A 1FJEB 3OYMA 2GQVA 2V2QA 5KYXB 1SV5A 3QZ5B 3HTRA 2AV5A 1S10A 4JRPA 1LJOA 2OPPA 3L7PA 3X26B 5GAGU 1JLBA 2BYCA 3R6GB 1T0JA 4LDUA 1N6QB 3QT7A 4ZTJA 5I42B 1X7VA 3MI7X 4OIXA 1U1SA 3DU5A 8AT1B 2E44A 1IJFB 3DLGB 4XIUA 1LNXA 4ANDA 2D41A 4OI4A 3B8HA 2YUNA 4JV5F 1HNIA 4NEZA 3VS2A 1H38A 2RU9A 2DJQA 4TN2A 3QBCA 1DY3A 5D6YA 2JM8A 2DNQA 2MLYA 1SL2A 5EWGA 3CD7A 3SXLA 4CTAB 1WQ7A 4KAIA 1D09B 1N48A 2GCXA 2R42A 2BXJA 1CJTA 4J9QA 1JU5C 5EDWA 2MKIA 1Q86R 1R8AA 4KFBA 4NA1A 3DOMA 3ET6A 4JS5A 1YIJA 1IBMJ 1BI2A 3OXGA 4NYOA 2HPUA 2RJZA 3BDUA 3S01A 4PWUA 3MEDA 3FFIA 4LQ9A 5IT4A 4GKKJ 2GA7A 1LK5A 3HSZA 1HBMA 1B99A 1YJNS 3FVYA 4LFAJ 3ENAA 3RGIA 3EUNA 3IRWP 3BQ2A 3UD3P 4WXWA 1Y0HA 2A6MA 4C11B 4RUBA 5H9EJ 3BO4A 2XB2D 1L3TA 4ZCIA 3M6XA 2AX0A 4NASA 4J9KA 2KXDA 1RI9A 2KSSA 4IG0B 5KT2A 3AB2B 2KE9A 4RCBA 1I0CA 1NE8A 3OTEA 3BQ0A 1IGUA 3NFCA 1CQNA 4FCYA 4NYPA 5DG7A 1VQSA 3CCVS 3T6BA 4XK8E 4Y2IA 3T1YJ 4OZLA 2XGQA 2SRCA 2W24A 2HFZA 1RT7B 2OPQB 2VUBA 4NXNF 1WHLA 4KO0B 1EETA 2CQ1A 3KXDA 4TU9A 2LECA 2QZ8A 1UUEA 1RP5A 1F9FA 5BR8F 3KJFB 1YCYA 3JCMJ 2QEXS 2VA2A 4R56A 4QPTA 3MECA 3EG1A 2V8IA 2ZOMA 2OAWA 4ZPDA 1CKBA 4M7DG 3K57A 3GG0A 2VOPA 1UVIA 3W7BA 1U2RA 4WU3A 5GMEA 5FWCA 4CLTA 2MDAA 4FT4A 2O88A 4ZP6A 1TELA 4E7ZA 2H5EA 2VONA 4JV0A 1F0XA 3RAQA 4MZPA 3NL0A 4PQUB 4P2XA 3G71A 5J1EA 3KWMA 4PXBA 2CNKB 2XMTA 4ID5A 2K2MA 2COWA 4PJOG 4L74A 2A37A 3GQCA 1TKZB 1LFPA 3JTNA 1FE4A 4J5YA 2V4QA 1YJWS 3DLKB 1SRMA 3NNHA 3JSRA 2BQRA 1AZSB 1OPIA 2KXCA 4DOWA 1R43A 4C92B 4IQXA 2FUG9 2CDTA 1WSVA 2I5JB 2YKMA 1YI2S 5DQIA 1HYSB 2MI6A 2EVZA 2YY3A 1QTNB 4NI2A 4FF3A 1OQ6A 2GIQA 1S0OA 5GANh 2HGNA 5A6WA 1VQKA 2WTFA 5I2SA 1JLGB 1YHQQ 3PFSA 4MK7A 2B7BB 3Q8SB 3URGA 3WHIA 2HHHF 2H8HA 3MD3A 1TKZA 1VQMT 1CJKA 2WCXA 4WU2A 4AFQC 3PYEA 4CC3A 4S0MA 1KN6A 1CC8A 3CEDA 1XWLA 2M7SA 1VQPQ 3HFVA 4HTJA 3RKYA 3AJDA 1IBKF 4HXJA 2BJ9A 4J9BA 2CVEA 3I87A 1XEZA 2FJBB 4F7UA 2IA0A 4CLWA 2UUTA 1N52B 1OMSA 1FWKA 3VJPA 1VQKS 4QR2A 1FDAA 4YHHF 3H4BA 4QIFA 3IGVA 2XMVA 5I22A 3BYRA 2XZDB 4CRJA 2J6FA 3CO9A 4YB6A 3QZ9B 1V3RA 5H9EK 1GMWD 4ZVRB 3C19A 2HVZA 2WSCE 1JIHA 1S57A 1PRMC 2HLTA 2AYGA 3MHYA 5HLFB 1UGSB 3L9ZA 4DCPB 3T5KA 4MH8A 4C7QA 3OUYA 1I51B 2QL7B 3CMEA 4DV0J 2O9SA 1U2CA 3ULHA 2M3DA 3H2VE 4RW4A 2MY8A 4Q5WA 3PYDA 3G71S 4DSJA 2HHPA 3H5UA 2U1AA 3BDPA 4PUOB 4J9MA 2JMCA 3CIMA 5DDQC 5EUHA 3QO9A 5GAOp 1OWXA 4LBIA 1UWBA 4ED3A 2M2BA 3M2UA 5JVHQ 4UW2A 3LWLA 1M90T 2W9BA 2B6AB 3BDLA 2QEXA 4M77B 1JLFB 2ED1A 4UQTA 1W6XA 3M8SA 3QWXX 1MNDA 1HBMB 5C2CA 1K9MC 2Q79A 4C92C 4E0DA 1ZA1B 3TSWA 1U0HA 4TVRA 4EMHA 1WEZA 1AZSA 3OR2A 1S48A 4WKYA 3FCVA 1I94F 1GK8A 4H4MA 5JUMA 4OB0B 2IDEA 4F25A 3DRPA 2OPSB 4NWBA 2KFZA 2KJVA 1KG1A 1IBMF 4O3QA 2YRVA 4PNOA 2AGOA 1ZBJA 2FD2A 2XULA 4J9GA 1TG0A 1UEKA 1U24A 5B0GA 3M9MB 4LSZB 3IR6B 4RL1A 2J0SD 4OB2B 3JCMW 3BSCA 1B0TA 3TX0A 2AJ4A 4GKJF 4WF2A 4N4GA 2CG8A 2MQLA 5JXSA 1HPZA 4GO5X 2EJFA 4C0GA 4IYQA 1YWOA 1UE9A 4M75A 2PNIA 3BR9A 4AT1B 1YJNT 4Y34A 5KFXA 2XMKA 4BC7A 3L2UA 2DEUA 3PG9A 2GS8A 3UF4A 2CJKA 2E1CA 2V94A 3WC0A 4X4QA 3ZZZA 4MIWA 4AUKA 2C3MA 4V2SA 1SKRA 4OZ2A 2W1BA 3OTOJ 5KYWA 3TAPA 1KBRA 1FRLA 3NGDA 3VS7A 3U7JA 2KB2A 1X0FA 3QJJA 1IM4A 2XMUA 2QYGA 2R8IA 4PG8A 3M2VA 3NCPA 3G8SA 2E7WA 1TSFA 1QAYA 4CP5A 3CXCR 3N5BB 5KG5A 5GMKm 4HEA9 5J2QB 3PDNA 4F7UE 1Q16B 3W9JA 3EGUA 1HNVA 2XI2A 3NAHA 3KLFB 1MROB 3RAXA 2JTFA 1JXMA 3KMQA 3KLEA 1NZAA 2ECZA 2HMIB 2DVJA 1RHKB 1RHRB 3EVOA 4DR1F 2MQNA 3FBFA 5DRKA 1S6UA 3PIPQ 3GYXB 4DS5A 5JJBA 2DERA 4YR2A 3HT3A 3M2VB 1NDLA 3RBBB 4C8QD 3GIRA 3CC7Q 2VKNA 1KHVA 3CJ4A 5HROB 3QYGB 3FLGA 1RI0A 1J2VA 3TWZA 2ZJQQ 2DCLA 3GZ7A 1RKJA 3CCRS 1VQNS 1G3OA 2RKIB 2LQJA 3BR8A 2UP1A 1HK9A 2EYXA 4OL8A 1DARA 4F04B 3EFRA 3HHLA 1VHFA 2L8DA 4PJOA 5J2QA 2DH9A 1DAXA 4QVCA 1X5PA 5KOXA 2DGSA 4C8QB 1GMVA 3CVKA 2KYZA 1Z9QA 5HK3A 1XMOF 2C2DA 1VQMA 1TL3A 2QC3A 4A8QA 3CCSQ 3CDWA 5FLXY 3MKDA 3OW2A 3Q2SC 1LVKA 3DLEB 5HK0A 2XSJA 1ZAVA 5A6PA 2KG1A 2HNYA 3RTVA 1Q8LA 2YKNA 3IRXA 3HPOA 3CMAS 2BE7D 4DV6J 4C0HA 4IQMA 5E3CA 1NK9A 3C6UB 4ATNA 1XMOJ 4FZVA 2E1RA 3HI9A 3TJ9A 4JZ3A 3QJYA 1JJ2P 2BJ1A 2VJVA 1VQ7A 3EG9A 5F9LA 1I1GA 4EMKC 3C15A 2FPFA 3M4XA 5A76A 3EGDB 3U27A 3O3LA 2X1FA 1VQ9Q 5CAAA 3FC9A 4DQRA 4RBTA 3H0PA 2O4XB 5LSLA 3W8GA 2I0NA 3K8VA 1TK8A 5C0MA 2IJFA 4FS2A 1R77A 2CG4A 1EX4A 1D1UA 4RNHA 4XQ3A 4M5IA 1CSJA 1TTHB 3MPDA 4DR7J 1WF2A 4OZ3A 3OYKA 3RMSA 1NSAA 5KFPA 3PFEA 3CDUA 3DB4A 3QT6A 4P2SA 2CP6A 1WHWA 1VQOA 3ZFJA 3R5JB 4DR2F 1XMQF 3GPLA 1Z1ZA 3AAWB 2QA4T 2GO9A 4X66F 5GMKi 4ED0A 4JI7J 3DM2A 2BM0A 5KFVA 5GMDA 2JEGA 5CKBA 4TKTA 4DR5J 5KFCA 2HIYA 1WIEA 2C0IA 4AFUC 5CR2A 1OIAA 2VG7B 4J6YA 4J9VA 4M77D 3MAHA 2W2QP 1P9YA 2EQIA 1QWFA 4YS2A 2F2XA 4CT8A 4E7HA 1LCKA 3MM7A 3CCJS 5BYQA 3KLVA 3KUGA 3BN7A 1AUDA 3GFYA 3JSMA 3JCMQ 2EPDA 3MMBA 1K8AT 2EC0A 5DM6Q 3MCAB 3K5LA 4LF7J 4K4XA 3VTIA 2EBPA 3NMZC 2BJEA 4ID5B 2DXTA 2YKOA 1HQ2A 2YNFA 3C6TB 4OV1A 3S1TA 3X20B 3GSIA 4DR2J 1RT3A 2HQXA 4J6XA 1H3HA 3SZ2A 2I0XA 1N27A 2CGHA 4PWWA 4IIOA 1TL4A 5K8NA 3KFVA 1RBLA 2KHCA 3EFOB 1URNA 2DR6A 2NZCA 2COZA 4ITSA 1U1PA 4UY8T 1ZUKA 3DLEA 2KT1A 4ID8A 2C2MB 1U1LA 3PT9A 1KJWA 7FD1A 2PI4A 1JLGA 3RBZA 1UB4A 4UT4A 4WK3A 1NHUA 3WX4A 3D68A 3O8VA 3PY8A 4ED2A 1YLXA 1S0VA 1KVIA 3HX9A 3K5MA 5GAMf 1HA1A 2HZAA 1WJ9A 2J7IA 3GU0A 4KQZA 4DUZF 4J9RA 2D9TA 4G1QB 1BD6A 2V4RA 1TUDA 3RDVA 2AYBA 1PJ5A 2RQWA 4J8OA 4K4TA 4M75G 2XG8D 4I2PB 3DKDA 4B3RJ 5CVIA 4JV1A 4X9CA 4B3SF 1IKXA 1PSEA 5KT5A 2DBMA 1M1KR 1WOOA 2A10A 3AQPA 1CEZA 4M78C 1LFWA 1RWPB 4EBEA 2LEPA 1UW9A 4ZPVR 4JI1F 1VQ9A 2Q66A 3WXMB 2WONA 4OZ5A 2PUOB 3J7AN 1HL6A 2LT1A 4HI1A 5C6SA 2J9DE 3EXCX 5HQMA 2QX0A 3KK2A 1OU9A 4ELZC 4RUAA 1WI7A 2DF6A 2G2OA 1RAJA 2KVIA 4JI4F 3M30A 1MV0B 2YNIA 1K4US 2L3MA 3W62A 3HF5A 2KT5A 3BV8A 3HFOA 4DF4A 2EGAA 2BANA 4C6AA 4J91A 4LDXA 1X4DA 3J81Y 3AA8A 1VQ8A 2UXBF 1KC8C 4CRIA 4L72B 2IFXA 2XMAA 4EMGA 4CLLA 3DOKA 1H2TZ 4A4JA 3SCIE 3IWLA 2A7YA 1OPKA 3R97A 3G1JA 2W7AA 2L9WA 5KFEA 3HKZD 2ZM6F 4IG0A 1RTDB 2YKPA 2K3KA 2MKHA 4ZVPB 2AT1B 2HNIA 3I35A 1KTVA 5BYRA 4CDIA 3JCMP 2D3UA 2XNQA 2UUBF 1QM9A 3LH0A 4OMLA 3OSVA 3KK2B 1AYEA 2CPZA 2JEFA 3JB9I 3T5HA 4DPOA 4PJJA 2YNGB 1PBUA 2M88A 5E3AA 3A12A 2IPOB 4B9XA 1V1CA 3H59A 5GAN3 4RCCA 1RCXB 1ZQ1A 4M7AB 1WACA 1WXBA 1M2VA 4R0JA 2M0OA 2VF3A 4CT9A 4KH0B 3TQ7P 2ACYA 3DM2B 3I55S 1S9GB 1SXLA 4LFCJ 4BY6B 3D6HB 5KFLA 5GANd 3DHXA 2EFPA 3UT1A 2B4PA 5KFRA 4ERDA 1C1BB 3ULRB 2IVMA 1WG1A 4HDGA 1CSKA 4JYAJ 5EHHA 2W8LA 3HVRA 2F4VF 4JP8A 4O5VA 2EFQA 1F60B 4P7VA 1VJWA 1M3AA 5G4DA 3S3MA 3BJYA 1OSCA 1T3SA 3GNFB 2FY8A 3PEHA 1VGYA 1Q82R 2ALZA 4GC7A 3UN5A 5EX0A 3EXYA 2OHDA 1H3ZA 2BACA 2ZPEB 3KK1B 1RHQB 1IJEB 4XAXB 3PXGa 4DPTA 3PW7A 5IWAF 1L3SA 4BDZA 4L6V3 2FJDB 4JOUA 4R5PA 1F1BB 1RAGB 2DA9A 1U1OA 5F8GA 1F9HA 1AZEA 3L42A 2B5JA 4ZPBA 3KHLA 2N4CA 1NK8A 4OYXA 3GLJA 3ZEHA 2JJ9A 4MIBA 3QT8A 3D67A 3JV3A 3TAMB 3UVJA 2CQ0A 2VODA 3W1YC 3QWUA 3V8LA 4OX6A 2VKRA 5HBMA 4USKA 1ZM2A 4MJKA 4LSNA 5LOQA 1P6TA 2CT4A 5D0EA 1RU2A 3AHUA 4ALZA 2HBRB 2HBPA 4OMFG 4OX9F 3NCRA 3DYAB 1YJ7A 4LF7F 1NG2A 3W60A 1HWUA 2ZH1A 1Q95G 2VFRA 4N5SA 4OB1B 4IUPA 5GAHI 3CD0A 4HHJA 2QXFA 2ZVIA 5KT6A 2EYQA 2RM4A 1KTQA 1TL5A 1GMWA 1XOVA 4NE9C 3LWHA 2HHVA 5GAGI 3RKXA 3CCJQ 2R7SA 1PRLC 4MDXA 3GONA 2CREA 1ZPVA 2KU7A 1VQ4Q 2AZVA 3UDVA 2OEMA 4ZPCA 4M75E 3OW2P 1TL7A 4O4RA 1ZPWX 4IUQA 3MMBB 2JHEA 3CCEQ 3DDIA 2HIQA 1F9EB 2DLPA 4JI8J 1S9EA 3GCXP 2H65B 4CI0B 4I7FB 1M2OA 5CQGA 2Z2MA 5I21A 1MU2A 3W9IA 3FZBA 3DFEA 3ZBDA 2QDYB 1ACMB 4I2QB 5F8JA 4PFZA 4LF4F 2VXFA 4MZTA 4OYMA 1D3BA 2ED0A 1B64A 5J2MA 4C3LA 4FPRA 1RWNB 1PC5A 3VS3A 1NJIR 2RILA 4LN2A 1GBQA 1VBXA 2BKNA 4AFZC 4PABA 6FDRA 4RMOA 3H2LA 1GCQC 1U45A 2X1BA 1GCQA 5FU7B 3NBPB 5B08A 4ZP9A 2CZVC 1ZTWA 1JK9B 3C3LA 2O67A 3GILA 2LP4A 4RWXA 2P8IA 2DPPB 1YRTA 4ZGEB 4FU6A 2D9OA 3NCQA 3W5ZA 3KLFA 4HTIA 4F02A 4ILMA 4IO1A 5ETQA 1LWCB 2XCPA 4NCGB 2DM1A 2RHUA 5D4PA 3GCWP 4C97A 5I42A 2VDHA 2E1AA 1RHUB 2HS0A 3FZ2A 1H98A 4DX6A 4IRDA 2DYAA 5IV3A 4DUYJ 2J7UA 1WHVA 4WFBQ 2F3JA 2J6KA 2OEKA 2YWGA 2WSEE 5J39A 1SJ1A 1QKXA 2DZ9A 1X4EA 1BQMA 2QMUB 2G3RA 1QP2A 2GNCA 3FSIA 2IG0A 2ADBA 2IC3A 1IGQA 2FO0A 2XZTB 4NRUA 2CJXB 1PYSB 2JMAA 4QVZA 2Z57B 2LXIA 1FFWB 2GFAA 5CKFA 4EMKA 4USVA 1U0HB 4DL4A 3HD2A 2Q6BA 4LF5J 3RIRA 4D8DA 4IG3A 2FHJA 5LL6d 2FZCB 1RTHA 3G82B 3P45B 2CP3A 2RE1A 1LWCA 3IXQA 3G6XA 4Y91A 3TSZA 2DTIA 4TVAB 2HFSA 3VQTA 1O0PA 2ROPA 5DLQE 2EKYA 2DY9A 2VVKA 4AQYJ 4NS5A 5KG1A 3OB9A 5KG7A 1S1XA 4F26A 3MURP 1VQ4A 2FHOB 2CSQA 2LJ3A 1S1TA 2K5LA 2ZEJA 1WG5A 1R0CB 3CC4Q 3J7AF 1CULB 3ZO7A 5GAOq 4OYZA 1CS4A 1K73C 1E6YA 4R55A 2A2CA 1D0EA 2IM1A 2W4DA 2X35A 1Y57A 3L2WA 1TK5A 4PG5A 2CZ7B 1WC5A 3DXSX 3UWTA 3KK1A 2YH1A 3HHLD 2P84A 5FU7C 1FRHA 1TS9A 3KLHB 2A0FB 4XDCA 3QO9B 2F8MA 2QG9B 4CM0A 1X31C 4CLFA 4FNHA 3SCLE 4JJNK 1OZ3A 1HD0A 2FJWA 4EO8A 1URRA 1OQKA 3THKA 5DDOC 5LXRA 4NXMF 4O4GB 1WPYA 1KQGB 3NWRA 5GAEI 3HRUA 1E6HA 3LYIA 4DCOB 1S9GA 4DEXA 4YOEA 1B70B 2V4JB 4DU7A 1VYTA 3GTYX 1BI3A 5CD4H 4PL6A 3MAAA 1VUBA 2VXEA 2AP6A 2E5LJ 5ECAA 2HNYB 5KFUA 3SDEB 2R4FA 1VK3A 3ZZYA 2V5HG 3CMQA 4FXWA 2C3UA 1DFDA 4PJOB 2N4DA 1TKXA 2KN4A 3VR1A 2K5IA 2HURA 2OJ2A 1H73A 4M1KA 4E8UA 1UVLA 2IRUA 3JSBA 1SC1B 2ZWPA 2OP5A 2HHQA 1NSQA 1PIEA 1X6GA 2BA9A 1UDLA 3E2EA 1OY6A 3S7RA 4NZ7A 2IBKA 3A8HB 4ZGDB 4A8WA 2EW3A 2RB7A 3N01A 3SYZA 1M5HA 5LJ3f 1NB7A 2MMPA 5F3ZA 1W2BP 4JJBA 3JSCA 1GAOA 2PD1A 2MKCA 3EZOA 3UPUA 2V2KA 3UDLA 4QQ6A 1VQNQ 3ZZUA 4OX8A 1C4AA 1S1XB 1ZSZC 5B0BA 4DZ6A 3E8OA 1NHVA 2IIHA 2RRAA 1BQNA 3MM9B 2HSPA 5KOWA 2B7CB 1VQ9T 3VQSA 3AD7C 5D0HA 2POKA 5GAOl 2YNIB 3TEEA 4M7DB 1UJYA 1OO0B 4J9HA 1JB0C 1FNMA 4MYTA 3AOAA 4C5GA 1C2PA 1NSPA 1L5UA 1F5AA 4IG3B 2LLZA 1SCJB 5CHCB 4N47A 2QFJA 3EGDA 1N8RU 1ZUUA 3MDFA 3HSJA 1JLBB 3LGNA 3CXCA 2RIJA 5B0CA 1WI8A 4R0KA 2B86A 1NLKL 4RKUC 1GXTA 2ZOGA 1JLCB 2J8AA 4KRWA 1T9TA 4GRSA 1M9SA 1UFFA 2FDNA 4VUBA 3L3CA 2FJXA 4DV7F 3UCGA 3LP1A 3R1HA 2ZC3A 2HG4A 2WSEC 1K73U 3RUBL 2D7SA 2RH2A 1UECA 1HNXF 3PX0A 1B3TA 2RDDA 2BVZA 3VAJA 1GH8A 5IC4B 5KFDA 2CQCA 1S9FA 1D1AA 1YJNQ 4LR7A 2DNKA 3QQCD 4B3OB 1K1SA 4LMZA 4ZKAA 3MR7A 2ABYA 4LF4J 4M78B 2RNAA 5KYUA 4LVNP 3M0UA 1EP4B 4DBQA 3H41A 4M7DA 5L1KA 2DNLA 1VQ7S 3BN4A 4LE9A 3OSNA 3RR7A 5CKEA 1U1KA 3DOKB 3MWBA 2MXYA 4AL6A 4A4EA 3LWIA 3CMAA 2OTLQ 4F36A 4ZN1A 4RO0A 2DFUA 1S0MA 1H2UX 2KYXA 1BCOA 4P2FA 4NEYA 5T14A 1VQMS 5E7OB 1FWPA 4FYXB 2N82B 3P4UB 3E2UA 2K7KA 1JNRB 1QQJA 4I7FA 3J80E 1TVRA 2RKIA 2JFKA 1VYAA 3TZZA 2FHJD 2R7XA 3JXOA 2YBVA 1VQNA 4EBDA 2VFSA 3GNGA 4ELTA 2LKZA 2OTJQ 1NYGA 3NEKA 5I3UA 1YI2Q 3M7VA 1C1BA 1U8WA 4G1IA 1SL0A 1RWWB 3MAAB 3ICLA 2Z2LA 3JCMV 2O3DA 2OD6A 3CIZA 3IRXB 2CAJA 1RHJB 4O6JA 3C12A 1M90C 2HQEA 3TVKA 1NM2A 3MMCA 1YJWQ 3KUHA 3BYPA 2WVCA 4DSIA 4CO2A 3CD6A 3D0HE 4K4WA 4URGA 1FKPA 1M5SA 2LEAA 3P8BB 3O1LA 4IUTA 1N0VC 3NY0A 1M1HA 3WVDB 3CDAA 2LP5A 2XU8A 4R8UB 3VKIA 2ZUAA 4DHVA 5ETTA 4OYWA 4BCAA 1WJRA 5GAN6 1AZGB 1TKXB 2J05A 2HCKA 3EJMA 1W7WA 4UTGA 5GAN2 1FKPB 1SBRA 4DPYA 3NLCA 1SF9A 5HBMB 3H6ZA 4XK8C 4ECVA 5DDPC 5CABA 3OHBA 1WJQA 4CM2A 3IBFB 3A5ZB 2HQFA 2IA6A 5IS2A 2NQPA 5IFMA 1FE0A 4DG1B 1FDNA 4OF1A 4OHZA 3D5MA 1M3CA 2DXDA 3D3CJ 2XQCA 1MWYA 4CH1A 3OL8A 3FJ5A 4WFXA 2R7QA 2EI5A 2EGEA 3B6BA 2F7VA 3A4TA 4ZLLA 3H0FA 1NUEA 1WC6A 2XI3A 4XAKA 1VC5A 2FB0A 3CCQA 4HACB 2GFFA 5KFSA 4U6PA 2HQCA 3VRZA 2MKYA 2B8PA 7FDRA 3R8YA 4FL6A 3FBCA 2LFVA 4WCIA 1YBUA 3E01A 1LW2A 1IWGA 4DV5J 3A3PB 1WWHA 4JI0J 3FFIB 3CXCP 3FQLA 1K0TA 2LQNA 4P72A 1RGVA 1N54B 4MDWA 4PUOA 3CD5A 2VC1A 2VOOA 4BY6C 3JCMb 2JNJA 1IHWA 1ELOA 1RL2A 2M0YA 4RU2A 4IFYB 3AOBA 4P9SA 3KJVA 2EFGA 2V8JA 3CNQP 2MAMA 2V8PA 2HFVA 3C14A 3DKMA 2RK2A 4IDKB 2ZAEA 4WZMA 3O44A 4V1Ak 2X4YA 2FGCA 4RW8B 2F2WA 2FG0A 4MKYA 2A28A 1I94J 4C8OA 2QQAA 2W10A 3QT5A 5IT9Y 1AFJA 1D0XA 4C92D 2KGTA 2F1LA 5KFYA 4TY8A 2DNMA 2UUBJ 4KR0B 2HYIB 2IM0A 3UFCX 3BM7A 4LDYA 1XR6A 3KMSA 3HKWA 9ATCB 3D54A 2AZ1A 1UVKA 2XS7A 3J7YU 2HHSA 4J9UE 2XY5A 2MJUA 2XKOC 2YXLA 2D0NA 2HLUA 3D2WA 1BQMB 1BBZA 2ZBRA 2HRUA 5I3UB 2ZD1A 1YJ9T 1WC1A 1QCOA 4G65A 5DM7Q 3TVTA 4C8QE 1C6VX 3INZA 3CCSA 2Y0BB 3MR6A 1EP4A 2LQWA 1XIQA 2CP2A 2AQ4A 4F50A 4XO0A 3F73A 5HVHA 1TK0A 4KTQA 2KFYA 1ZUYA 3OYJA 1W2IA 4X4RA 1M1KC 1PKTA 1FNOA 4LDVA 4IKFA 4HCBA 4M5JA 4F7VA 3EVMA 1YGYA 2AEMA 2XYPB 4RBVA 1S4FA 3NMRA 1QVGR 3DOLB 1TMJA 4DEZA 2VWFA 1TUGB 1E6YB 4ZN3A 4Q0BA 4EUVA 2FLOA 2QA4A 1RKIA 1QCFA 2DYBA 1C1CA 1RXOB 1WHYA 2E6NA 4NMLA 1WKJA 2M52A 1PJ7A 2WW8A 2X1AA 2E12A 5A0YA 2EFVA 1FRMA 4ZOSA 4WP3A 5HI7A 2HDAA 5ETMA 1Y96A 3CJKA 4YHHJ 1JXVA 1VA7A 3GPAA 3OTBA 1NEGA 3IG1B 1IR2A 2W7OA 2K57A 4QBUA 3IBWA 4QYRA 4C92A 2AJ2A 5K8PA 4M75B 1YI2A 3EPGA 3PJXA 2PMHA 4BWMA 2E3IA 3QDRB 2I8EA 1X4AA 4PCQA 2DRDA 3NS6A 4NPOA 3DI6B 4EK2A 3G2XA 3I31A 1YITT 4KULA 3V4MA 2C3OA 1N6QA 4RW7A 4CC7A 1BCMA 2G0IA 3I5RA 3K0JA 1OEBA 1I6JA 5ETPA 5A0DA 1RJJA 3SD4A 2D6FA 1I1JA 2FY1A 4NA2A 3GJSB 1HQUA 1RAHB 1ZAXA 1M0SA 2YNFB 2FVRA 2VJUA 1R3NA 4OYBA 2VGNA 4LDWA 1IQZA 2XEXA 1EIFA 4QZVB 4DN9A 4EO6A 4AL7A 3BGRB 4Y0FA 3OV7A 1DZ5A 4U7CA 3IAS9 5KFQA 1JRIA 4DA4A 4EMDA 3EGVA 3LWMA 2Y1JA 2Y0SD 4F0HA 2XI9A 1W25A 1KKHA 2E6ZA 2HZYA 3R6OA 1TL3B 2ZPHB 3M30B 3UNYA 1B07A 3I56T 1RUSA 2MSSA 2ZZDA 2VH7A 3GWCA 3ZTSA 1VCTA 2EGCA 3RMQA 2J9DA 1XBWA 5FRNA 1C0MA 3I0SB 3ZXWA 3NKYA 1JJ2S 4NLTA 3HO1A 2DRKA 4B02A 4OZ0A 1VC6A 2E5HA 3R5CA 4HA8A 4ZLNA 3VGVA 1VQ5Q 2DXUA 3POTB 1JXEA 2XD0A 3D28A 2XWXA 1RT3B 4RTYA 2WSCC 1RAFB 4N4HA 3AD9C 3V7CA 3I55A 3PJWA 3PV8A 5KCHA 4HH0A 1IKWB 4L59A 1A9NB 2XM3A 1B7YB 2BJ7A 3SFMA 2YLBA 2HVEA 3I96A 4DOVA 2V0NA 2WBMA 5HLFA 1HNVB 4D8KA 1V5VA 1G3YA 3MM6B 1TP7A 1PM3A 1UEUA 1CJUB 3GP8A 2G6FX 4TYAA 4CLYA 4CNZA 3IQLA 1TUWA 1DRZA 4BE2A 5KFZA 3FNNA 3SI8A 1MGQA 4UOHA 3C15B 3VAFA 3IWXA 3HK2A 2V2VA 2WVFA 1EETB 3CSKA 5A8KA 4DV2F 4LJMA 1JBMA 3F44A 2DPIA 1NB2A 3O5TB 1T8EA 1RAIB 1KNZA 4M7DF 3CE8A 4WTOB 2DNPA 4AMCA 4YDXA 1AWXA 4MMKA 1RDRA 1S72T 2W2PP 4RNMA 1GFCA 2O66A 4CQ1A 2L89A 3A8MB 2NUTB 4J5OA 2VB6A 3H8ZA 3OUYB 1BK2A 4ZVFA 1AWOA 2E9TA 2A2DA 5GANg 1IUJA 1UVJA 1FO1A 4FKYA 4DI6A 4DL7A 1V76A 1LQ9A 1ITPA 1LEOA 2A08A 1CJVB 2WW4A 3TARA 2NZ4A 1FWLA 4O3NA 2RQKA 3CJ8A 4U96A 2KDOA 1KWMA 5BXIA 1FMKA 4XU1A 1X4BA 4RPFA 3C94A 3VF0B 3M54A 3MCNA 3RBXA 3RRGA 3QWYA 3GIBA 3LUYA 4J7CA 1FD8A 4JUZA 4EBCA 3CDBA 3TQ1A 1VISA 3CJ0A 2XY7A 4HLBA 4DOZA 2RN8A 3OYEA 1TQLA 2F63A 1K44A 2MPXC 4JPBW 1Q81U 1U6FA 4PAAA 4YB7A 4AG1C 2NUPA 3OS5A 1TKDA 1UW4A 2PUKB 1NK4A 5GAN8 1U7LA 2XDPA 2GIRA 1MLAA 2B8AA 4V19J 1R31A 3W9HA 2ZE2B 1U4BA 2Q6CA 3KBGA 2ZITA 3KG1A 3VU3C 2ACMA 5KG4A 1WHJA 4LUEA 1KR4A 4QKUA 2KRNA 4FM4B 4TLQA 3THTA 2DRMA 5F8HA 2RF0A 1Q81T 1Q7YC 3FRYA 5CYMA 2M8DB 5KT3A 4ELUA 3EZUA 5KG3A 4KHPJ 2P5VA 4ECRA 2E5GA 1X0PA 1MG7A 2DGOA 3DLBA 3OMCA 2CDQA 2OO4A 3PACA 1SIWB 5LJ5f 2DNGA 1KLMA 4D3HA 2OTJS 3EFOA 1YP5A 1AEYA 2DH8A 3H2UB 3KG4A 2FJVA 4J9FA 1VQ6T 5IAYA 4OX7A 3PRVA 5D0RA 3CMET 4M5HA 2KMTA 1TMMA 3TU4K 5L9NA 2HMIA 2EK6A 3M4YA 1RACB 3BKFA 4R25A 2VQFJ 3H25A 4LFBF 1OQ3A 2Y4XA 1UVMA 2NCKL 4HVUA 1Q86C 2QA4G 5FU6B 4PLLA 2EBGA 4MK8A 3RRKA 4I69A 2Y1RI 4LSLB 4TU7A 4F67A 1D9FA 5AXMA 3OYCA 2R8HA 2C22A 2OUGA 4YTLA 3UATA 4YR0A 3IG1A 2GX8A 3KHGA 2CQPA 3EGNA 2A36A 2HWHA 5IT0A 3UNGC 4LF9F 2AYEA 4Q2MA 3M0SA 1LOJA 3PX6A 2MY7A 2VG6B 3MPVA 5A2QE 1O75A 2NUUG 1VS3A 2YRCA 2R2UA 2K3YA 2BKPA 3MHXA 3OJSA 5GADI 1JQGA 3QMQA 1FVSA 1JNZB 1IZ6A 4RG8A 3J81U 1X2KA 1AA1B 5AJ3J 4CLKA 2FYXA 2Z2ZA 2WVDA 2LT4A 3EGZA 1FK9A 3FEOA 1ZBTA 3HRSA 2KTQA 4LR9A 3OYIA 1DLOA 2JH3A 5DJBA 1NJIT 3IWNC 3EICA 3VV0A 3J80Y 3ENWA 2DTHA 4JZ4A 2KDSA 3G82A 1PD0A 4WWSA 2VPXB 1RWVB 2E1PA 1IKYB 1WLPB 4C3MA 2F1FA 4EYIB 2QQRA 2IMOA 2SXLA 3PIOQ 1UFKA 1I8FA 4PJOE 2CPFA 5J1EB 1NZ9A 5KFIA 3DRPB 4DJBA 3V6JA 3N6LA 4O0IA 1FERA 3CCUQ 3C6UA 1S1TB 2OTJA 2BABA 1T95A 1I5OB 4L5GA 5IM0B 1N33F 4M7AA 4QQGA 2PTKA 5L8RE 3DLLA 1Y3JA 1AOJA 2DB1A 2RHIA 3HSGA 2GTJA 4C5IA 4DR6J 5CCMA 3WVEB 2LNHB 3L7UA 4NLSA 3DMJB 1Q82T 3PIPA 4AXIA 1TH7A 4ES1A 1K9AA 3VAMA 2ZH8A 5HVGA 4C0OC 5HMWA 2IIMA 1L3KA 2AJ1A 3UD4P 2QLBB 1WFWA 2EQMA 1YBAA 4ECSA 2OPRA 1QLYA 1N5YA 3QWPA 2RI3A 1T0HA 2DEIA 1AWJA 1YHQA 2QFIA 2VZ9A 3OXLA 5EG2A 3G8QA 3ADAC 4U95A 4JI5F 4LRBA 4ZLPA 5L38A 2D3ZA 3Q1JA 3TJAA 1S6PB 2DIQA 3H0IA 2H48B 5K5MA 2V8GA 3C2PA 3EHQA 1M1GA 2AKWB 4JV5J 7AT1B 5GANj 1FXRA 3EGWB 5HJYA 1J3TA 2PA3A 1RT1B 4M78A 1BC6A 3CEYA 2DGQA 3M8PA 1WDDA 2EYYA 6FD1A 1NDPA 3OQ2A 2HHUA 2DL5A 1YSJA 2RS8A 3DDKA 5LMUJ 4B9SA 2CJ9A 3K5OA 3ITHB 3CCRQ 4JI4J 3MEGB 1SKUB 3QPIA 3SSRA 3DN9A 2VG7A 1SPKA 4JBCA 5I3QA 2AD9A 1H8KA 1HMVA 3LW5E 1CS4B 1W26A 3Q2TC 4BWJA 3UR3C 3RJMB 1M90U 2RUSA 3WIVA 2JM9A 2P4TA 4ZVGA 4KKOA 1F5CA 3MF5A 2HQGA 3M8RA 1JLCA 3WX8A 1WF1A 3CWJA 1FEEA 2MPUA 3HHKA 5IHIA 4Y2KA 2OEJA 3DDNA 3NGKA 3C16B 3LGLA 5CZVA 1X4CA 2R5MA 3G6VA 2OI2A 4F3OA 5KYYB 4A8KA 4DQSA 4UOGA 3OA6A 5MAOA 1BIAA 2CVIA 3SV4A 4HL9A 1D3BB 2CNOB 3OBYA 3CMEQ 3HFZB 3MUVP 1PGZA 2R3VA 4QU6A 5KFKA 1NPKA 2ROTA 4JDSA 3I9ZA 3JB9F 3D0GE 1TWBA 2EKOA 4WKRA 1UP1A 1VQ8Q 5EWFA 2NXEA 2QGFB 2DNZA 2P9EA 1YJWT 2HQIA 3FEXB 2FJEB 2H4YB 3KLGB 3KHRA 3EG9B 2CS7A 2CJBA 3DGPB 3IO1A 4DN0A 3E19A 1MMGA 3KDNA 3VYHB 3GJQB 1RA7A 5EN1A 2XICA 3PHTA 1NKEA 1Q7LB 4F4AA 5C42A 2CZ0B 3R1LA 1YJTA 4YEAA 2ZBIA 4P7TA 4EWTA 2QGGA 2OPSA 2DK3A 1SL1A 5FDLB 3VRYA 5D6GA 1FX7A 2Z4PA 4B9WA 1JJ2A 1E6VB 3KK3B 3G96A 2L3PA 2AEFA 5KYNA 1ZETA 4DEYA 3GB0A 1DURA 4WPAA 4G1PA 5JVGQ 1YKWA 3I56A 3HRTA 1CJUA 4IDKA 4F7UF 4FKXA 4GKJJ 1SSFA 1O9SA 1LWEA 2NPFA 3CTRA 3TJ8A 4M7DD 1IQTA 2BMBA 3LAMA 2YUOA 3JTOA 1GRIA 1UL3A 2XTJP 3MJXA 1HBUB 4HT8A 4WYWA 4M75C 3G4SQ 4E7SA 4OZ1A 2ZFHA 2M9UA 3TVYA 3AA9A 2EYWA 3FKBA 3KXTA 5HN0A 3CMES 2H1YA 5GAMg 1UFLA 1VQ6S 4PYDA 3DI6A 1Q7YU 2G1HA 2U2FA 4KY3A 2BZ2A 4DF8A 2DISA 4NCAA 4A4GA 5LSRA 2MK5A 2HRYA 2WOMA 2RJDA 2DD4A 2AEJA 1S6OA 2RQCA 1D0YA 2HNZA 3M0QA 4XTWA 1AVZC 1RT5B 4NXMJ 1K73R 2H9ZA 4CLPA 1M90R 1T9VA 1NH7A 2B6AA 1HYSA 1ZS6A 1CQMA 2CUBA 1S7IA 1Y96B 3OVBA 1QSSA 4K11A 1PNJA 3SFUA 3DRXA 1UWBB 2HQ3A 4OZNA 3H40A 2ROEA 3NGUA 4RUCA 1O51A 5KFTA 1FEHA 5FJ4A 1UHFA 4M7DE 2CNLB 2PZ1A 4A46A 4IURA 2VUGA 4A47A 2XK0A 2PVOB 1N8RR 4BHQA 3M5AA 1GNKA 4A63B 2GGPA 4OQJA 1U48A 1CG2A 2C2RA 5F0WA 4WE1B 5J1PA 3FDRA 3OYHA 3KNAA 1HBOB 4IFVB 3B82A 2RT3A 2WAQD 1U6BA 4PG4A 4ZIWA 1MW7A 5K14A 3KKFA 3MEVA 3ISZA 3VHQA 1CJKB 2COLA 4KUDK 4UOFA 2CSIA 3CC7A 1RISA 2JVVA 4M77F 2LX7A 5IHKA 2RU3A 4JI8F 5CO7A 4OHYA 1NBEB 1S1VB 2CQ2A 3MECB 2LVMA 5EWEA 3GMGA 3VGUA 4M5KA 4FYYB 5CCLA 3H98A 3OL6A 1N88A 5J1NA 1PBAA 2R7WA 3GLXA 2DNNA 4RJVA 3P49B 3FJPA 3EG0A 1HNWF 2N7YA 2KG0A 2HD0A 1QSYA 6AT1B 4DFPA 2AKKA 1QY7A 2CQGA 1UJ4A 3EGXB 4DQ2A 3L09A 4RLEA 4RNNA 2WACA 3CUNA 4M75F 1YJ9A 3SSQA 5HANA 2APOA 1X75C 2MWPA 1WHXA 3RW7A 2HEQA 3OYYA 4XTUA 5DZ7A 4DR4F 2W0ZA 2HGLA 2BM1A 1YJVA 1S5ZA 1IXKA 2VFUA 4Q7AA 4O23A 2IM2A 4C8NA 2RPNA 4NLWA 3AH6A 3JB9D 1M8VA 4KHRA 4FIBA 1X6OA 2X3WD 2QTXA 1FCAA 4C11A 2ZH3A 1VR6A 1IHVA 1RCOB 1RUWA 2JOQA 2EPIA 4KJIA 3TI0A 1N8RT 1QSLA 3D1QA 2R2SA 1T9WA 1QVPA 2QLFB 3D9BA 1K47A 3TAQA 4FXDA 1HNXJ 1T3NA 3W64A 3GF5A 2QQSA 3QZ8A 3HPWA 3UCUP 1H92A 3EM1A 5L39A 1UJ6A 5L1JA 3OS1A 2RMOA 3CCVA 3CCVT 1Y7PA 4WP8A 2ZH6A 2LCCA 4OI0A 2GGRA 5DLFA 2CPDA 1LW2B 4NOYA 3CJ2A 3OYNA 3A8OB 2BR0A 4LF2A 2HZVA 2I2LA 4JJCA 2D1CA 2KM8C 4LT6A 4OI3A 4QU7A 2VASA 4JI7F 1BQXA 3QSIA 1K1QA 3S6WA 4OYAA 4KRTA 4K4VA 1ZM4A 3A3NB 2BRKA 1J5EJ 2PC6A 4BLGA 3A3OB 5ETLA 3SWNA 4Z89A 2R2RA 4LRAA 3GFHA 4NOHA 1YJNA 2EYZA 2R7VA 5DQGA 1XC9A 1QVGS 3QATA 4Y2CA 4H4OB 3TVZA 2FZGB 1U09A 3N0VA 3TR5A 2ZPFB 3MUMP 1N5QA 3MEEA 4IIMA 4DBRA 1U02A 4KUIA 3L2QA 2AIRB 5KAKA 3HFKA 3T5LA 3GYGA 4PJOF 4ECZA 3A8KA 5C24B 3C66A 2FEIA 3ENQA 2J06A 3EH2A 4DSKA 2QQBA 4A8SA 3H9NA 2NR0A 4Q8EA 3CBPA 2BUDA 3ISNC 2QL5B 1Z2ZA 2IYIA 2JNGA 3HSDA 2FC8A 4DV4J 5KFNA 4ZA1A 3S3OA 4CLSA 5J2MB 2NLWA 5CQXA 1KQ2A 2H3EB 1JLFA 1S4EA 2DH7A 3SV3A 2DK2A 2BZYA 1F2GA 2R5AA 4L73A 4RW6A 3OMGA 4ZP8A 4WFZA 4ZCLA 4OVAA 1HHQA 4HACA 3KOAA 2G13A 5FD1A 3HSBA 2ASJA 4P52A 3OYGA 4MFBB 3JCMc 2IVYA 3M32B 3CD6S 2E3HA 3VCDA 5DQHA 3TUIC 1SIZA 4ZVTB 4UY85 3S3NA 1OYXA 3TUPA 2BEFA 2LXFA 3ET6B 2NS1B 3ILLA 1D1CA 2J6TA 3US5A 1R6VA 1ZZFA 4ED5A 1K76A 2HSEB 2SEMA 5F8LA 2EWNA 2M16A 4PG7A 4C0FA 2A1BA 1VQOQ 1EQMA 1GTEA 1K73T 4DQPA 1JLAB 1WOPA 1WZOA 2K2VA 1FDDA 5D6WA 1ZOTA 1SKWA 1X27A 1S12A 2BBEA 2V26A 2W9BB 4PXDA 5AE3A 4UZCA 1RBOB 3FUYA 1U0SA 2P9CA 1KS2A 1U2FA 1VMBA 3X28B 1PCXA 3A8EA 4J9DA 4HHHA 1YWXA 3LGFA 2DVEA 3A1PA 3BGRA 3HKSA 3BFMA 4OMNA 2FRWA 2DRAA 2FHKA 3KTQA 4M95A 3TUJC 4DV4F 3ZZ0A 3MTKA 1HW9A 1AXQA 3PTWA 1VQ6Q 5DS7A 3WC2A 2DNUA 1QAXA 3ZC4A 3M8QB 4ZVHA 4EIKA 1OI1A 1MV3A 1X69A 2IBOA 1DQAA 2GAGC 4F8RA 5GMKj 5LXYA 2F2VA 4WTYA 2AGPA 2IJRA 2BKDN 4X4NA 2J6UA 1GCPA 1KFZA 3DRSB 3TA2A 4NXNJ 4ECQA 3JCMe 1WNEA 3NS5A 1FF2A 1BHNA 1BI0A 1BE4A 1AT1B 1REVB 3SEOA 5GAOm 2YNHB 1SH0A 1MU2B 4F4YA 4A53A 4ZS6A 2ZHOA 1D0ZA 2DXCA 2UUAJ 4WYLA 3QAEA 2FGOA 2YPYA 3AT1B 3UWNA 1JKHA 4OGEA 4PJLA 1VQLS 2J8SA 1ABOA 1FI4A 2X4JA 1VQ4T 4W4MA 3QSYB 1D9AA 4MKAA 3DGVA 4X65J 3JCMh 3R27A 2HNDA 2K4YA 1MN7A 1NLPC 2XS2A 2OELA 2LCLA 2Y90A 3M6UA 3C46A 1B34B 4LD9K 2C2NA 3W2VA 1QVFP 2M70A 3CXCS 2JVRA 4C0BA 1N8RC 3R5DA 4NLUA 1NM7A 2KRSA 3RB6A 1UWAA 3OVSA 5T7LA 2V34A 4BE1A 2GIFA 4JI0F 4XPEA 2JL9A 3CJ5A 3AOCA 1TUCA 3A8LB 1GTHA 2JT4A 2OMLA 4FNIA 1JB0E 3DYAA 2EW9A 4PJOD 1UGQB 2I1RA 1W2BS 4LIWA 4U7UK 4M7AE 4ED4A 1S72Q 2OFHX 5K14B 3KG0A 4DX7A 2KXFA 4C8QC 5J2PB 2V4JA 2F5GA 2RDJA 4IUVA 1U8RA 3P8DA 4OI2A 4K59A 3SWNC 1S79A 5LJ5d 3JB9H 5B0DA 3META 4DV3J 2B5JB 4KH1B 2MGZB 1C1AA 2E7XA 5E3RA 3QO3A 1G5VA 5KFHA 2YNGA 2LMJA 2KZMA 5KFAA 2RB6A 2HMAA 3HFNA 3CCLT 2ENMA 3V5RA 5HP1B 2F8HA 2BQ3A 3NOCA 3J81E 3U1LA 3TO8A 1T7PA 3OT9A 3PYGA 1EX8A 4QWEA 4JJDA 4ELYC 3G87A 5ITHA 1RTDA 4Y3CA 4DR5F 3IP0A 5A2QU 1RHMB 2WOMB 2WONB 5IXFA 2B9WA 3MM8A 2DAQA 4NLXA 5DG9A 5F9NA 3RKWA 4OMQA 1FRXA 2WSFE 1CULA 2UXBJ 4ICLB 2DL3A 4F0KA 3M0RA 2BE9B 4DQIA 2RSQA 1CJTB 3G71T 4NZ0A 4M5DA 3H4DA 1IBLJ 2YUQA 4URQU 3B78A 1N34J 4DFKA 3CC2S 2DJZA 2EFOA 2HKNA 4F2RA 2RQTA 2BANB 1APSA 3EFSA 2OAUA 3EMTA 3CBOA 1YITS 3DCAA 1Y00A 2UV8G 2UUCF 3MM7B 1J5EF 3ZNUA 3CBMA 1BGXT 1FYNA 3AODA 2C28A 1RTZA 4USJC 1VQ5A 1WYXA 1VQ5T 3G6EA 2HBQB 4F3QA 2I5JA 1YNZA 3PTAA 3QFHA 1Z4UA 1IRXA 1VQKT 3LLRA 3PIOA 5J2NA 3LPYA 3CCEA 2HBYB 3CCUT 4X66J 2ABLA 3S6EA 2VFVA 1FRKA 5A8RA 1QVFA 4PWDA 2QEXQ 1ZAWA 2E1MC 4O44A 1H74A 3VUBA 4NLQA 3BEGB 2FHMA 1R8PA 1N5TA 1UZDA 4FF2A 2NUTA 4DUYF 3VZHA 1Q4RA 4XU3A 3LP1B 1LWFA 1SJQA 3C95A 1Y9OA 4ATOA 1FX2A 2FLPA 2XLIA 5J2PA 1IBLF 2DEJA 3C6TA 1D8ZA 2MZTA 2XGPA 5CQYA 4C0DB 1N5YB 1HJDA 5GANf 1S1WB 2AWZA 3R5BA 4CNYA 4MTPA 1JWWA 1ARKA 1S59A 1TOVA 2V63A 4KT0C 2UUCJ 5CD4A 4JLIA 3GSDA 2NXCA 3BW1A 4CIOA 3PJ9A 1TV6A 2V6AA 1HYOA 3P8HA 3JCMX 3VAGA 5HY6A 3PW5A 3QRQA 4ETZA 4PXEA 4B9MA 3W5XA 2HBZB 4DU8A 4DL0C 4LBPA 1Q53A 2R7OA 5H9FJ 1KLNA 1R0BG 4JYAF 2CQDA 1JLAA 2CQ4A 4X4SA 2YPZA 2IVWA 2DITA 3OLAA 3VZIA 3W66A 2IY5B 4C4WA 4ETXA 3QLHA 3SHWA 3W2WB 4ED8A 3CMAT 4IOCQ 2XDDA 3OYLA 2ZBCA 2V9KA 2O9VA 1G3WA 1U1RA 2BV3A 1WC0A 2IM3A 3TQEA 1KQ1A 5BYSA 2E9ZA 3NRBA 2G0CA 2MOXA 1K8AU 2RQUA 1JLQA 2DHSA 4ZMMA 2VL1A 1M1KU 1UCNA 3Q89A 3R5AA 4ZIVA 3NGTA 3FDSA 1YJ9Q 4O3SA 1XQIA 2KROA 1RWKB 3RERA 5ETOA 1WA7A 4B9VA 2OTLS 2QMWA 4E98A 3ITHA 2HS4A 1SI9A 4QR0A 5CZXA 3OFEA 4Z88A 3CF5Q 1UHCA 4M78G 4NLOA 4X64F 4IUFA 1QMCA 4NRTA 1RZMA 2DL8A 1JLEB 1Q8BA 1VQNT 4RW4B 2WK4A 4O3PA 4CWBA 2R7TA 2CP7A 4H54A 4M7AF 1ZBXA 4M7AC 1QD1A 4GVBB 2JEIA 2J6OA 5KCOA 3SEMA 2CRLA 2C0TA 4ZJLA 4CC2A 1D3WA 2L3QA 3HJFA 3QAUA 1DQ9A 5CAIA 1SUQA 5FIIA 4QOTA 3LP2A 1H641 3KUFA 1G8XA 3TYTA 2ZJPQ 2ZBQA 2KRMA 3MPYA 2Y9HA 3N5BA 1Q81C 4NCGA 5LT5A 1JJ4A 5M2PA 1NPRA 2HAIA 3JQMA 1BIBA 2VYTA 4X62F 1YJUA 4ZPTR 1TL7B 4QWCA 4LSNB 2OPPB 3I6PA 4U67Q 4IFVA 3KLIA 3K17A 3CJKB 4GVLA 4CYUB 1U26A 2DR9A 3UVJB 3MMJA 2XO6A 2XHCA 4A8MP 2GV1A 1OOTA 3TOQA 2X4WA 3ASKA 3T5JA 5KFFA 1U8SA 2QTWA 2MWOA 2E41A 3M2RB 1YTYA 1HARA 3BE3A 1UA0A 2CKKA 2GQCA 1RLDA 2C2ZB 3R3TA 3NGSA 4ZHRB 4ZJQA 2MCNA 1IXDA 1HQEB 4DR6F 4OYPA 3R2DJ 2DT9A 1TVRB 2DNHA 2R8KA 3DC2A 2KYBA 2RS2A 2NPIA 4K4ZA 3CCLS 5AXLA 1KQSR 4Y28E 1HNIB 5AE1A 1S99A 2A3LA 3DRRB 2K6DA 4FT2A 3H8YA 2PFDA 1T3OA 2AHJB 1HKAA 1VK8A 2ZOFA 1SEMA 2VPZB 4X4OA 2RHQB 1M8MA 2CP5A 3IMQJ 3BS9A 2PMWA 1K9MU 1XMBA 1N5SA 5IQQA 2Z0GA 2JC0A 1Q8IA 3D66A 2Z8QA 3IM9A 4LF6F 2ILZA 4M77C 8RUCA 2K7AA 3EGXA 4QW2A 4USMA 1HR0F 5KYWB 2DVIA 1WORA 2VBYA 1REGX 3FK4A 4JI2F 1P92A 2AU0A 2D69A 2DO4A 1G7CB 3HZEA 1LNQA 1UPMB 2K3BA 4WF9Q 3HM9A 4C8QA 3V8KA 2E29A 2I6WA 4Z8AA 2RJFA 3J7Z5 4QYZK 2AYMA 2RD5C 2AHOB 3MEKA 2Y1LB 2OSQA 1T03B 2HEKA 3H5YA 2V68A 2RVJA 2DEQA 2L08A 1YG0A 3EDRB 3RESA 2K3XA 1TUVA 4I64A 1VIFA 2HQHA 2G1DA 1AUSL 5E3QA 1YFNA 1KD1U 3QDFA 4PXCA 3NGRA 5DM7R 4I67A 2BE2A 3MP1A 3HDSA 1MWQA 1Y71A 3FQKA 1C0TA 1VQ7T 1AB8A 1S0NA 1JLEA 4DQQA 2UUWA 1G3TA 2DY1A 3WDOA 1WQWA 2HFUA 4MIAA 2QASA 2OD4A 2WRMA 4O3OA 2C3YA 5GJVB 4J83A 4MFBA 2P4RA 3QRPA 8ATCB 4USWA 3OHAA 3NMAA 4IUUA 4C5HA 1X4HA 2W01A 2VBWA 3HL8A 3LP0A 3GFZA 3GV7B 4MK9A 5C7PA 1B7FA 4DV6F 1UTAA 1HR0J 2NWMA 2V9WA 1KK7A 4OJHA 4PFPA 1Y5NB 2KYMA 4C92E 2X9HA 2DZCA 4F17A 4JS4A 5L8RC 1PYTA 2P6SA 2M9KA 4X1VA 2AW0A 2PN6A 2R8JA 3OTCA 5CKHA 1EJ7L 4E7JA 4B3SJ 2LU2A 4LBHA 3IA0A 2RD1A 2CDRB 2QL9B 1EQ0A 2C3PA 2ROGA 4UUWA 1UVNA 1RTIA 1IN0A 1FKOA 4KGMA 3BREA 3CCES 2JC1A 5FLXU 4F4WA 3CCMQ 3H90A 4YMEA 4XTTA 2VQEJ 3PR4A 1Q1KA 2ASYA 1OY9A 4ZLJA 1V3SA 1VBKA 4QYZJ 2YKQA 2GZOA 3MR2A 2UVWA 5T41A 1KD1R 1B4SA 2G2YA 2K9GA 1GX5A 1U1QA 1N32F 2BDPA 5CYQA 5A0LA 2IVFB 4IH7A 1VQ9S 4NLRA 5KT4A 1XR5A 2BW2A 2NSCA 1RT7A 1LWXA 2D0QB 2YX4A 5B0AA 3MAQA 4ER8A 1UA1A 1HBOA 1RSCA 1PYOB 2YKNB 1UJ5A 1QAJA 2GBQA 2CIMA 4FSXA 1FKAF 1SVDA 3ILOA 3ER0A 4J37A 1D1BA 4B9TA 4C8YA 3PX4A 4XTYA 1UAWA 4DR3J 5HQLA 3HHLC 4DX5A 1V9OA 4P5NA 4XDDA 3I0RB 4A8OA 4TNOA 2F65A 3HULA 1NNDA 2IHR1 5GAMd 3IS9A 4BD3A 3EG2A 4RUGA 1LOUA 2RRNA 4Q45A 2CP0A 4LF8J 2DXBA 2NLUA 1X60A 3L2RA 4OJGA 3PW0A 5D0GA 1K9MR 2K1RB 3OXFA 4BI3A 3SCKE 3ETOA 4XU2A 5AE2A 1PSDA 2W9CB 4O0NA 3MMAB 3EHRA 1YX2A 3QKJA 3JYTB 1WD6A 5GMKa 1Y4ZB 3X3UA 2J7KA 3DOMB 1TZ0A 3I4PA 2K5FA 4YN3B 2BZ8A 5ETNA 1IR0A 2BE2B 1CVJA 4DV5F 3D4JA 4ECXA 2AF6A 1Y7XA 3EDQB 4DX8H 5DO2A 4URSA 1IVZA 3JCMg 3EX7B 4HT9A 4LUBA 1HBUA 1JKHB 3GYNA 4IRCA 3NOGA 3GV8B 2COYA 4WFNQ 4GLKA 3CO0P 3ONQA 5GAMh 1LWEB 1H7XA 5CYQB 2QDLA 1VRUB 3Q22A 4Y2MA 1K8AC 2DHGA 3H0HA 4D3GA 2DGXA 5HP1A 4TXSA 3F0NA 1MNEA 4BE0A 1LKZA 2GJ2A 3MEDB 2W2MP 4H4KA 4ZVEA 2JXBA 1Y07A 1FJGJ 2JDJA 1Y3KA 2DR8A 3OS0A 3FSXA 1L3VA 3BDEA 2M8HA 3M55A 3D3BJ 1NAQA 1RADB 1WDXA 3N28A 2IRYA 1VQ8T 4J6WA 2HKEA 5M2UA 1CBKA 4MT1A 2YUPA 2JRSA 3JB9k 3X25B 1BKBA 3RUXA 3HHDA 3K2YA 3KFWX 2Z0WA 2M0GB 1HHSA 2E5JA 3LQVA 3QGIA 2MF2A 3OR1B 1EHWA 1N56A 4LRFA 1TFYA 1KQSS 3UE2A 4DS4A 2A18A 4NMXA 4MZMA 1S76D 2CADA 1HI1A 4OZJA 1CKAA 5J2NB 4IOBA 3MO8A 2DO3A 2GHWA 5I11A 2ZPGB 1LW0A 1Q78A 2CJAA 2CQBA 3NG8A 2XSFA 4OJ3A 4XPCA 1HNZJ 4O3RA 1QLNA 1EB0A 4Y92A 2G2ZA 3D7SB 4M8LA 1X5TA 3MM5A 1J5OA 1R89A 3T9NA 1DJ7B 4M94A 1S1UB 2KRBA 1VIOA 1RT4B 5C25B 1U3OA 4L6V5 4K5RA 1DQ8A 5AT1B 5HMYA 4Q44A 4Q0BB 4CTAA 1S72S 4JUVA 2PEBA 1QW1A 3R5GA 2FPEA 2O01C 3FBEA 3SQGA 1VQLT 1WJSA 1AW0A 4YDDB 4X4PA 2CJYB 3VVTA 5GMKh 2G4BA 5H9FK 1NJIU 3IN5A 2DKGA 1YJRA 3X1LB 2HHWA 2DNRA 3SQGB 4YY3J 4M7DC 3P5BP 2V8HA 2HWIA 5LJ3Y 4LFCF 1Q79A 3G6EQ 1HNZF 4MYUA 5FROA 3CCRA 4M78D 2RA2A 4GBQA 5GADU 4ZVSB 1B3QA 1BXNA 1BWEA 1E7OA 2DR7A 4CC4B 4Z2XA 3T1HJ