2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
1VQ7A 3J7AF 3CCRA 3CPWS 5DM7R 1W2BA 3CC2T 1YJ9A 1Q82C 1VQ6A 2EXUA 2OTJT 1K9MU 1YJ9T 3G4SA 2JVVA 2KDSA 3OYYA 5IAYA 3CXCS 2LVMA 1YIJA 3CCMA 2OTJA 1VQ6T 1RL2A 2EIFA 1KQSS 2MI6A 1YIJT 3HKSA 1YI2T 1M90U 3CC4A 1N8RU 1VQKA 1K8AC 3QQCD 5FLXE 3JAME 3LPEA 1VQ4T 1NPRA 3PIPA 1YHQT 3G71A 1VQPA 1Q86U 5DLQE 3CCEA 1JJ2S 1K9MC 1Q86C 1VQLT 2KVQG 3I56T 1S72T 1NZ9A 3I55T 3CCQT 3CCUT 5IT9E 1K73U 3CD6A 2E70A 3CCQA 1IZ6A 1K73C 3CPWA 2OTLA 2QA4T 3CCJT 3CCVT 1QVGS 2LCLA 1VQ5A 2JUFA 3CD6T 2DO3A 1N8RC 4CRIA 3DB3A 3CCVA 1VQOA 3CCST 1YHQA 3CCET 1VQ4A 1KQSA 1YITA 1UEBA 3A5ZB 2OUGA 1VQLA 2L3RA 3J80E 5HY6A 1VQ8T 3CCUA 1KC8U 1S72A 3KBGA 5A2QE 1YJNA 3G71T 3TREA 1YI2A 1VQNT 2QEXA 3LH0A 3CPFA 3CCMT 3G6ET 3CMEA 3CC7T 3LGFA 5J26A 3CMET 3CMAT 2E6ZA 2G3RA 1JJ2A 1NZ8A 3CMAA 1KD1C 1K8AU 3CCRT 1VQKT 1M1KU 3G4ST 3P8BB 3DB4A 3CXCA 5LL6S 3EWGA 1M1GA 1KC8C 1KD1U 4X34A 1VQ8A 3H7HB 1XTDA 2MWOA 1Q81U 1YBYA 3CC2A 1YJNT 2LQ8A 1Q7YU 1Q82U 2QEXT 4QQDA 3CC7A 1YJWT 1KHIA 2JNGA 3G6EA 1VQNA 1VQMT 2K06A 1XNIA 1EIFA 1VQOT 1M1KC 3ER0A 1VQ7T 1X6OA 1QVFS 1QVFA 3CCSA 4ZN1A 2QA4A 1YITT 1VQ5T 1VQ9T 3CCLA 1Q7YC 3J81E 4TVRA 1W2BS 3CCLT 1VQ9A 1Q81C 2IG0A 3DLLA 1BKBA 2JOYA 2CKKA 1NPPA 2MWPA 4ZN3A 3I55A 3OW2A 1M90C 1QVGA 1VQMA 1SSFA 1NJIC 1YJWA 3PIOA 2XHCA 3CCJA 2OTLT 3I56A 1M1HA 3LGLA 3OW2S 1NJIU 4YTLA 3CC4T 1VQPT 4RG2A 5J3BA
chains in the Genus database with same CATH superfamily
2XMJA 2WRMA 2OTLS 3FNNA 1WD6A 3WVEB 3I0RB 5M2PA 2C22A 4X4NA 3LGMA 1M90R 2OPRB 1HWJA 3SWNB 1KHVA 3GU0A 2L0AA 2G0JA 3DRSA 1VQPS 4AQYF 1U45A 1AZSB 2G4BA 5J2NA 2JOQA 2EGEA 3CCRS 3C14B 3PYGA 3VCDA 1Z9QA 2DO3A 3CJ2A 4B3MJ 1RT7A 2DIUA 3FBEA 3OR2B 4WCIA 1HWUA 3NCQA 3K59A 2NSCA 5DLGA 4EMHA 2BJDA 4OMQA 4QR2A 2GGPA 4U96A 1SJ4P 4DQ2A 2JZ5A 4K5SA 2ZKTA 3HHLD 3VGTA 2RI5A 1D09B 3QYYA 3W2WA 1NDLA 1BQMA 2EFPA 1APSA 5IQ6A 4F4KA 2OTJS 1WHLA 4DSFA 4DR7J 4J7CA 3MM7B 3I9QA 1BWVA 4P52A 5DS7A 2UXBJ 4E6RA 4OZ1A 1IBMF 4C48A 1CVJA 2RB6A 3CCLA 3MEUA 3ZZRA 1XNRF 2J9DA 4M75C 3J81E 4ECZA 2JM9A 5KFZA 2XLKA 2QL7B 3OW2A 4QVZA 5LJ3d 3VTIA 3VS1A 3EHRA 4OI2A 4F67A 2GHPA 2ZE2B 1D3BB 1UZDA 2QQRA 2CRLA 3KHHA 5CAAA 4F0HA 5KYUA 1YKWA 3A3PB 4AMCA 2IJFA 5FWBA 1J5OA 1UJ5A 4RTXA 3HKWA 4DL7A 3PY8A 2XSJA 4MIBA 1WJSA 1VYUA 2IA0A 3QJ6A 4ZVFA 1WELA 4IFVA 1K8AC 1FRIA 4W90B 2CQ1A 4LF7F 1VQ4T 1T11A 2VG5B 3PO5A 4C5HA 4F04B 4RW6B 5KG6A 1TR0A 3V4MA 1C4CA 3QIPA 3JAMU 1WIEA 4OI4A 5CD4H 4KH0B 1CJVB 4JPBW 1KC8U 3MM8A 1WNEA 3P8DA 3TJ9A 1L3VA 2KSSA 3G71T 1S49A 3NOGA 1N34J 1T94A 4IOAQ 5LJ5d 5AXKA 5F8LA 2BJEA 1DFDA 5FU6C 3P3DA 5LOQA 4FL6A 1SIWB 2FJWA 1KLMA 3IFEA 2XMTA 5J1PA 3N28A 4M75B 3GIBA 1GXLA 1KLNA 3R5JB 2AJ0A 1WI6A 4NL3A 1JLQA 1NKBA 3IM9A 3FRNA 5DZ6A 3TVYA 1RWKB 1FYNA 3OTOJ 2OJ2A 5LSOA 1U2FA 3T1HJ 3RAMA 2OSRA 1M90T 2XQCA 4Y92A 5D0GA 1ZBTA 4RW8B 2RHZA 2XY7A 2LFVA 3ET6B 4WFBQ 4C92G 1GMWA 1Q5VA 2KRSA 3CBMA 5F8HA 4IOCQ 2E5KA 2DZCA 4I7FB 3MEVA 3OS1A 4ZCMA 4F7UF 4P74A 2G2YA 2PQWA 2X1AA 1WI7A 1O6XA 3W9HA 1HBNA 3R9LA 4Y3CA 4YDDB 3G96A 1QVFP 4C8OA 1OZ2A 2LDIA 3A13A 1K73U 5D0EA 2GNCA 2YNGA 2VFRA 2AGPA 3JCMX 3J80Y 4DSLA 1WHHA 1MW7A 1VQ4A 5A8KB 4OYOA 2IFXA 3M2UA 2CP0A 2MY8A 3CMAQ 3S3MA 3V6JA 4XU1A 1C1BB 5AE3A 1LWEA 3DN9A 4ES2A 4QIFA 5GJWB 4C4WA 1AWWA 3NS5A 2RU3A 5CQXA 2GVDB 3LANA 2W9CA 1O0PA 1YJNT 4PJLA 2YQ1A 1VC0A 2N3LA 4ERDA 2KU7A 1EP4B 2YNFA 3L09A 4O3PA 3OYEA 2HNYB 3CCLT 1S1WA 4KT0C 1ZM2A 1HNXF 4ZVSB 3NAHA 3UA6A 1S1TA 2W2QP 4DL6A 1R89A 4JRPA 3JSYA 2CP7A 4LNPA 1HBUB 1IHVA 2DTIA 1RT1A 1Z2ZA 4WYWA 4OMFG 4M7AC 1K9MU 1P1TA 5KFVA 2VQEF 3IBWA 1T95A 1ZPWX 2JZ2A 4OHWA 3P96A 2NZ4A 1MWYA 2ZCFB 3ELHA 3PX0A 4RPFA 2JVVA 5M9OA 4KC5A 2L48A 4HKQA 1HK9A 3JTNA 5IV3A 2QAZA 2HFVA 4DHVA 3SFGA 4E47A 4L6V3 4JI6J 4LFBJ 3URGA 1H2TZ 1HHSA 4DX8H 4DI6A 5GAN5 2GHWA 4RTUA 2V2VA 2DPPB 4Q2MA 4NOYA 1OY6A 4LF4J 1ZUYA 1IM4A 3OBYA 4OHZA 3U7JA 1VQOS 3M9MB 1WEXA 3VAJA 4DQPA 1VQNT 2V9WA 1S79A 1ABQA 3HPOA 3PNWC 4M7AA 2COLA 3RGIA 4M78A 2KG1A 1TUVA 2EYQA 4M7DB 3KG4A 1JKHB 3QO9B 5CCAA 2JNGA 4USTA 5GAN4 1U8SA 1PC4A 2XO7A 4M7DA 4Y2MA 1WSRA 1NDKA 3V5RA 4N41A 4XTTA 1HW9A 4F3MA 2RN8A 2PC6A 3P6YC 1YQHA 2DYBA 4A4KA 1JXVA 4ECRA 1UVLA 3CB4A 5L23A 4JI4J 1PG5B 2NPIA 3OMCA 3EGNA 2O01C 1P27B 3DRRA 4F14A 2DF6A 5HLFB 2OTJT 2H4WB 1WDTA 4M78F 2QC3A 1T8EA 3QGPA 2CREA 3GP9A 3HJVA 3MFIA 1FERA 2ZNZA 5CHCB 2OD6A 3CJKB 1X2KA 1S6PB 5E3AA 3T5HA 1BYMA 5J2QA 5A8RA 4A8KA 2K2VA 2JTEA 5I42B 5GANd 3F70A 3HXMA 1U1OA 2FPHX 1NHVA 4DPUA 3VGVA 1LJOA 1FKPB 2J6UA 4WXOA 5HP1A 2DR9A 3NGPA 3UI3A 1YJWQ 2FEIA 1K8AT 1OJ4A 1SV5B 3CE8A 8RUCA 1DHMA 4MMOA 4RZRA 2K6DA 2KYZA 4JI8F 5IWAF 4QYRA 4QWCA 5D4PA 4MKYA 3US5A 3TEEA 1WXBA 3B6BA 1PWTA 2LNVA 4PWWA 3F41A 1QLNA 2AK5A 2J0SD 3UN2A 1Y00A 4MDXA 1QAJA 1VQ8Q 2IHR1 3DLLQ 2OELA 1FWKA 2NXEA 3CCJA 3R1LA 2Y3YA 4G1QA 3NPFA 2MKSA 2E7VA 3RBDA 2I6WA 4LF4F 1J2VA 2HQ3A 5GAMf 2ZH3A 4LF9J 1TFWA 2OLWA 5HN0A 4OZJA 3BKFA 4DCJB 1OQ3A 4XAKA 1X4FA 2DHHA 4ED3A 4DOWA 1RTJB 3EZOA 1FA0A 3CW2C 1VLOA 1VQ6Q 3R27A 3J7YI 1T0JA 4ECVA 4UQGA 4CLTA 4Y28C 5ADZA 4DR1J 4LD9K 3QUIA 2B3TB 1UGQB 3VUBA 3GBQA 3NNCA 4LVOP 3X25B 4NZ6A 1RAOA 2EFVA 2CJAA 2QSFA 4MFBB 1H3HA 1KQSA 2D74B 2CJ9A 2PVOB 1FXRA 3OVSA 4P2SA 2DNKA 2JWNA 1OX8A 3CCSS 4IUFA 3HFKA 4FVCA 4V1Ak 2IYIA 4C6AA 5A0DA 5KYYB 2DXDA 5I2SA 4EMDA 2FJAB 2YX1A 2UUCJ 3IR7B 3FB9A 3C12A 1Y57A 3CMEQ 3VZHA 2FHJD 1ITPA 2L41A 3UN3A 4KPCA 3PJWA 4HVUA 3SD4A 4HDHA 3QFHA 2JFKA 2AGOA 1LW2B 2ZH9A 1ZS6A 2GO9A 3N4WA 2VKZG 1S0OA 1AVZC 1IQTA 2EI5A 1SL1A 2Q6BA 1FRMA 4DUYJ 4M95A 2CZ1B 1KOHA 3IS9A 2ZPIB 4KUIA 3H0HA 3HT3A 3PGGA 3H2UB 5LJ3g 2RHQB 2IIMA 2D9OA 4FN5A 4O4RA 3PTWA 2KH9A 1U1TA 3D0HE 1FNMA 3FBBA 3IG1A 4ZHRB 2DD4A 2DJQA 1S72T 4LIRA 4J9HA 4M7AD 3BQ1A 1DQ9A 3UNYA 1VQ7Q 2D3O1 1GT8A 2YKMB 4ZPWR 3VAKA 4QQ6A 4P10A 2MQPA 2YH1A 2DZ9A 3QZ9B 4FKYA 1FX4A 1Q5YA 4I2PA 3I5SA 2LEBA 2CZ7B 2GV1A 2O31A 4B02A 3SCKE 1IWAA 4N7TA 1OEBA 3DLGB 1FESA 4JJNK 2LMIA 1W25A 1U47A 2KZZA 3I55S 2ATCB 1TL1A 4G65A 2XLIA 3FRYA 4EK2A 4OI6A 4JJCA 2HNDA 1Q7YC 4Q44A 4UY85 4CO5A 4I6AA 2CP2A 2RU9A 2K7KA 2QASA 3BR9A 1JEGA 1VQMA 3OBWA 1YJWA 4OZLA 3T5LA 2B6AA 2J0QD 1ZBJA 3W5ZA 1DJ0A 2IY5B 4BC7A 1JJ2P 3E3XA 3MFHA 3KWMA 4MH8A 2B4OA 4PXDA 1WORA 1VQPQ 1JU5C 2DGUA 3K57A 3OTCA 1WJRA 1XMQF 2E5GA 5HSPA 3VJPA 4DV5J 2X1GA 2P84A 3EPIA 1PJ6A 2AIRB 2E10A 4BI8B 1YRXA 2DY1A 3NY0A 1IBMJ 4B9UA 2IRXA 1C4AA 1QSYA 3C6UB 2PE8A 2PMHA 2NZCA 3QT6A 3CCJT 4WK1A 2V6AA 1U2RA 1RE1B 3CCVA 2P4RA 4ELYC 2VC8A 3RBEA 3HRUA 1HWLA 3PRVA 3S3NA 3OW2P 5CH7B 3VQTA 2BZXA 1TL7A 1AW0A 4ECSA 4LUEA 3SCJE 4QQBA 2MEWA 2HVZA 4KGZB 1BQNB 2DH8A 2W4CA 3M6WA 5EUHA 4Q45A 4DV6J 1ZH5A 1MU2A 4DR3J 1FTRA 4N76A 4DCPB 3UQSA 3IQLA 1IR0A 1UA0A 3DI6B 2ZHAA 2UXCJ 3MXHP 2JMCA 1T9WA 3FC9A 3ISNC 2VKNA 1RTDA 2MQLA 2UUAJ 1X7VA 2AX1A 3G6YA 4OP0A 3U1MA 2QA4A 3CCMQ 1LVKA 5BJRA 2LU1A 5I3UB 2WVEA 2GF7A 3UT1A 1T9TA 3N6LA 4E7IA 1S7HA 4P75A 2DVJA 1PKUA 2L5QA 4LSZB 3CF5Q 3EGWB 2BJ3A 3Q86A 1S4FA 1NM2A 2F1FA 3VQSA 4J9PA 4JI2J 4DL2A 3JCMe 1KC8T 1Y3JA 2M51A 2VUGA 4I64A 4DR1F 4KGXB 1WHYA 2LYVA 4FDFA 3PVXA 2EAYA 1RHRB 5EDWA 4TQRA 3I35A 1JXEA 4PL6A 3PIPA 1T0HA 1JLFB 4C5IA 5E0OA 3GOXA 2MSSA 4JRIA 3I56T 2QV6A 4ECQA 1CPZA 3CD6S 3CC4Q 2KJVA 2PZ1A 1RAEB 1AD5A 4CTAA 3CCUS 2OTLQ 3C94A 4RW8A 3CCQS 5K8PA 5I3QA 1KVJA 2DK3A 1FRJA 1VQMS 1XJWB 1LK5A 1SJQA 4DF8A 3EG2A 1I5LA 3PR4A 2J9DE 1HLWA 3SQGB 2F69A 2ZBPA 2ZD1A 4OMPA 3HRSA 1Y07A 4NLWA 4OMNA 1KSPA 3L2WA 2FC9A 1M30A 2JX2A 2BW7A 5E3RA 4CRJA 4N5SA 3CDAA 1KHIA 2HG4A 1X01A 1PRMC 2E9RX 3H25A 2EFIA 2K1RA 3LWMA 2JNJA 4B9MA 2LX9A 2QQSA 5DDRC 2QA4S 1RQ0A 3MTKA 3BYRA 2VJVA 3HP6A 1U02A 4O0NA 4Y34A 2ZM6F 4IIMA 4RG2A 5KFWA 1Q8IA 5GAGU 1OY9A 4Q0BA 1VRUA 1SBRA 2VL1A 1RHMB 1Y71A 3BH6B 5FWCA 1HR0F 1RWWB 2WW4A 5HMWA 4K8RA 5AXNA 3UF4A 1HPZB 4C5GA 2IRYA 4ID5A 4X4RA 4GVBA 4HYKA 3RYLA 1YRUA 3H5XA 3KFWX 2XI9A 1KIKA 1K73C 4OX9J 2QEXQ 2DEQA 3DM2A 5KFOA 2DL3A 2HS0A 3RIRA 4QW8A 2B4UA 2N82B 2DJWA 1RI7A 3FMBA 3FJ5A 2CQCA 1Y5LB 3ZZUA 2MQ8A 1UEUA 1S1XA 4X9DA 1NUEA 1GX6A 5K20B 2J05A 2VFSA 1UJ6A 3QO9A 3BDEA 3OJUA 1H2VZ 4C11B 3GR0A 2HRUA 1R7IA 4Z37A 1S99A 3EVMA 4QOTA 2BXJA 4FS1A 1KVIA 2JTMA 2RB7A 3OYDA 2GBQA 1KTQA 4WFAQ 2CQBA 2Z2ZA 5ETPA 1KEKA 4DOVA 2OO4A 1HNZF 3TSZA 4FYVB 3EICA 3MMAA 2JEGA 2R7VA 4NCGA 4HACA 4ZHRA 3VZIA 3I0SA 4E7SA 1KDNA 1RUSA 1MMGA 1WFWA 1ABOA 3EXYA 5DQGA 4PXCA 1WKKA 1X5OA 3LA0A 3FGVA 1LFWA 1T03A 2MLYA 3HL8A 4QU6A 1WOOA 2EKNA 2FL7A 3TNVA 2OSQA 2GMJA 4O44A 3D3CJ 2KVIA 3CCZA 4RW4A 2CJXB 1QDUB 2J6TA 2QA4T 4E7JA 3GPLA 1LWFB 2RMLA 1YJ9S 5DY9A 2RHIA 2FVSA 2YVSA 2I0NA 2V34A 1AROP 1SF9A 1PAUB 1TFYA 1GFCA 3PFSA 1HJDA 1U1SA 4BHQA 1NK8A 1IKXB 1VQ5Q 2BM0A 4WZMA 1X43A 3OY9A 3NEKA 1X9MA 2QO3A 1NK6A 4KB7A 2CH4A 4EI2A 1H98A 4ILLA 2F2VA 1IKYA 1EHWA 1MMAA 5GAN3 2X1FA 4PKDB 4RUCA 3WX4A 2L3QA 3HFNA 2K3IA 2J8SA 2L3SA 2LXIA 1WI8A 3ILIA 3G87A 4YN3B 2CIMA 2EW9A 2GIRA 1NSAA 2WOMB 2VC0A 2AJ4A 5MLCV 3I56S 2ALYB 3M0UA 3NBPB 2HNIA 2VU5A 4X9CA 3OXGA 1Q79A 1U09A 3TR5A 2UU9F 1YCYA 2B86A 3LWHA 5CR2A 5GANj 4XDCA 2ZH6A 4B9NA 2CJYB 2C06A 3H0IA 5C42B 1YJNS 4F4WA 1RYRA 5DM6Q 1S5ZA 4EZ9A 2LC4A 3R6OA 1MNDA 3Q23A 2DIGA 3PRBA 1FD8A 3CD6T 5GMKa 2VYTA 4C0FA 5C42A 5HI7A 5GAMh 1YITS 2DRBA 5K14B 3SIPB 3MEEB 1NEGA 3H2VE 1QWEA 1OV3A 5KFXA 2JSXA 4O44B 3ILOA 1AWOA 3NKYA 2F9JA 2R2UA 1T3SA 1VIXA 2KXHA 1JLQB 2ZJQQ 1B99A 1I07A 2EPDA 2AEFA 4ELVA 1Y5NB 5KFBA 4ZGEB 2QLFB 4ED0A 1RTIB 2F65A 3ISND 1HKAA 1PD0A 2EKHA 4DBHA 1U1NA 2H5JB 3ZZPA 2VG6A 2IAJA 5C5JA 2ED1A 2FVUA 2Z56B 1TL7B 2O88A 5CKEA 1XIQA 1WC5A 4ZCIA 2X4YA 5E3QA 3CXCR 3OVAA 2DD5A 3HCXA 1XR5A 3GPAA 4FXWA 4FIBA 1OQ6A 1FF2A 4DR6J 1TK8A 4I69A 1VQ9S 4NZ0A 4Q8EA 4C92B 2E5QA 3G82A 3V6DA 3LAKA 2OPQB 3PZPA 2DM1A 3CCQT 3WXMB 2AMCB 5L38A 2ALZA 4DBQA 1QW1A 2QGFB 2M3DA 2CNLB 1ELOA 1KFDA 4URSA 4P72A 4ZK7M 4PWDA 4W92B 4B3MF 3K2YA 2HHTA 3AH6A 3CCVS 2XYGB 2HFOA 2H4YB 3LOUA 5C0MA 1S6QB 3LX7A 4IG0A 3PCOB 4JJBA 4ZPBA 2VH7A 1UAWA 5KG5A 4KGVB 3EJMA 3T5JA 3VF0B 3MZIA 1JLAB 1RADB 4MMKA 1S6QA 4KJIA 4B9WA 2A28A 4A4FA 1YSJA 4CO0A 3QYHB 4JS4A 2EFOA 1VR6A 4AD6A 2B7CB 2H51B 5ETSA 3MM6B 3CPWS 3MM5A 5KYWB 4LR9A 2QT7A 1W26A 2HK3A 2QA4G 3C8YA 3M59A 3NFCA 3S6WA 4X4TA 1JBMA 4B3RF 3PKMA 5KT6A 3NS7B 1M8MA 1BUXA 5ECAA 1KD1R 3TVTA 4JI5J 1RBLA 1X69A 3MI7X 1YJUA 2RILA 4USUA 1LWXA 4PJNA 1UECA 4L75A 1OU8A 2DB1A 2C2EA 2H8HA 2D69A 3CEYA 4M5GA 1S72S 3UATA 1D1CA 1K4US 3IRWP 3CO0P 1TSFA 2OH2A 1OIAA 4FYWB 4Y0FA 3RAQA 4OHYA 1AEYA 1PYTA 4JV2A 4LN2A 2EWNA 1Z9ZA 3QGGA 4JYAJ 2N4DA 1BHNA 1N33F 3P8BB 1HBUA 3E01B 2GAHC 1U0HA 2HBWA 1JJ4A 1UTIA 3I5RA 1NEEA 5CABA 3IM8A 2C3MA 3MEWA 2IJRA 1JLBB 3PEHA 3CCQQ 3QIDA 5A8WB 4JI4F 3ZNUA 2OD4A 1WC1A 1Q81C 1DTQB 1UCNA 2UUBJ 4IO9Q 5I21A 3N0VA 2MWPA 2PEBA 1M2VA 1R6YA 3ETMA 1D1BA 4LF2A 4FZVA 1S1VA 1IGQA 4NPOA 2K9GA 3VS3A 3MPYA 1JRIA 1OYDA 1TL3A 2KJWA 3NGDA 2DIVA 4F2SA 4RWWA 1SC4B 4F3OA 2M7SA 2M9KA 2LQWA 2YUOA 1NLKL 1X0FA 4JLGA 1X5PA 2FPDA 2RH3A 1BD6A 4K4XA 1VQSA 3LGHA 3R8YA 2JUFA 1N8RC 4CRIA 2FQQB 2OEKA 2LNHB 3J7YU 2XB2D 3CJ8A 4PQUB 1OQKA 3HRTA 2R7SA 2RAQA 1I8FA 3A5ZB 4JI2F 3RBBB 4IH7A 4LFCJ 2MKCA 4Z2XA 2HHHJ 2F2XA 2A37A 3HMJG 2DY9A 4LUBA 2ATLA 2RT3A 4GMKA 5FRNA 3OLBA 2VIHA 3VR1A 2V94A 2DITA 1M1GA 4YS2A 2W7AA 3DOLB 4XQ3A 2XG8D 3HHDA 3M8ZA 5A0GA 4PKCC 5F9NA 1RHJB 3DU6A 2BOAA 2P0QA 3V8KA 1OSDA 1R0AB 1MGQA 1S59A 2DNQA 3MEDB 5CQYA 1NJIT 1RU1A 2JDJA 1I0CA 1VQLS 3QG1A 5IHNA 2RMOA 1SL0A 2V8IA 1ARKA 2PI5A 1G6BA 3S01A 2ZBCA 3IO1A 2DBBA 2FJEB 3HT0A 1XQHA 4J9IA 1UVMA 3M0TA 5IT9Y 4Y28E 3QO3A 1PJ5A 4HT8A 2V63A 4IH5A 4E7ZA 4M7DE 1RTZA 3BGRA 4JV5J 2IMWP 2YBVA 1T9UA 2JRSA 5L8RE 2X7IA 2HW3A 3FJPA 1YHQT 5F8JA 4Q43A 5DETA 4UOFA 1X4GA 4X4QA 3EG1A 1CJTA 2X4WA 1N8RT 2ZPEB 2DNOA 3KK3A 4QVDA 1YITA 3M7VA 3M8YA 3D0GE 4J6WA 3CCUA 3QT8A 3KBGA 5EC7A 2DXUA 3O5ZA 4F3QA 3T9NA 2V8KA 2VWFA 4ELZC 3FFIB 5KT2A 3G6ET 1NDPA 1S9GB 5HKCA 1RT7B 4YDXA 4XPEA 3DB4A 2AZ3A 3JQKA 4NXMF 1FDNA 3C6TA 2F40A 2EYWA 2QA4Q 2C3OA 2M0OA 1D8ZA 3DC2A 2YT6A 4OB2B 1KONA 5DLOA 1Q7YT 4MK7A 2O67A 2XC9A 2FYKA 2CNKB 4DU8A 3E2EA 3E9FA 3DCAA 3HFVA 4P9SA 3RW6A 2C28A 5D6WA 2MIOA 2DNUA 5HL7Q 2OTJQ 2KT3A 2XNQA 2HHQA 2VPXB 3QDRB 3LH5A 2FZCB 3CJRA 1YIJT 1QM9A 2QLXA 1M2OA 1U48A 1FK9A 4ZPTR 4LDVA 2DT9A 1QE1B 3M5AA 5KFJA 1WDXA 2DRMA 3EH1A 1RTIA 1S57A 2BBEA 2PT0A 2Q1LA 4EMGA 4OMFB 1V5VA 3CBPA 1DRZA 2OTLA 2QYCA 1YDLA 4FXVA 3KJNB 2XS7A 3MD1A 2HIYA 4OZ5A 2LP5A 1LCKA 3C16A 4CH7A 1WLPB 3CC7T 1FJ7A 3BJYA 2ASDA 2IBKA 4O3QA 4RTTA 3NCPA 1KQKA 1KD1C 5GAOl 2EFNA 3L7OA 3R7BB 3H7HB 4MTPA 4RTVA 2LECA 4AE5A 4DV3J 2BJ9A 4RNOA 3VAMA 2ZGWA 1VQ5T 5AJ3J 1NYGA 2IPOB 3HVWA 5ETVA 4M75F 2D3OR 2VOOA 3Q89A 4PWUA 4AFUC 4J9FA 2VPWB 2RQCA 3LP1A 4J9BA 5HCKA 1M1HA 4K5RA 4K4SA 3JV3A 1LK7A 5GAN7 2P6TA 3AODA 5JVGQ 2E5LF 5E3PA 1NHKL 5B0FA 4DR5J 5A76A 1YX2A 3PFEA 2ZPGB 4D6WA 1RL2A 3EG0A 3PYEA 1TG0A 3E01A 2IVYA 2YQ0A 4KHPF 4GKJF 4M5DA 4LDWA 2YPYA 3NXZA 1UVJA 2PIIA 3GFYA 4OJ3A 1YJ9Q 1URRA 2XEXA 4XTXA 2IM3A 4DV0F 5KFTA 3UDVA 3EGXA 1WC6A 3EXCX 1CJVA 1VBKA 2D0QB 3CCVT 4F4YA 2Y1LB 1ZHIA 3MURP 1YJNQ 1QLYA 1YHQA 1UFWA 3CJ4A 3R97A 2HZVA 1IUJA 3OHAA 2RUSA 2KT1A 4DV7J 4HVVA 3PRDA 2NREA 3OYJA 2AD9A 3QJYA 5A0LA 4UOCA 1RCXB 2DJZA 2YUQA 4BI3A 2HBZB 2E5HA 4LRBA 1URNA 2E7XA 1M1KU 3AD9C 3LP0A 1XTDA 2MWOA 2VBXA 3D54A 4U9RA 1FRKA 3V81B 4QIEA 4CLZA 4A8SA 3RMSA 3G6EQ 1YP5A 1VQ9T 5ETLA 1D3BA 5BXIA 4CH0S 3F56A 2XI2A 3ZTOA 1MMLA 2CKKA 5CKBA 1RT5B 1RT4A 1SH2A 5DZ7A 1Z2LA 3R5AA 2MCNA 4B9SA 1EX8A 3OW2S 1BCOA 2L9NA 2Y0SD 4LVNP 2JH3A 1VFJA 2PI4A 3KUEA 2P0PA 1EKSA 4F02A 2OI3A 1VQ6A 2YNHB 1VQKS 1FKPA 2KDSA 2B9EA 3C66A 2W8KA 5EX0A 3KLFB 4J9OA 1KQGB 5IN1A 4RW7B 5ETMA 3MP1A 2VKRA 3BQ0A 2HGMA 1FT8A 2Z8QA 2J76E 2R8HA 1X27A 4ETXA 1Q86U 1GK8A 2CJKA 4OX8A 1SKSA 1X75C 1V3ZA 4WTOB 2EC0A 5IH2A 4O6JA 1Q86T 4R56A 3TUZC 3D6FB 3KK2B 3ENAA 1XR6A 1WKLA 2ZFHA 4BACA 4M75E 1HBOA 5GMEA 3W1YC 5CXTA 3RMQA 4D8KA 2CVIA 4LMZA 2CQGA 2MHNA 1B3QA 1F9HA 4PG8A 3QGHA 3BREA 3TQ7P 3G6ES 4EBDA 1VQ8A 2QX0A 3CD5A 4WPAA 4B08A 2HHVA 5L1IA 4DV6F 2WTFA 1EKRA 4K2XA 1J27A 1QUPA 3Q2TC 2E5LJ 2J5AA 2OGUA 2H5IB 1TL1B 1Q8LA 2E65A 2HHWA 2Y90A 2BKDN 3EFOB 3I5AA 2HZYA 2JVOA 1A0NB 3TJAA 4M7DC 3QJPA 1YHQS 1QVGP 1HARA 3CC4T 1VQPT 4PRFA 5A6PA 3BY7A 1REVA 4BCAA 4U67Q 3CC2T 2HNYA 2KI2A 3TAPA 8AT1B 3PMTA 1S1TB 2E1HA 3MCAB 4WTYA 2D9TA 2BABA 5FLXE 4L3NA 2XGQA 2DILA 1F9EB 3J7ZT 2KTQA 5DDOC 2QQBA 2QYZA 4XTWA 1Q86C 3OL9A 1REGX 3V6DB 5K8OA 2NUTA 1TP7A 2H3EB 4ELTA 4KE5A 5HBMA 5F8NA 2FHOB 3M9NB 2B9XA 4CLLA 1IREB 4KV8A 1Y0HA 2HLTA 2FRWA 1VQ4S 1W4SA 2YNFB 3CCMT 4CT8A 3AY0A 1O51A 1RT3B 2RIJA 2WVBA 5C24B 4S0MA 4C8QE 1S0VA 4LRCA 2ZPBB 5H1SV 1JLEA 3OB9A 4RW9B 1Z4UA 5LXYA 4C0OC 2E5IA 2A08A 2IBOA 4ZVUB 1OS5A 4C8QD 3L4BC 4YOEA 1WKJA 1M1KR 2OPSB 2HNZB 1YZ7A 4FP9A 2GTOA 1N34F 4DV5F 3HZEA 2A3LA 3WC2A 2CDTA 1M2VB 4YB6A 4ZLNA 2L9WA 1XMBA 1VMBA 2CPHA 1M4ZA 2R4FA 3GP8A 2PMWA 3Q8RB 2MZQA 2CPYA 3MM9B 3KLEA 4JBCA 6AT1B 2WAQD 4PR6A 3NNHA 1X9SA 3BBCA 4YY3J 4ECWA 3GMGA 4NRUA 1RT3A 3CJ3A 5CVIA 2PD1A 1B64A 2GHVC 4MYTA 3H20A 1VLYA 2RDDA 3NBPA 4CC4B 1YLXA 4IUQA 1Q95G 1E6GA 1S72A 4HHJA 1CG2A 4IG3B 4N4HA 1Q16B 3DFEA 2O3DA 2CVEA 2DNMA 3JCMg 1QE1A 2J06A 1BI3A 5I2MA 2NR0A 3MOZA 3ZFJA 4EYIB 3IWNC 1VUBA 2DO4A 1AZEA 2XM3A 3BSAA 1H6KX 2I1RA 1DLOB 3V8JA 1KRPA 2CNNB 2RHXA 1LOUA 2VQFJ 2BMBA 3UD3P 3GB0A 3V4IA 1MLAA 1QY7A 3UPFA 1RBAA 2OAUA 5HO4A 3FK4A 4PG5A 4USMA 1FEHA 4R25A 2A18A 1N27A 1J3TA 1T03B 4RBVA 4OX7A 3HHLC 3CT9A 4I4BA 1HL6A 3OFEA 3LH2S 2MHEA 5GAOr 2BKOA 4U95A 4J9UE 1N5ZA 1ZQ1A 1PIEA 5GAN6 2XGPA 4CNZA 4OYZA 1GBQA 3QXEB 1GCQA 1RWOB 1LW0B 5LXRA 4IR9A 3MMJA 5J2MB 3MUMP 2BR0A 3AOCA 1M5VC 4USHA 2GQ2A 4MJKA 1F1BB 1D9AA 4DPYA 3SZ2A 1EX4A 4CQ1A 1K1ZA 4RO0A 3AJ2A 4GY5A 4M77F 3QMQA 3H6ZA 3BO4A 2HCKA 2V5HG 2DHSA 3OYBA 3PACA 7FDRA 2BANB 4C5EA 5KYWA 3CMET 3D5MA 4DV2F 2RK2A 3M8PB 5B7WA 2VFTA 1RLDA 2KT8A 1KC8C 3I87A 3OYNA 1ZUUA 3TZZA 1KG1A 4QWEA 1WHVA 4KGKA 1OZ3A 4P7VA 3SSSA 3GLXA 1VRUB 2CGHA 1BI1A 1M3AA 1GTHA 4MYUA 2QLWA 2FZKB 2NSBA 2XHWA 2DTJA 2E41A 5ETNA 4XDDA 1S1UA 5KFKA 2D8JA 1TZ0A 4DG1A 2YNHA 2Q43A 3BPDA 1IN0A 4BDZA 1EIYB 4RCCA 3CD6Q 1P9QC 2JVRA 2XY6A 3W9JA 4ZP6A 3PV8A 1UJ4A 2NYSA 3X3UA 2J9EA 1S9EA 2CPIA 2JN0A 3LW5E 4ZITA 2W0ZA 4Z89A 1YBUA 4TY9A 2V8DA 2W4PA 2I9SA 4ZS6A 1C6VX 3H59A 2GNKA 2IJNA 2COYA 4EWTA 3VALA 2R7TA 4WIQA 3RBZA 3BPSP 1HQEB 3HHTB 3VS6A 3ZZ0A 2EC2A 2MZSA 1V76A 4BY6B 3UA7A 3CCET 3TVKA 2JW4A 1UUEA 4TXSA 2MKIA 5KT7A 2GQCA 2XULA 3KLFA 1D3WA 2E3IA 2DL8A 3MR7A 1HYSB 3MEEA 4BC9A 2ROGA 5AT1B 3HHLA 2YKOA 1RAFB 5D8HB 4HEA9 3QZ8A 4NLYA 2UP1A 1T3LA 4Q7AA 1VRQC 4YR0A 2XS2A 2E12A 2MZTA 2Z4PA 3M2RB 4O0IA 1FI4A 3F44A 4C0ZA 5BYRA 3Q8YA 2XZTB 4CC2A 3CD0A 2A36A 3RERA 4DR5F 2FZGB 2P9CA 2OAWA 1X5SA 4YMEA 3RNJA 2W10A 3L2ZA 3ZEHA 2QYGA 2EQUA 2ZOGA 3KLGB 3KKFA 3TQ1A 4FYDA 1HWKA 1KHWA 2XCAA 2GJIA 4DUTA 1JQGA 3TA0A 2AF6A 1XERA 2BA9A 1SJ1A 5KFIA 1M5KC 3HPWA 4NLGA 5I4MA 5AJ3F 2YNGB 3I32A 2FD2A 2JEJA 2PO4A 2C3PA 2YWFA 3KJVA 1Q4RA 2P0KA 4ILRA 1N5VA 4KR0B 5L1KA 3PG9A 2DRAA 5HANA 3KDOA 3C0CA 2HAXA 3VS7A 3CPWA 1Y96B 2K57A 2GJ2A 2CPFA 4FPRA 2CFXA 5KFUA 4PPDA 1RAIB 2EGAA 4HT5A 1MU2B 1CKBA 4C8QG 2VD3A 4Y00A 3I9V9 2YTCA 5F8MA 3CMAT 5DQIA 4DS4A 4XTZA 4XU2A 4G1QB 1L3KA 2B43A 3JCMV 1FRLA 4ZOSA 2LQ8A 3OYCA 4AG1C 2SRCA 3E9GA 1VISA 1MV0B 4HI2A 1HQUA 4E98A 4PJOF 2X9HA 2DVIA 1YITT 3NTHA 4IG3A 3QZ5B 1FDAA 2ZC4A 2XK0A 3H5YA 2KYXA 2DR7A 1VHFA 4ZN3A 2JLFA 1PD1A 1X9WA 2AZ1A 1HNIB 1R27B 2RQRA 1H38A 2JTFA 1R0CB 2K4YA 3CVKA 2ED0A 5HROA 1RZMA 4NL5A 3W2VA 5DDQC 1K73R 2YWHA 1NZAA 3TOQA 5CK9A 2A10A 2LMJA 3I4PA 1M5Q1 1HNWJ 3W7BA 1NH7A 1E6HA 1N0UA 3H0PA 2ASLA 4URGA 5L1LA 2E3HA 2RKIB 3B4MA 3OUYA 1SIZA 3W60A 5DO2A 4KH1B 2BJ7A 3S1TA 2CADA 2F63A 3CCMS 2L2PA 1AOJA 1BCMA 4RKUE 2X3GA 4ICLB 3RJMB 2SEMA 2KFYA 2FVCA 4L72B 4RW9A 2JEIA 1FDDA 1PAEX 4K0KJ 4WF2A 2GIQA 2LEAA 5LMNJ 3B4DA 4HHUA 3UN5A 4O3RA 2CZ0B 4D3GA 2DYIA 3UPUA 2APOA 5GAGI 3M2VB 1TKTB 2HGNA 3UCGA 2D3ZA 4X65J 2JT4A 5JXSA 1N6AA 1SG5A 4Y2KA 3OL6A 3IC1A 3JRZA 2OTLT 1VQNS 3A8LB 2BZ8A 4U7CA 3BW1A 2R42A 3WQPA 1NM7A 1I5OB 5J1EA 1KQSR 1U49A 3CCUQ 2DTOA 2R5AA 4FW1A 2R57A 5H9FJ 3OJSA 1R8CA 4KT0E 3BR8A 3BS9A 3MGJA 2QGGA 1OY8A 4M7DD 4J9LA 2K5FA 3MMCB 1VQKA 3CGIA 2HQXA 1DQ8A 1S6OA 2E66A 4NASA 1RYSA 4DU7A 2BACA 2FY1A 2PFFB 4OGCA 4KBIA 1N33J 2AJ2A 1CJTB 3GIRA 1RB0A 4XTVA 2Y1RI 1SKWA 1BC6A 3TI0A 4UZBA 4GRSA 2U2FA 2MDAA 2O4XA 2WSEE 5GAEI 4A8QA 4LDYA 2XZWA 2VXEA 4L76A 2BQRA 1R8HA 4YB5A 3C15A 4KKOA 3FSYA 4M5LA 4ID8A 4AFSC 4UZCA 2C0OA 2PUKB 3MMBA 2AKKA 4H4KC 4RUAA 1X31C 2GTJA 2BRKA 3UR3C 3OQ2A 3BH7B 3JB9I 3DOMB 1NSKL 3M1VA 5KFNA 1CQMA 5DGBA 3G6EA 3BSCA 1UHFA 5BR8F 3FEXB 2MQQA 2KXDA 1RBOB 4TVRA 3D1OA 2D8HA 1FD2A 5IZHA 1CULA 3D9BA 3H90A 2HQIA 3CCJQ 2B5JA 3OTBA 4ZIWA 2WBMA 4M7AF 2KI7A 4PFOA 3OS5A 2D1CA 1I94F 2RHYA 4NEYA 1WOPA 1EFNA 1NK5A 3CMAS 1UGPB 2EBGA 4WKYA 2M0YA 1C0TB 2SXLA 2XDDA 2MZ1A 1V3RA 1QCNA 3RUBL 2HMIB 2E1CA 1H92A 4XK8E 2M1HA 4KBMB 1VQPA 2J6FA 4C2MA 1KHCA 1F3VA 2BV3A 2CQHA 5LSRA 1KQ2A 3A1PA 2HBYB 5KFHA 1VQOQ 2LCLA 1WC3A 3PFOA 2HHPA 2R2TA 3EGDA 3ENQA 2LKZA 4NS5A 3MM8B 3MECB 5CZVA 3QRQA 2L3RA 5HY6A 4J9QA 2O9SA 1F9FA 3VYGA 1NPKA 2HZAA 2KHCA 3G9CA 3P5BP 3L95X 3REAB 2JEFA 1VS3A 3PYFA 4DQRA 5JVHQ 1JXMA 1P92A 4ECUA 2HZCA 2EJFA 2ZBIA 2PUOB 1H7WA 3M9OB 1JMTA 2N4CA 1KJWA 3KUGA 5THWA 5ETQA 4HACB 4UY8T 1R8AA 4GO5X 5A8RB 2X4XA 3CSKA 3MMAB 2EQMA 3RKYA 3OT9A 3NNAA 4H4MB 5GMKj 3HKZD 5KH6A 3AB2B 3GWCA 2FDNA 2N3OA 2R2RA 2LEPA 4XTUA 5GVQA 1NRKA 2FLPA 3EGXB 1Q7YR 2VODA 3C3LA 3A8EA 1VQLQ 2RI3A 4J9RA 4PFZA 1VIEA 5IAYA 1UEKA 1N36F 3DLEA 1GTEA 5HATA 4EMKA 4O3SA 4KO0B 2KK4A 1HNWF 1FJEB 2IM1A 2C2KB 4XAXB 2A2DA 2MK5A 2R3VA 1VJWA 2I5JB 2MMPA 4RWXA 3MM7A 3LYIA 5IFMA 4K4ZA 3HVTB 4C0DB 1N36J 1N56A 2EPIA 3G1JA 4I2PB 2DL7A 1K1SA 1WDDA 3O44A 2YKAA 3PTAA 2MQMA 1M5PC 2PVGB 3W63A 1RLCL 2W8LA 1Y5IB 4QWAA 1CS4B 5C2GA 1TK0A 3ETOA 3BFMA 2W2PP 1N48A 5KYUB 4CO1A 4I2QA 1KQ1A 1N9SA 4KHRA 4H4OB 1K8AR 1ZZFA 2YKMA 3JCMb 4OGEA 3RB6A 1S76D 3FQLA 3MUVP 3JCMc 2E4HA 1F2GA 2HFNA 1FKOB 4LQ9A 4M78G 4C8QB 2F4FA 3EFRA 1N0VC 2OKQA 4J9GA 2UU9J 5I22A 2BANA 3QATA 1WG5A 3DYAB 4LUDA 3FCWA 4NL2A 4WU3A 1UWAA 1HI1A 1RWMB 2AEMA 2EBEA 1LPLA 3TP2A 3GJSB 2KBTA 3GILA 4OJGA 2IVWA 4J83A 5GMKl 6FDRA 3M0QA 3Q22A 4JJDA 3VS2A 2OEJA 2CJBA 3H5UA 3VAFA 1N5QA 1C0MA 4M5IA 1NMEB 3GCWP 3U23A 1FNXH 1D0EA 2E1AA 3QAUA 4URQU 3LP0B 2DFUA 5JMNA 2ZITA 4Y2IA 2JM8A 1YITQ 3NCRA 3M8SA 1CSJA 4LF5F 3ZZZA 2FRYA 2RF0A 5D0HA 4AXJA 4ED2A 5HK0A 2DGTA 4ED6A 2YX7A 4DR7F 5L1JA 1VQ8T 4MFBA 4F50A 4YEAA 2P4TA 4MK8A 2WVCA 4EFAC 2RRNA 2K3XA 2B9WA 1NJWA 4PXEA 3LGFA 4ATNA 4AFFA 1FRHA 2UV8G 3KK1B 2HGLA 5IT4A 1OMSA 1LWCB 3BN4A 3WIVA 2AYBA 3D6MB 3QJJA 2COZA 2VG6B 3QGIA 4OB0B 1WPYA 1ULRA 1UWBB 1T3OA 3U02A 4ENOA 2VXFA 2X1BA 3HSDA 2IG0A 1VQ6S 4K2JA 2VQFF 4PLIA 3PEJA 2ERRA 2GA7A 3R1HA 3EVWA 5CIUA 4IUPA 2K8GA 3A3NB 2NCKL 3FDSA 1RSCA 4LF1A 2HSPA 2VQEJ 4IO1A 5MAOA 1NG2A 3AA9A 1GBRA 1KFZA 1FWLA 3W5YA 1YWOA 1ZETA 1YIJA 4EMKB 4KHMA 2CUDA 2MI6A 2QXFA 1ZUKA 1JLFA 5CYMA 1WHGA 4OMLA 2UXCF 2HKNA 4JI3J 5LSLA 4LRAA 1H72C 4NXMJ 3PIPQ 1LNXA 1IHWA 1SCJB 1Y7PA 2AYEA 3LPYA 3M8WA 4QR0A 2E70A 1JLCB 2Y8YA 1TQLA 1NO8A 1IM6A 3ULRB 1TVRB 4C8QC 3BB5A 3RW7A 3KHGA 3RKWA 2KR3A 3W2VB 4B3SF 5A2QE 1PGZA 4PG7A 2OPSA 2Z30B 4IIOA 2OHDA 1FEEA 4QCLA 2EVRA 4R5PA 3CCRT 2FVRA 1HI8A 1N8RR 1RHKB 2KL8A 4BE1A 3CCEQ 1D9DA 2CDRB 2D3UA 1K9AA 1PKTA 4JDSA 5CO7A 5T7LB 1RWVB 1UTAA 4ZP7A 2HBQB 1KVKA 3B54A 1FJCA 2XI3A 4IFYA 2AKLA 1FK9B 5E2QA 3LUYA 2AZSA 4B6MA 5FD1A 1DAXA 4OYMA 1UGSB 3TA1A 3MP8A 2ZH4A 1GEHA 3KJQB 2G2ZA 1AZGB 3MHYA 4OVAA 3ZTQA 1REVB 4PYDA 1T9VA 1O75A 2BZYA 1FKOA 5HMXA 2ADCA 1ZA2B 2YUPA 4A54A 1KD1T 2GMLA 4DLEA 4DQQA 3PVQA 2CAJA 3H9NA 4P71A 1RWPB 4A4GA 1MUZA 1S4EA 2WW8A 2DXCA 2EW3A 3HFOA 3GIIA 2GC8A 5KFPA 1S48A 3AHPA 4CP5A 3KYLA 4KTQA 4RLEA 4OJHA 2Q3PA 3ITHA 1UVKA 4ZIVA 3JSMB 4M5MA 4BDYA 4J91A 3LH0A 3SCIE 2V26A 5LJ3j 4GKKJ 1B7YB 2NQPA 1SUQB 2YLCA 4J9EA 2DGQA 3DRYA 3TCJA 1VQKT 2J0XA 2JL9A 3FEYB 3CC2S 2VPYB 4OB1B 2EG2A 3ER0A 2CSQA 2HAIA 3OTDA 1VC6A 1O5JA 5HK4A 1W70A 4ANEA 4LF7J 1ZA1B 2G1HA 3AOAA 5CCLA 4PUOA 2HWIA 4ITSA 2I38A 1B7TA 4ALZA 4ZMMA 1HSQA 4ES1A 4PWDB 4BWMA 2OFGX 3I56A 1HBOB 4DFKA 2Y8WA 4YTLA 3RAXA 3GG0A 2VGMA 3C14A 1ZTWA 4BI4A 1RDRA 3M30B 2MZRA 4DDFA 4CLYA 1QCFA 1YI2T 2KVQE 2V8HA 3GJRB 4TU9A 2XY5A 3KK3B 4ETZA 4HA8A 1NLOC 2YRDA 2VFVA 5LJ5g 1SB6A 2HPUA 1ZM3A 1T05A 5IT9E 3KHLA 1U26A 2CPDA 2GVDA 2WSCE 2VF3A 3PHTA 1TMMA 2BDPA 3KUHA 2GW8A 2VC1A 1JWWA 1VQ7S 2L3MA 2PVDB 3QDFA 3KG0A 2FB7A 2F4VF 4LSNA 4JB8B 5B0DA 2HL3A 1WQWA 4JI7F 1U6FA 1LOJA 3CJ0A 3GV8B 5D6XA 1FXXA 4W98A 4I56A 2DERA 1EB0A 1VQOT 4RNMA 4PJOG 4TY8A 2W2OP 4DUZJ 2K1RB 3G71Q 3FQKA 5F8IA 4ZJOA 5DQHA 5HJYA 3RRKA 2HWTA 2W7PA 4U7UD 3MKDA 4M7DF 2HS4A 3M58A 6FD1A 4L3KA 1Q81R 4D8DA 3R3TA 1NJIU 4MAKA 3CCRA 4FPIA 3LWLA 5D6YA 4WFXA 3TARA 3CBOA 1KQFB 3TEHB 2B4VA 1SV5A 4CH1A 2V2ZA 2G1DA 4L5GA 2DEIA 4HTIA 2D7SA 4DQIA 2RRBA 3MDFA 2GCFA 2BQUA 5ETTA 1YJVA 4USVA 4FSXA 2E7WA 5LJ5e 1EQ0A 1NYFA 1U0HB 4N4GA 5F0UA 3MECA 4JI7J 2X3WD 2EKOA 3CIMA 3QFWA 3MWBA 5HQMA 4EBEA 2FHJA 1NB7A 1QSSA 2DRDA 2NUHA 3TREA 5B0AA 2WSFC 5D7UA 1TKZB 4DV4F 4A8WA 2QDLA 2DBKA 4IURA 4LDUA 4FCYA 5SUHA 4ILMA 2F3JA 2JC1A 5J2PB 5H9FK 4TKTA 9ATCB 1YG0A 2DPJA 1KSWA 4O5VA 5A0YB 4DJBA 1T9XA 2N7CA 3TAQA 2QRRA 2RVJA 2RDIA 4QPTA 3G71S 1GRIA 2DHAA 2KDOA 1HR0J 4DN9A 4ZTFA 2UUAF 3C6UA 1G2BA 1IKVA 5I3UA 5E3CA 4MZPA 4M5HA 1XNQF 4CNYA 5HP1B 1SJ3P 1W2BS 3AT1B 2DEUA 1S9FA 2HRTA 2FUG9 2L9DA 3BV8A 1CLFA 3OL8A 4ZGJB 1RA7A 1HNXJ 4B3TF 4TVAB 1P8GA 3M8RA 4X66J 2QA1A 2GFFA 3CC2Q 3KLHA 5DM7Q 4LR7A 4EIKA 3D2WA 3CPWR 3MF5A 3ZC4A 2AZVA 4USIA 5L9NA 2RPNA 4C98A 4GBQA 5IS2A 3T1YF 2PDAA 4PABA 4E7HA 1QAIA 3T6BA 3EYZA 5J1NA 1SQGA 1I51B 5IM0A 4QPXA 1V29B 1S97A 2RA2A 4O3OA 2HKEA 2FJXA 2FLNA 2QTWA 2BRLA 1U3OA 2XDPA 2YXYA 2KVQG 2HL5C 3BF4A 1U6BA 1HNVB 1NZ9A 2M5YA 5BR8J 3KLIA 3W2WB 3ZTPA 3D68A 2EQIA 3C46A 2HFSA 2DL5A 4DN0A 3MM9A 3KG1A 3H4DA 1ZSZB 1VK3A 1PHTA 3N5BB 1H73A 3MPUB 3T9ZA 3X24B 1DBDA 5GJVB 5KOWA 4UUWA 4O4GB 3CDWA 5G4DA 4EEYA 3HJFA 1IQZA 3L2UA 3VRYA 4DX5A 1TH7A 3G4ST 3JQMA 4X62F 4ZVGA 1ZSZA 1SI9A 1PYOB 2DHXA 3HHLB 3QT5A 2RRAA 4M78B 4L59A 2V9KA 4C3KA 3VYHB 4OQJA 4C8NA 4IDKA 1FX2A 3UW1A 3BO3A 1PJ7A 5E7OB 3VHQA 4KGMA 4PQAA 3GCXP 1T7PA 4I6WA 4OJ1A 3UD4P 3PW0A 4X64J 2NWMA 1HNIA 1JK9B 4JV0A 1RT4B 2YHTA 1PCAA 3D1HA 5DM7R 2GX8A 4F4ZA 1YJ9A 3C4SA 4M77G 5J39A 2CP5A 3P49B 1SSHA 1RT1B 2IC3A 2K5IA 5GANg 3VAIA 2BUDA 4DA4A 3AFGA 3M6VA 4HVZA 4DOZA 2VDIA 2R7RA 3E51A 1Q8BA 1VQ9Q 3G8SA 3WDOA 2LA6A 1PCXA 3EWGA 2RDJA 3TU4K 4R55A 1XMOJ 5KYYA 4LFAF 5EWFA 3D28A 4AFZC 5ETOA 2F4VJ 2ZBRA 4IKFA 2V4JA 2DETA 2J7WA 4TU7A 2D9PA 3EZUA 2MYFA 3S7RA 5U47A 1NJIR 3KMSA 3QWXX 2KKHA 4NI2B 3QSUA 2J6SA 3CTRA 3WIUA 3PNIA 2NS1B 1B07A 3CC2A 3H8ZA 4DV2J 1VQKQ 3CCVQ 1CJUA 2UUTA 2HBPA 5F3ZA 3VVTA 1IRXA 4TYAA 2V1QA 4EDUA 2V69A 4B3TJ 3MAHA 1SPKA 1HQUB 3I4HX 3OR1B 3EHQA 1SQEA 3KNAA 2RQUA 3KUFA 1QVGA 3FZBA 1BI0A 5FU7B 1HYOA 1S7IA 2RE1A 2RQ4A 3THTA 3L9ZA 2G0IA 4ED7A 5KFAA 3QBCA 1N32F 5GADI 1VBYA 4OYAA 4Z7CA 2I0XA 5CYQB 1UFFA 3OYYA 4OYXA 1WGSA 2KQWA 3R2DJ 1GMVA 2WBRA 2Z57B 1TTHB 3CJSA 2OMOA 1WC4A 4M1KA 3SEMA 2JS0A 3OMGA 2DNRA 5DLQE 2W01A 3CCEA 4WYLA 2KMTA 2Q6CA 4JI8J 8ATCB 4YUDA 1IZ6A 2CPEA 3H0FA 3G6XA 1VBZA 4EMKC 2O2OA 3HSZA 1B0TA 4II1A 4BY6C 3QIIA 4KUDK 3NMAA 3CQTA 3SWNC 1N54B 4C7QA 4HCCA 2VG5A 3MMBB 5IOLA 1GXTA 3DOLA 3W64A 2YLBA 1ZAWA 5CYMB 2WVDA 2BE7D 5FW9A 2V4QA 2JJ9A 3FSIA 1QTMA 3SFMA 3HZGA 3R6LB 1VQNA 2W9BA 1UVIA 2QE5A 1J5OB 1QVFS 3N79A 2HKQB 2ZE2A 4EO8A 3QKJA 4DZDA 3A8JA 3M56A 3GIKA 2RI2A 5HLFA 4DSIA 3LGLA 3I0SB 4OV6A 1FO1A 3M2RA 2VV5A 1TL5A 1Y11A 3PR5B 4TYBA 4MK9A 1VYTA 4I67A 1GAOA 2WSEC 2XMFA 3RB3A 4M5NA 2DR5A 3EFOA 2AGQA 1ZLMA 3FCHA 1PSFA 3JCMh 2K7AA 1SRMA 4USJC 5AXLA 4LIWA 4C3LA 1V1CA 1S1XB 3KJFB 2RO0A 2LXFA 3MCNA 4JV1A 5B08A 1U1PA 2V4JB 3UVJB 4JI5F 4DWIA 2GIFA 2GAGC 3LTOA 3IAS9 2H9ZA 3UR0A 1FKAF 1U4BA 1IBKF 1X60A 1F60B 5GAOq 5LJ3f 3O6QA 2DBMA 3CPFA 3QAEA 4J5OA 4DBFA 2CYYA 2DH7A 4KSEB 1NJZA 1ZSZC 1FRXA 5KCOA 1RABB 3IBCB 4WZQA 1VQMQ 3CCJS 4ELUA 3CC7S 3SWNA 1UETA 3N5FA 1CEZA 2V67A 3PW5A 3FZ2A 2RJCA 1Q81U 4KO0A 1HPZA 2EYXA 2CXEA 4JUVA 3JB9G 3META 4O23A 3LW5C 4J9NA 1RCOB 3Q8SB 2AW0A 4OYIA 3QYGB 3PW4A 5GAMj 5LJ5j 5D4LA 4DPTA 2XHCA 4AUKA 4JZ3A 2YWKA 2ZDPA 3AOBA 4HDGA 1GL5A 2LVMA 3AQPA 3W5XA 2UVRA 2LQJA 5F41A 2M8HA 2AHOB 1WF1A 5HROB 2JLGA 3DRSB 3FBCA 1ICEB 2AX0A 4DZ6A 2GO8A 4C92A 3RR7A 4Y91A 1KTVA 5G0RA 4DR2F 4QKUA 2BM1A 2ZEJA 1FJGF 2AJQA 3ZNJ1 3OHBA 5KG4A 1RAAB 1A6LA 1WJQA 4EBCA 3TAMA 3WHIA 4UTGA 2DAQA 4NXNF 2ZUGA 5L8RC 2DNNA 2IDEA 1PC0A 4E2FB 2HDAA 2NXJA 2BE2B 1JLGA 4DS5A 2X51A 4UOGA 3AXKA 1JJ2A 3BGLA 2M88A 4HCZA 1Y0MA 4PPZA 3G8TA 2HVDA 1ZSGA 4WIIA 5KT4A 3CO9A 4IDKB 2YWWA 2MGZA 4HHHA 3HI9A 4F0KA 4C8QA 1KS2A 1AWXA 2KT5A 4WP3A 3K5NA 4M7DG 3VS0A 3NS6A 1GMUA 4FYYB 5GAN2 2VGNA 4AT1B 3GR1A 4RX6A 1UE9A 2O5DA 2YRCA 3M53A 1V5IB 7FD1A 5DG9A 1B34A 1SEMA 1JQQA 1DURA 1W2BA 1C1BA 2BJ1A 1MROA 2HHUA 1V3SA 5H9EJ 4XU0A 3ZFVA 4DFJA 2LTOA 2VZ9A 4KFBB 1Q1KA 2MJUA 4ED4A 3D6HB 4X4VA 1U1MA 3M1VB 3K0JA 1HNVA 2GCXA 1I94J 2Z2YB 4F26A 3JS9A 1VQLT 3QWUA 1RKJA 4J6YA 4FNHA 5AE1A 3ZTSA 4DR2J 3GIMA 5KFDA 3OXFA 4LF8F 1H74A 3AAWB 1K0XA 5LJ5Y 3M9QA 1VIOA 1TV6B 2C3YA 4NCAA 2P9GA 2RNAA 3SCLE 1YGYA 1RI9A 2CA9A 2KRBA 4LD6A 4YHHJ 1SVDA 4LBHA 1R43A 1NK0A 3V81A 1G4CA 1M1FA 4ZGDB 4M7AG 3RTVA 5FRMA 3HHKA 1EARA 3QIPB 2QTVA 3NAIA 2R8KA 3J81U 4NWBA 4M63A 3Q8QB 3U1NA 1BY9A 1O9SA 2XWXA 5L46A 5A8WA 1TKZA 1XWLA 2O01E 5H9EK 2MSTA 4NLQA 3UCUP 3IWLA 1FXDA 4R0KA 4U8VA 5GANf 2G2OA 4N56A 3W9IA 1VQ7A 2VDHA 3KJVB 2M4MA 5GAHU 3PW7A 2WZ1A 4IUTA 3FBFA 3RRHA 1G2EA 3M57A 1Q82C 3M32A 4DF4A 3M2VA 4FF3A 2OTJA 2M2BA 2KT2A 4JP8A 3W62A 2ACYA 3PW2A 4WP8A 2I2YA 3CCWA 4YFUA 3PJXA 3HX9A 4DPWA 5HBMB 2W1BA 2ABYA 1RAGB 2HEKA 3Q8UA 4NX9A 5KT5A 1LV5A 4LT6A 3ICLA 4K59A 1RWXB 4QR1A 1R6VA 4GC7A 4DCOB 4A8FA 1WHKA 5GMKe 4J9DA 3JCMQ 2DK2A 2KFNA 4LSLA 4O3NA 4FF1A 9RUBA 4M7AB 4VUBA 3K7RA 3SMZA 3EFSA 4USKA 3TO8A 5FU6B 1F2HA 3BDLA 4R0JA 1QMCA 3E19A 2RJZA 1HHQA 4WBFA 1MMDA 1L3TA 4JLIA 1NK4A 2QMXA 4B3OB 2PTKA 3CIZA 3CJQA 4RTYA 4N0AA 2H5EA 1IVZA 1KKHA 4A8XA 1X6BA 4BE2A 2U1AA 5LMUJ 4OI1A 4IKAA 5KTQA 3OYKA 2HQCA 5DG8A 4MDWA 5CAIA 4CO2A 1QP2A 4NE9C 1PYSB 3JYTB 3MPVA 4WXWA 2DCUB 2ZH8A 4CM2A 3OTOF 1GX5A 1S6PA 3VKIA 5K9FA 2CP6A 2QI2A 1UL3A 4QWBA 3SHWA 4IUVA 1G3OA 2KHDA 5GAMg 2O4XB 2D0NA 3MR2A 2DCLA 1SJFA 3NWRA 3LO3A 2QK0A 1EAYC 4QYZJ 1KBRA 5KFLA 2J9CA 4OZNA 1BMQB 1M1KT 4JI1F 2HAFA 2DX1A 4AQYJ 3V6KA 2VUBA 1S1WB 3D1QA 4B3RJ 3MPDA 3CCUT 3X1LB 2MXYA 4AFQC 2QSWA 4OHVA 3IBFB 4ZVOB 2KAFA 1YK9A 1ZOTA 2B9YA 2F5GA 4GKKF 2P6SA 4Q2LA 3R5GA 2A0FB 4DLGA 2WHOA 4QJVA 2MF2A 3FKBA 4OX9F 3Q1JA 1YJNA 3A3OB 2ZJPQ 1Y4ZB 2LXUA 2P5VA 1MNEA 3I0RA 1W2BP 3Q2SC 4N8NA 3TQEA 2EFQA 4LREA 1H641 4RL1A 2FTRA 4ZCLA 2DL4A 3PDNA 3RRGA 3AXMA 2MAMA 5CYJA 3IMQJ 4EPCA 3OBIA 2MKHA 1WEZA 2CT3A 2CG8A 3CPWP 4ME7A 1CS4A 3DDIA 3NWGA 4DV1F 2ZDOA 1WOSA 1RT2A 3D7SB 1CJKA 1WACA 3HVTA 2ZHBA 2A1BA 4NEZA 4CC3A 3KLEB 1UJYA 2ROTA 2H3JA 1U0SA 1UPMB 4GVBB 3KLVA 4V19X 1J5EF 2GQVA 2RUGA 2XZDB 4NLDA 4OMOA 2K3KA 2C2MB 2ZKUA 3ZO7A 2B5JB 2CH4W 3CCLS 2DR8A 2FC8A 4OLPA 1CULB 4NCBA 1WJ9A 1SQFA 1SC3B 1LFPA 1X5TA 1R8OB 2POKA 4PJJA 3TSWA 4ESRA 3OSVA 2E1MC 4ZPAA 1AHJB 1CC7A 4E7KA 2CWKA 4NLSA 3EDRB 1NH8A 3POTA 1GXIE 3DB3A 2QLBB 4CLWA 7AT1B 3ILJA 1TKXB 1IBLF 3LP2B 2IYGA 5T14A 2XDBA 3CCTA 3JB9k 1M5HA 4LSNB 1SJRA 1VK8A 2A2CA 5KE2A 4L74A 4RU2A 5K5MA 5C7PA 1FMKA 1F5CA 1W7WA 4BBYA 2AYMA 4HCKA 3FEOA 2LQ9A 2Y1JA 2GVZA 2BVZA 4R8UA 4IRCA 2CQPA 4M78D 1VA7A 2BOPA 4NOHA 2GMHA 2VA3A 3HK2A 2VHGA 3SSQA 3FLGA 2EQJA 1H8KA 4KYZA 4R8UB 2KROA 3HFZB 3LP1B 1NPPA 4M78E 3UDCA 1XQIA 4C92F 2LCWA 3GFHA 5EGYA 1JIHA 5HAOA 2XD0A 4JZ4A 4H4KA 4NLVA 3T5KA 1RWUA 3MCSA 3DLKB 2UVVA 2XICA 2ZOMA 2CPZA 2OIHA 3CCMA 4RU9A 4ECTA 4MZMA 4HT7A 2ZH2A 4WKRA 3N01A 1WZOA 3FMWA 2CWXA 3ENWA 3MOJB 4XIUA 4J6XA 4AG2C 1WQ7A 5IC4B 2LA4A 4ED8A 1N6QB 2AWZA 1HD0A 1TU0B 2RH2A 1U7LA 3SSRA 4QIWD 2MKJA 4HH1A 5KG0A 1WHJA 4ED5A 2F1LA 3KMQA 4K0KF 3J80E 3GFZA 3HM9A 1WA7A 5KYXA 2FLOA 1ZM9A 1EZZB 4B9TA 2BYCA 1ZAVA 2KEAA 3RR8A 3MAAB 2LDMA 3QBYA 1Y9OA 3DRRB 2DNLA 2QG9B 3T41A 3OVBA 1NXIA 3RUXA 1ZPVA 3C95A 1RU2A 3Q0AA 1KD1U 1KLMB 3TVZA 1YBYA 1QSLA 4DQSA 2FGCA 2PA8D 2QEXT 5I3PA 1Q8KA 4ZPDA 1VJQA 3PM9A 2ZHOA 1XNQJ 2I2LA 1OPLA 4JV5F 1RJJA 4KV8B 1RHUB 3K89A 3MMCA 3L2VA 3KK1A 3CCSQ 1KC8R 4JRKA 1PO6A 1FDBA 4Z02A 3JCMJ 4J9VA 2G0CA 5F9LA 3MEDA 4QYZK 2ZNYA 4DMZA 2VBWA 1SL2A 3SEOA 2IIHA 2BUNA 2LJ0A 4PFPA 5JJBA 3VU3C 5FLXY 4RUHA 2AKWB 1HA1A 3ZZOA 3V7RA 2RQMA 1S9GA 5D15A 1OU9A 5GANe 4DFPA 3IR5B 4QU7A 1EJ7L 4JI3F 3JQJA 2L08A 5J1EB 4C92E 4MIAA 1QVGS 4WCEQ 1E6VB 5HMZA 3B82A 4CCHA 2PGCA 3NTKA 1NK9A 3BGRB 3A1YG 2OUGA 4OFZA 1N32J 2YRVA 3A8OB 2CNOB 4M75D 3OFFA 3W66A 3EGVA 1D1UA 1GFDA 3JSRA 1BXNA 3TUJC 2E9ZA 2FG0A 3DXSX 1X4HA 4A4JA 4N8OA 3FJ2A 5CCMA 1QAXA 1JJCB 1HFEL 3FCVA 2HMAA 4ZVHA 1WUUA 2K79A 4Y6IA 4FBUA 4CLFA 1XC9A 4J5YA 3HO1A 1Q82T 1Q7YU 4F8RA 3T1AA 3VRZA 3TZXA 2E1RA 4ZDNA 3UNGC 1H3ZA 4P73A 4OV1A 5CKDA 2RD1A 4FKXA 2AHJB 3I56Q 4J7IA 1VQ9A 3IA0A 3HDSA 1IJEB 2IA6A 4F16A 2DGWA 3KK2A 3OR2A 2ZAEA 2ABLA 2MLZA 4ZP9A 1IKWB 4LF8J 1Q82R 3J81j 3K17A 2VG7A 1RLQC 3P45B 2AJ1A 2B8PA 1N6QA 2KB2A 5F8GA 3I55Q 4DUZF 3UFCX 1CKAA 3M54A 5EWGA 4RBUA 1QD1A 1DLOA 1RI0A 2M16A 3E1SA 4ZLLA 3Q8PB 2FJVA 3M2UB 4NLUA 1MSWD 4IUUA 3SFUA 4BWJA 4JS5A 3W8GA 2PFDA 3I96A 3GQCA 4RNHA 3DXBA 2HRYA 4CTAB 2M52A 4CT9A 3O1LA 1P9YA 2B56A 3JCMd 1JXLA 1U8WA 1Y10A 4ANCA 1MG7A 4Q8FA 4FXDA 3KXTA 2D41A 4JYAF 4F36A 2OMLA 3C19A 3R5DA 4RUGA 5IHIA 2LQ5A 2UUBF 1G3YA 2QLJB 2D6FA 2V50A 1FXLA 1SH0A 2V0NA 1BE4A 2DA9A 2W4DA 2HHHF 3VGUA 2LQNA 4NZ7A 4M8LA 4QT7A 1GQEA 4F25A 1OYXA 3IAM9 3O8VA 4XTYA 3POTB 2C2RA 4HVWA 2VA2A 2F9DA 5JUMA 3R2CJ 1NE8A 2HSEB 4J9KA 5B0BA 3BM7A 3NMZC 2HQGA 1JB0C 3GYGA 2Y4YA 4BLGA 2JS2A 4R0EA 3SQGA 3OYAA 2JC0A 5DDPC 5KT3A 1WTFA 3MPWA 4TY8B 3QSIA 3FIFA 1H3DA 3AA8A 4CZCA 3GJQB 3P8HA 1AT1B 4OX6A 1AUDA 4A4HA 3CJTA 3ENVA 1FE4A 4LF6J 3CXCS 5ETRA 2WVFA 5DJBA 2ZC3A 3GIJA 4J9MA 2VONA 2A3JA 3NHNA 1JJ2S 3BDUA 3X20B 4ZTJA 4QZVB 4V2SA 5KAKA 3OW2R 2KZMA 1TL3B 1B70B 1RT2B 4C3MA 4X4UA 1FWZA 3IRXA 3U27A 3G7ZA 2ECZA 1ZZNA 4AL6A 3J81Y 1Q86R 4DL3A 2KYBA 2B7BB 2L89A 3BN7A 4Y2AA 4YB7A 1L5UA 2CZ4A 2QJ3A 1OI1A 3BBBA 2VBZA 3TX8A 2GQIA 4DV1J 4TLQA 1TOVA 2QDYB 3LQVA 2IM0A 4C0DC 2C0IA 4A63B 3C16B 1QVFA 4DR3F 2R7XA 4IOBA 3OFGA 2MGZB 3OXLA 3KXDA 1WTBA 4F7UB 4ZCKA 5KE3A 5I42A 1FFWB 4DL5A 2YQ3A 4IG0B 3RU0A 1TAUA 5KYNA 2NXCA 4WFYA 1NBEB 2GFAA 1Q0NA 2BE2A 3QZ7A 3M05A 1JXOA 3M6UA 1IR1A 3CMES 1RLPC 3CMQA 4PLLA 2ZZDA 1OX9A 3DLBA 3HSJA 5IXBA 5CD4A 2UUWA 3QLHA 4I6YA 3QQCD 4Z7YA 1UW9A 2AYGA 3OYMA 2DISA 3OFHA 2ZVIA 5GADU 2Y0BB 3MAAA 2WB1D 5DGAA 1AXQA 1AZSA 5GMKi 1YBAA 4MT1A 4JI6F 1K0VA 1B3TA 5K8NA 4FBTA 2KGTA 4JI0J 1GCPA 4Z88A 2W24A 4GLMA 4LSLB 3OSNA 3L7PA 3VUZA 2ZD1B 4KIAA 2CDQA 3AB4B 2X3XD 3G82B 4LBIA 2CP3A 1U24A 3K5PA 4LE9A 4X1VA 1ROFA 3GSDA 3ZL7C 2DGVA 2B0GA 4B9VA 3QPIA 3BQ2A 3CXCA 1V9OA 1BLUA 3RBXA 1UHCA 5IWAJ 2EFGA 4PQUA 4U6PA 5D0RA 1C1CA 1CSKA 4JRQA 4E7LA 1SRLA 1VRTA 2MQOA 3I6PA 3DHWC 3EG9A 1A0OB 1JNZB 1HI0P 1OSCA 1FFSB 3H2LA 4ZPVR 1IBKJ 2J6OA 1FCAA 1I6JA 3OYFA 1N5YA 1MV3A 1X8DA 2ZZMA 3VS5A 5J3BA 5KG7A 3G6VA 2XMAA 5KFSA 1HD1A 1IXDA 2R7WA 3N5BA 3MEGB 2RM4A 3CNQP 3J7A1 1TUCA 4FU6A 3NTIA 4DR4J 1NB2A 2ASJA 3GF5A 1NPRA 1KR4A 3LALA 2G9OA 2EG1A 1E7OA 1YJWS 3SV3A 1J5EJ 3HVRA 1R31A 1NJXA 2HFUA 4C8MA 1Z1ZA 2CS7A 2XIDA 2YUNA 3RESA 2FIUA 5A0YA 2V8JA 4RW7A 1U8RA 2ZBQA 1ACMB 1D1AA 3ONQA 2ZH1A 3MD3A 3H4BA 4IH6A 1YCSB 2VJUA 3JTPA 3OTEA 5KFEA 1HWIA 4F2RA 2G6FX 5B0CA 1T9YA 5KFGA 5BYSA 4LBPA 1U5SA 4KULA 2V2QA 2Z0GA 4KRTA 1R3NA 3KHRA 2MMYA 2J6KA 3PMIA 3V7SA 1XBWA 2WSCC 2WOMA 4OZ2A 2QQ9A 2NXNA 2QZ8A 3HHNB 2RQKA 2HD0A 2CYZB 2JFDA 5CQGA 1M90C 4UUXA 3OV7A 4WP9A 1H0HB 3FRZA 3HD1A 5FU7C 1YZ6A 4LF6F 2IVMA 4L73A 4C92C 4NYOA 4CIOA 1B7FA 2DNYA 1YJ9T 2F5KA 2NUUG 1TVRA 1U1KA 1HIYA 1C0TA 3BDPA 1FHTA 2IRUA 4UF4A 1MHNA 3I5CA 3EMTA 4CM0A 3NOCA 3KNGA 2K5LA 4K4VA 4RR5A 4NLTA 3UWTA 4Z8AA 3DGPA 3HSGA 2DGOA 2DGSA 5IT0A 2HNDB 1K73T 3EX7B 1QVPA 2WK4A 4FS2A 4PJOE 2KY9A 3DKDA 3GE9A 2E1PA 5A2QU 1C2PA 3T1HF 1TUDA 1Q81T 1GNKA 2E64A 2DHGA 2HK2A 4NLXA 2YKNB 4ES3A 1M0SA 1QWFA 4PJOD 4KAIA 4ANDA 2HBRB 4LF5J 2JXBA 1VQNQ 2HQEA 2OP5A 4DFMA 3QLHB 1JB0E 4ID5B 2ILZA 5RUBA 3E2UA 1C1CB 2F5TX 1LEOA 3CDEA 3HP9A 1TK5A 1DQAA 4N47A 5LL6d 3CC4S 2VVKA 1RUWA 1U1RA 1CC8A 2KYMA 1S6UA 4CLPA 3CC7Q 3D6TB 1AWJA 1QUVA 3MEAA 2RKIA 2ASYA 3KTQA 2J0WA 5E41A 1KQSP 4A8YA 3WBZA 4RTZA 2LLZA 3QWYA 4DR6F 3CDBA 2NUTB 1T05B 2ZM6J 3ISZA 4B3SJ 4RW6A 4K4TA 1WHWA 4LDXA 2P2CB 1TUWA 4ATOA 2KO1A 4DX6A 1PBUA 2Z0WA 4ZVEA 2FPFA 5L39A 1YIJQ 5HK3A 4M7AE 4O4GA 2EK6A 1LKZA 2HQFA 4NLOA 2RK1A 4EZ6A 2XWYA 4ZP8A 2RD5C 1YVFA 4KY3A 3F73A 3RZAA 4QQGA 2XG8A 2QIFA 4G3IA 2NLWA 1GCQC 2XBPA 4FNIA 3DDKA 5FIIA 2BZ2A 2R7QA 2KRMA 3JTOA 5ETKA 2R8GA 3R6GB 1B4SA 3KDNA 3NGSA 2C2ZB 4C8ZA 2D1XA 1A7GE 5AXMA 4AL7A 4FW2A 3DLGA 2DXBA 2YX4A 2PMZD 4TU8A 3JB9D 4WWSA 4QQDA 4B3OA 2QEXS 1ZM4A 3M32B 2XCPA 1WYXA 3M8PA 3NGRA 5IXUA 3EM1A 1TL4A 3R7SB 3JSMA 3OL7A 4I7FA 2YWGA 2CPXA 4LFCF 3THKA 1Q78A 3JB9F 2JOYA 1C1AA 5LJ5f 3THVA 4I2QB 2Z2MA 1Y7XA 2W9CB 4KHPJ 1H2UX 5B0EA 3V8LA 3LF0A 2UXDJ 1D0XA 4BUGA 4OB3B 3V4IB 1SUQA 1PNJA 2MKYA 4YR2A 4KPYA 3KLIB 4JI1J 1NLPC 2W9AA 2W2NP 3KLGA 4EYHB 1YHQQ 5D4NA 3EZ5A 3M0SA 2XMVA 3VGSA 1YFNA 2R58A 1VIFA 3AD8C 5CKFA 2RF2A 2KM8C 3FC3A 2V1RA 5A8KA 1TAQA 4DSKA 5LMUF 3GLJA 3BYPA 1XOVA 3PKYA 2ADBA 3NG8A 1K47A 4FT4A 4EO6A 2FO0A 1VQOA 3TZYA 3G4SQ 2X35A 3OS2A 4PXBA 2QFIA 1IB8A 4G6VB 1QQJA 4G1PA 2DGXA 1WXTA 4QVCA 1G3WA 3PVLA 2DEJA 3I31A 2CQIA 1YRTA 2B51A 2RS8A 2R9LA 2NXUA 4LR8A 4KFBA 2MB0B 2UXBF 2A6MA 1N52B 3ET6A 3BE3A 1R0AA 4M77E 2EK1A 1SH3A 4A47A 4OYPA 1QKXA 1U6ZA 4OLOA 2ZWOA 1FVSA 3CEDA 1NDCA 3UDEA 5IQQA 2FLLA 2HLUA 4M77D 3CDUA 5EG2A 4M5DB 1IKWA 5GAHI 3VS4A 2A7YA 2W9BB 5LMNF 1B0VA 1VQ5S 3PHEA 1QJHA 2RQVA 3IR6B 5T41A 1TV6A 4F0MA 5KFRA 1CJKB 4CO4A 3MTJA 3PIOQ 2HQDA 1FWPA 3QPHA 1R8PA 2A6OA 3F0NA 4R5PB 3L2QA 4F7VA 2E6NA 1YI2S 2DYAA 3G4SS 1L3SA 1HD3A 4PZVA 2J7KA 1UGVA 1G83A 1VRTB 2QMUB 2QMWA 3SI8A 3GNFB 4GLKA 4FF4A 1QCOA 1S1UB 4M78C 3NL0A 5KFMA 3O8WA 4X2BA 3BSNA 1JLCA 2RJEA 1ZTTA 4HXJA 4NI2A 4MKBA 3TWZA 2M70A 5FROA 1PKSA 1JKHA 2OPPB 1WWHA 2VG7B 2QL9B 2XKOC 1X4DA 5D6GA 3A8HB 2XSJB 4FF2A 2CSIA 4PJOB 1FNOA 3UD5A 1YIJS 4QW2A 3HULA 3I82A 4PEOA 4MIWA 3ASKA 4ZPCA 2NYIA 2OPQA 5LT5A 4BS2A 4X84A 1HQEA 4OI0A 3BGUA 2BX6A 2UVWA 3QNWB 1UKUA 2DTHA 1NK7A 1VQ7T 1X6OA 4F17A 1WG4A 3JXOA 4JOUA 3IS9B 1QAYA 4TN2A 2WSFE 4F4AA 1VYVA 3D4JA 4UQTA 4M4ZA 2XO6A 3H5SA 4WE1A 2FB0A 3HF5A 4RNNA 3HHEA 3M4YA 2J7UA 1LW2A 2K2MA 3GTYX 3VVUA 5J2QB 3M55A 1BQNA 3K8VA 1RTHA 3HLUA 3BGOP 1RP5A 2FYXA 4CLSA 1HMVB 2E44A 2EIFA 3KOAA 1I1GA 1YN8A 1M90U 4LFAJ 3T3FA 2W7OA 3OQ5A 1N8RU 4F7UA 2QL5B 3H8YA 1XMOF 3DRPA 1S9EB 2C2OB 3T19A 3MJXA 2LP4A 2FJBB 2DXEA 2AQ4A 5HQ8A 2RSQA 3SYZA 4RMOA 1QVGR 2KE9A 3PJ9A 4CWBA 4HI1A 3CD6A 3S3OA 3IG1B 1S12A 4QW9A 4WJBA 4PNOA 1IBCB 4CI0C 3K5MA 3OUYB 4DBRA 3IRXB 4OI3A 2F8EX 3GV5B 1NKEA 3NRBA 4J9CA 1FTCA 4P5NA 1O8BA 5I11A 4MKVA 2XMMA 1RK8A 3FEZA 5IM0B 3MR3A 2DXTA 1SXLA 3DDNA 2R7UA 1ZX6A 3R6NA 2KFZA 3Q8VA 4A48A 3A8MB 4J8OA 3D3BJ 1KFSA 3MP6A 3JCMW 2AT1B 2WONA 1M27C 1HBNB 2DLPA 2EBPA 2ZH5A 4QWDA 2RHSB 3UCZP 3LLRA 1N88A 2FHKA 1TS9A 2V8PA 2DPIA 5J2MA 1VHIA 4OF1A 4N77A 4ED1A 1KQSS 3UWNA 1JO8A 2HURA 1IO6A 4K4YA 1M5SA 1SC1B 1I1JA 4XO0A 1BIAA 2C2NA 1HQ2A 3A98A 3ZZTA 1SC6A 1VGYA 1JNRB 4H54A 2I5JA 3LGNA 4MZTA 2AJFE 5A6WA 3AJDA 3I55T 4MKAA 4CI0B 4IYQA 1QVFR 1PC5A 5KG3A 2ZH7A 4HTJA 2CZ9A 3S8SA 1S0MA 4M75A 1VDHA 2FHDA 1YWXA 1FFGB 2CQ2A 3TX0A 2Q79A 2NUPB 4C8YA 3CD7A 1H7XA 4A53A 3L1AA 2RJDA 2V4RA 4BDPA 1VCTA 4YY3F 5IC6B 1D8YA 2KXNB 1WSVA 3DOKA 5J26A 1U06A 3D67A 3EE3A 4JUZA 3AD7C 1RT5A 3MEGA 3A4TA 3K5LA 1AA1B 4C0HA 4IFYB 1Q82U 4TLRA 2QFJA 1WHXA 5GAOp 1S10A 5D77A 1UFLA 2JMAA 1BIBA 3DOKB 1MROB 2YPZA 4AXIA 2MLXA 2EGCA 4M77B 1N9RA 4HCBA 1Q53A 2CG4A 3EGDB 2V68A 4N4IA 2AV5A 4Q5VA 2M8DB 4K50A 5LM7E 4ZJLA 1DTTA 5HJXA 1K1QA 3ZBDA 2YNIB 2VOPA 5IV4A 4ZKAA 2CQ0A 1PM3A 2QQAA 3JB9H 2K7JA 1F6TA 1YTYA 3W61A 1TKXA 4PYAA 2KRNA 4ZVTB 3B78A 4NA3A 1UEVA 5DG7A 3SDEB 2HVHA 2MZJA 2DKOB 5GAN8 3JCMf 1G5VA 1UP1A 1JLBA 2CT4A 4DSEA 1YWPA 2NLUA 1TMJA 2I8EA 3EG9B 3GFXA 2HS3A 1N5SA 2X4JA 3CJ5A 2LU2A 1HNZJ 3CCST 1FMWA 4FT2A 4ZJQA 3I9ZA 3M4XA 4JI0F 3MHXA 1V6HA 3CCRQ 4RW4B 3Q83A 4C9DA 5IXFA 4A46A 1EETA 4K7QA 3TANA 3CMEA 2CQ4A 3NGTA 1IBLJ 3CMAA 5LJ3e 1BQXA 2HYIB 2YXLA 1BBZA 5E5NA 2FVPA 2FJDB 2YKQA 4NLRA 2LQKA 4X4OA 2LJ3A 1HW8A 5CKHA 3OS0A 3IGVA 4ZN1A 2UZAA 2EQKA 4C97A 3OA6A 1HYSA 2RHUA 2KXCA 1UVNA 3PE0A 4KRWA 4N0AC 2QA2A 3BZQA 1JJ2R 5FLXU 1Q7LB 2COWA 4ECXA 4DL0C 3WVDB 1KNZA 1K76A 2ACMA 3EGUA 3H40A 3G4SA 1YBTA 1F0XA 1M8VA 1M9SA 1EP4A 3C15B 4C92D 3LAMA 2GFUA 2R8IA 4I1TA 3M30A 4NRTA 4ZVRB 1YJTA 4DV0J 2HWHA 2PNIA 4RCBA 3CCQA 1K44A 3EVOA 3OPKA 3MAQA 1EETB 2OX7A 1JLAA 3BGFA 3VAHA 1NEBA 4Y65A 4PUOB 1TWBA 3REBB 1TKTA 2XNRA 4WFNQ 1SKUB 3C2PA 2UXDF 1N5TA 3NMRA 4ECYA 2M9UA 3A8KA 1PBAA 1VYAA 2O66A 3QSYB 5GMKm 2ILYA 3O2IA 5K14A 2YY3A 2N7YA 1BU1A 2O1PA 2NPFA 2ROEA 5CZXA 4LRFA 3M4GA 3ZZYA 1XNIA 2Y4XA 1OPKA 1EIFA 1LNQA 2V8GA 3DGPB 4DV3F 1MWQA 1VC5A 4ICLA 2DKGA 1RWNB 3TZWA 3C6TB 1PILA 1AFIA 2WACA 5GAEU 1X4EA 3SDEA 2LRQA 4H4OA 4OL8A 2XMKA 2R7OA 1SSFA 1IGUA 4K4WA 2XMWA 1SKRA 3MR5A 5LJ3h 4DSJA 4B17A 1WNLA 2BIVA 1OOTA 2LQBA 1GMWD 4M94A 2BQ3A 3EH2A 2BJ8A 5LJ3Y 1RAJA 2JHEA 3FVYA 2B4PA 3DLMA 5KYXB 2IVFB 4M77A 3JSCA 3JAME 4RKUC 1DARA 2XSFA 1X4BA 3DLEB 4CLKA 4NMLA 3K58A 4KQZA 5T7LA 1PSDA 2LJ1A 1KP6A 5LJ5h 3W3SA 1S1NA 1G1XA 2BKPA 3OYGA 4YHHF 1RGVA 2GVZB 1UA1A 1NSQA 4YR3A 5KG1A 1KOOA 2ZZTA 5DRKA 1U1LA 1CBKA 2CZ6B 5HMYA 1VQLA 2K2PA 4B9LA 2DXFA 2MQNA 2FY8A 2HQHA 4H4MA 3N6NA 3N6MA 3Q24A 3CULA 2LCSA 1D0YA 2E6ZA 1T02A 3HSBA 2KXFA 3UDLA 2MOXA 1T0TV 3BBFA 2PU9B 2ROPA 4ZLJA 4ANJA 3SV4A 3CXCP 4WK3A 2G13A 5IT9U 1B34B 4Q5WA 4J7FA 3RG6A 1OWXA 2WCXA 1VQ4Q 1P6TA 2VB6A 2B6AB 1N5YB 4L6V5 1G7CB 4NLPA 4QBUA 2FVQA 5CA5A 3EDQB 4X66F 3M6XA 4YP3A 1WXUA 2H48B 4PG4A 1X4CA 4P7TA 4EUVA 1RTDB 5GAMe 3GJTB 1UMJA 4NA1A 5B09A 3P4UB 1JLEB 4NCGB 4WF9Q 1RT6B 3CC4A 4AL5A 3LP2A 1U2CA 1W1FA 2XMUA 3UE2A 2R8JA 4I0WA 5AYFA 2B8AA 4GO7X 4I68A 1Y96A 4D3HA 3L2RA 2HIQA 4RBTA 3BO2A 4DPXA 1WX6A 1WF0A 1IKYB 2Y9HA 2HVEA 5GAOm 1UZHA 2NUZA 4FM4B 1AB8A 4F7UG 1AFJA 3IXQA 3A8GB 5HQLA 1IR2A 1DZ5A 4B9XA 1AYEA 1GFWB 1S1VB 3VWSA 4CLUA 1QP3A 2W2MP 2VPZB 1K9MR 4CYUA 2KN4A 3B8HA 2DIQA