2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
2IG0A 2MWPA 3CCMT 3OW2A 3G71A 2G3RA 2E70A 3G71T 2OTJA 1NJIC 3J81E 3CCJA 3G6EA 3CCST 3CCET 2EIFA 3H7HB 3CCJT 1VQMA 3J7AF 3G6ET 1W2BA 1VQLA 3TREA 3CC7A 3CCLA 3PIPA 4TVRA 4X34A 2OTLA 3CXCA 1Q81C 3CC7T 1YJ9T 3DB4A 3I55A 3OW2S 1KD1C 2OTLT 1M1GA 3CMAT 3CCRT 1RL2A 1YBYA 2L3RA 1JJ2A 3HKSA 3I55T 1Q86U 3CCQA 3G4SA 1YI2T 1M1HA 5J3BA 2JNGA 5HY6A 3G4ST 3CCQT 1VQKT 1M1KC 2DO3A 1W2BS 3LGLA 1NPRA 1KC8C 1K73C 3CCEA 3ER0A 3CXCS 3CCSA 2QA4A 1VQNA 1S72T 3PIOA 1YJWT 2QA4T 1IZ6A 1VQNT 5DLQE 1JJ2S 1Q81U 1K8AC 3CPWA 1YJ9A 1N8RC 1Q7YC 3CPFA 3CMAA 3CCRA 4QQDA 1M90U 1K9MU 4RG2A 1VQ8A 1YI2A 5J26A 1VQ8T 1YIJA 2QEXT 1M1KU 1VQKA 1QVFA 1YITT 1SSFA 1KHIA 1YIJT 4ZN3A 3DLLA 3J80E 3A5ZB 1YJNT 1NJIU 1VQ7A 1NPPA 3CCUA 3CPWS 1VQ6A 4CRIA 2JUFA 1S72A 1YJWA 3CCUT 1VQ7T 1VQPA 1VQ6T 2OUGA 1VQ9T 3LH0A 1K8AU 1VQPT 1N8RU 3CC4T 1Q82C 3CMET 3CD6A 2MWOA 2LVMA 3DB3A 5A2QE 1QVFS 2K06A 1KD1U 3CD6T 5DM7R 2KDSA 1VQ5A 3JAME 1XTDA 3KBGA 2LCLA 1Q86C 1VQ5T 3LGFA 2QEXA 3EWGA 3I56T 3QQCD 3LPEA 1YITA 3CCVT 1KQSS 1YJNA 2XHCA 2KVQG 4ZN1A 5IAYA 4YTLA 1KC8U 1EIFA 1QVGA 1K73U 2OTJT 2E6ZA 2JVVA 3CC2A 1X6OA 2LQ8A 1VQ4A 1VQ9A 5LL6S 1YHQA 3CC2T 1VQ4T 1KQSA 1BKBA 1Q82U 3CC4A 3CMEA 1VQMT 1UEBA 1YHQT 5FLXE 1VQLT 1NZ9A 3CCLT 1Q7YU 1VQOA 1XNIA 3OYYA 2JOYA 1K9MC 1M90C 2EXUA 1VQOT 2CKKA 2MI6A 3P8BB 1NZ8A 3I56A 3CCMA 5IT9E 1QVGS 3CCVA
chains in the Genus database with same CATH superfamily
1AW0A 2FIUA 3JTNA 1KQSP 1N5SA 4I67A 3R27A 4C8QB 1VK8A 1MWQA 1DURA 3C6TB 3G6EA 1UJ6A 2PFFB 1BHNA 2HQFA 1NDPA 1VQMA 5U47A 1D8YA 5DY9A 3A3NB 1F2GA 1S7IA 1VQKT 5DG7A 3ME9A 1PKSA 4RLEA 5HAOA 3P5BP 3LGMA 1JNRB 3CCLQ 3O5ZA 1EP4B 3PJ9A 2Z0GA 1RHJB 4B9SA 1XERA 4HVZA 2LLZA 3VZHA 4HCCA 1VC0A 4DS4A 2EJGA 4Y2MA 3RR6A 1WG4A 1XJWB 4F3OA 5IC6B 2X51A 5C5JA 4LF9F 1G3WA 1JLBB 2BX6A 1K8AU 4NCAA 4OMLA 4K4VA 4F4YA 2BTTA 2NUTB 2LT4A 5HMXA 4PJOB 1K47A 5D77A 2E1AA 4PQAA 2EVZA 4QWEA 3CT9A 3HT3A 4C8QF 5LJ5Y 1U45A 4EPCA 5CYJA 1KFDA 3AXKA 5DS7A 2K2VA 5GAMe 4HHHA 4MH8A 4HCZA 3OR1A 1QVGP 2RB7A 3E01A 2DTJA 1EZZB 1WJQA 2H48B 2YLBA 2DXUA 3CC4S 4J9OA 3UR3C 1C0TB 4N77A 2DGSA 3V6JA 1F9HA 4FVMA 1SUQB 4HH0A 4RNFA 2LQ5A 4B02A 2KRRA 1KOHA 4J7CA 1QLNA 1S1WB 1X4AA 4ECWA 2UUAJ 2V9KA 2EFNA 4DV6J 2RM4A 1YJ9Q 1OYDA 2YH0A 2JH3A 4OB0B 1YJWT 4C92B 4J9BA 4JI7J 4KBMB 3SWNC 2AZVA 2DO0A 5FDLA 2GVZA 3L2ZA 2DR9A 2HWIA 4OMPA 2YRVA 4PJOF 4AFZC 2RRBA 1WHGA 2VG6B 2VU5A 2ZHOA 2EFGA 2KRBA 2WVBA 1PD1A 2FD2A 1I5LA 3A5ZB 1JRIA 3PNWC 3AY0A 2HWHA 5J2MA 4K7QA 5D4OA 3TZWA 1VQPT 2RS8A 3NTIA 4F7UA 3TJAA 4M8LA 1RA6A 4KV8A 1IBCB 3MEGA 3JB9D 5IM0A 2LCLA 2Y1IA 3RMSA 2M88A 1VQ7Q 3RMQA 3UWNA 2FLPA 2BZ8A 1HJDA 5GAHU 4PWUA 3TVTA 7FDRA 3H20A 4GKKJ 3V7CA 3M0RA 1FRIA 4OZ5A 2ZD1A 2W2PP 4O4RA 1C1BA 1HI1A 3LGNA 3SDZA 4LF7J 4JV5F 3M8RA 3H0IA 2X1FA 3BQ2A 1I0CA 3P8BB 4UW2A 3A8JA 4J6WA 3H2VE 2GA7A 2DEIA 2DIUA 2HS0A 1LJOA 2ZITA 2KYMA 4L6V3 3FC9A 3GF5A 2BMBA 2VFVA 3NXZA 4M7DA 2QA2A 2PTKA 3OSNA 3RJMB 1V6HA 3M0UA 4DUYJ 2GFUA 3E9FA 2KRMA 1MWZA 1YNZA 4QU7A 2ZWPA 3J7AN 1TL3A 3LW5E 4U96A 2FRYA 4LRAA 2PUOB 2AGQA 2HL5C 4NZ6A 2QQ9A 4USKA 4AL5A 3JCMe 2RRAA 1VRQC 4G1PA 2PI5A 3LALA 4RW7A 1Y10A 3CPWP 4M5IA 2FJDB 2DNUA 1BI2A 1N8RU 1G5VA 3GG0A 1TH7A 3US5A 1QVFS 1EJ7L 3JRZA 5DM7R 4USMA 4DV7F 1ACMB 1VIXA 4K8RA 2DNQA 4JUZA 1T3NA 2RI5A 1SJ3P 1BD6A 4KB7A 1HR0J 4BS2A 3BYRA 2G2YA 1VQ4A 1GX6A 3MM9B 1NM7A 1T02A 2HG4A 1W26A 2LA6A 3GV7B 6AT1B 1WKLA 1BGXT 1XMBA 2CP7A 1LXJA 2IMOA 2E7XA 3TA0A 2R4FA 4B9NA 1FRJA 1L5UA 2MLZA 3MR3A 2H54B 3T9ZA 2Z56B 2MGZB 4ERDA 1TKZB 2B0GA 1UFKA 3KLFB 3OXFA 1RTJB 4H4KC 1YCSB 4I6WA 2Y1RI 2NWMA 1YBYA 2DY9A 4HT8A 5IXFA 3TSZA 2FYXA 4OYAA 2AZSA 1VR6A 2FZKB 1CSJA 3UE2A 3SWNB 1TZ0A 3PEHA 1SCJB 2BZ2A 2EW9A 1Y5NB 1R8AA 4QVDA 2CP3A 2VA3A 1S6UA 4A46A 1VQ8A 4NA1A 2BJ3A 1FFGB 2MZQA 4LMZA 4YMEA 1N6QB 3C15A 4U6PA 3JCMc 5GADI 3IGVA 2M4MA 1RHUB 1Q81R 3NGKA 3M0PA 4NZ0A 3Q22A 3E1SA 3W5XA 3OBYA 4CLKA 4DR3F 3M9MB 1QVFR 1Q82C 3VTIA 3TCJA 3DRPA 1YJNQ 4W4MA 4WXWA 2OHDA 1AZEA 4QR2A 4PUOA 1CJKB 1NHVA 5E3QA 1TSFA 2QXFA 4WIIA 2IMWP 5D6XA 1OOTA 4CLZA 1QWEA 1PRMC 3CCLT 3H8ZA 2CQ3A 2X3XD 1KLMA 4JYAJ 1JX4A 2WZ1A 2CJBA 1CJTA 1W7WA 3NBPB 5HQLA 4ANEA 2K5FA 3KDOA 2AW0A 3NFCA 4HL9A 1NSPA 5CQXA 3CCSS 3CGIA 4LFBJ 3B4DA 4A4JA 2XY6A 5IT4A 2IRXA 4KHMA 2K2PA 1SEMA 3JS9A 2CDTA 2BOPA 5KFAA 4TNOA 3KK1A 2KO1A 4C5HA 2XGPA 2A6OA 1I1GA 1JEGA 4M77B 1JJ4A 3NOGA 2YNHA 2RO0A 4CRIA 2OMLA 3J7YI 5GAOm 4NLOA 4LF8J 4TU8A 4FF2A 2PN6A 8ATCB 2PDAA 2ROLA 1V1CA 1WJ9A 4LVOP 3RRHA 1K8AR 2HMIA 1WEZA 1WJSA 3G86A 2QK0A 1Y7XA 1HW9A 2H51B 1OQ3A 3CC4A 1LFPA 3IWXA 4N4GA 1RT5A 3OMCA 3ZZOA 1H74A 2PU9B 3MEDA 4J9UE 3X26B 4KO0A 1M4ZA 2HSPA 1E6YB 2G3RA 1JXVA 1N36F 1PSFA 2DNKA 1ABOA 5ETNA 1VJWA 3ZNJ1 4RO0A 1AZGB 4M63A 2EBPA 2DYIA 4M5DB 4X4PA 3SSRA 3NWRA 4C8KA 1R8HA 1UJ0A 2B4OA 4HEA9 3REBB 1S1XA 4Q8EA 1M1KT 1HQEA 2HW3A 4M77F 3M53A 2V0NA 5K8MA 4A4KA 3TAMA 2Q1LA 4ED6A 1NDLA 1T05B 4F14A 4P2FA 4KGKA 4EDUA 1MHNA 2J9CA 2LQJA 3SQGA 2XY7A 2QC3A 4UTGA 1OYXA 3G82B 2VDHA 3NCQA 4FYWB 4FCYA 3UATA 2AGPA 4JI3J 3VV2B 1T3LA 2YQ3A 5DLGA 4PR6A 1QDUB 2KSSA 4KBIA 4KFBB 3OTCA 2NXUA 2P8IA 3N28A 5CYQA 3SYZA 1J5EJ 3UWTA 2FGOA 4K5RA 4B9XA 3ASKA 4C0OC 3FJ2A 5B0FA 1UGRB 2OPQA 3P49B 4F7VA 4RNOA 5CQGA 4BY6C 1UEVA 1S97A 1MGQA 4DEZA 4QW2A 3MEEA 4A8OA 2YWKA 4HDGA 3RAXA 2HVHA 4HTIA 4CO1A 1L3VA 5GAN3 2GHVC 3X20B 1WG5A 3NGDA 1VIEA 2ZJQQ 1DTTA 2UP1A 4F26A 4IDKB 3OB9A 4RTZA 3VQSA 2M8HA 2VKNA 2CWXA 2FPFA 2WVEA 4M5GA 2CZ4A 4DV0F 3CE8A 1YJTA 3T19A 5CD4A 1R6YA 1LW2A 5AXNA 2MKCA 3AQOA 2KYBA 4LR7A 2LQ9A 4HH1A 3I55S 5KT4A 4JI6F 3MO8A 1TU0B 1K44A 1URNA 4ED0A 4ZCMA 2IC3A 1RP5A 3UF4A 3KG0A 1IKVA 1QVFA 4Y3CA 3BGUA 2IPOB 2JHEA 1Y9OA 1TXQA 1WXBA 3QNWB 3RAMA 3QHSA 4ZGDB 3VAJA 4XTZA 4AXJA 1R27B 2X3DA 3TZZA 3QMQA 4PL6A 4FPRA 1O0PA 3JQMA 3OBWA 4C8QG 4KSEB 3N6NA 1GNKA 5KE2A 4LDXA 3LPEA 5IT0A 5BYRA 1RSCA 1RWXB 3TX0A 1N8RR 2XCPA 2F8MA 3O8VA 4U7UK 1KHVA 1TK8A 3RDVA 2B9WA 3HVWA 5KFGA 3VR1A 3QAUA 3VJPA 4D8DA 5DG9A 1LWXA 4Q8FA 2K2MA 3Q8RB 2HEKA 2B8AA 1FXDA 3FK4A 3ZTRA 3OTEA 1VIOA 2XSJA 4TLQA 1RZMA 3DKDA 2A3LA 4NWBA 2K9GA 4QW8A 1FF2A 4XTUA 1U7LA 3I32A 4OZ3A 2JNGA 3CCJS 4OX6A 3G6EQ 1SPKA 3FC3A 4DR2F 4MYTA 1ZAWA 1WHMA 4PJOG 4X62J 4N8OA 1DAXA 3CPFA 2J0XA 2XEXA 3OBIA 5ITHA 1ZS6A 3FBCA 4JLIA 3LWIA 4WTYA 4C11A 5HKCA 4LE9A 3GPAA 3HLUA 3H0PA 2P2CB 5FLXU 1U1QA 3EG2A 2V34A 2MWOA 1PYTA 2V8KA 1YZ7A 1BBZA 3I0RA 4BY6B 2YX7A 2F5TX 3NP5A 2OKQA 3NCRA 2UUTA 2W4PA 1E6GA 4DPUA 3N5BB 4ELUA 1EX8A 3VUBA 5J2QB 4I64A 2P9GA 2I38A 2AT1B 2E5LJ 1TVRB 1JKHB 4J9PA 2HKEA 4EIKA 2E3IA 1N5YA 2ZZMA 5LMNF 3I9ZA 4K4YA 2DNRA 1S1UB 4B3TF 2H4WB 4OZNA 2HNYB 2MQNA 4AYBD 1JU5C 4W98A 2FEIA 4WFAQ 2DH7A 3KJVA 4XDCA 5E3RA 1F1BB 4HVVA 1RT6A 2LEPA 1FDNA 3ILOA 1I81A 2BANA 4FF1A 4IUTA 2DNMA 4ZVQB 1KJWA 3MEKA 3LP1A 4F17A 4CM2A 2J8AA 1Q8KA 5C42A 4JI0F 2D8JA 4KYZA 5KG3A 3CJRA 4RTTA 1SRLA 1F5BA 2RQCA 3M32B 3N79A 1FRMA 3IWLA 2EC0A 3MP1A 4LIRA 1X9SA 4RJVA 3PYDA 4PQUB 2OFHX 3MAQA 2X35A 2HAXA 1AVZC 2K5LA 1NSAA 3CMET 4CO3A 2EWNA 1MNDA 2MKJA 2CP0A 2OJ2A 4C0GA 4X4NA 3B78A 4DLEA 2AF6A 3GBQA 1WOOA 3MUTP 2R3VA 5C2GA 3K8WA 2XS7A 2RK2A 2PGCA 3VS1A 2ZPIB 1U6FA 1BY9A 1M5VC 4J9NA 3OYHA 2XO6A 3HKWA 4DQQA 4M7AA 2XTJP 2E1PA 1UPPA 3HRUA 4N76A 2IG0A 2YTCA 4EFAC 1HFEL 3HHLD 1VQLQ 5GAGI 2GVDA 2B4UA 3MJXA 2PI4A 2GC8A 3HDSA 4ITSA 3DRSA 2X4YA 3AJ2A 4MMKA 3TREA 4IFYA 4FS1A 4F2SA 1EAYC 2VKZG 3G71S 2PZ1A 1S12A 1SJ1A 3VGUA 4M78E 3VQTA 2QMUB 4WFZA 4ANCA 3QYGB 5KG2A 2ZPGB 2IYGA 2DT9A 4ZVFA 4IURA 1VC6A 3QZ9B 2E5IA 4LBPA 1D9AA 2IY5B 2XK0A 2HVDA 2XNRA 4ECVA 1LNQA 3MPDA 4CC4B 2DR8A 1WTFA 3LOUA 3AD9C 2C0OA 2JEFA 2JUFA 3CCUT 3LLRA 4V2SA 1JWWA 3FKBA 4DL0C 1SPBP 3M0SA 4BBYA 5A0GA 2HURA 1GTEA 2JRSA 3GSDA 3QGIA 2DZ9A 5IT9U 2RHZA 3DMJB 2QDYB 1OSCA 3KMQA 3M2RB 2BKOA 2WSFC 2WTFA 1F5CA 2ACMA 4JUVA 1NJZA 1ZUKA 4DSLA 2JX2A 2DNNA 1SV5B 2L9WA 3L2WA 1RAGB 4X4VA 1Y71A 3A8EA 4FNHA 1QCOA 1UAWA 2KNBB 4RUCA 1VQ4Q 2V50A 4DR4J 1QVPA 5EWEA 5CAAA 2V6AA 3OD2A 2JDJA 1S79A 4KAIA 3TUPA 1ZA2B 3NNAA 1YVFA 3B82A 1WIEA 3I55A 2VFUA 4NOYA 1U0HB 4J9FA 4C8OA 2AHOB 1RTDB 2DL4A 2AX1A 1M30A 2JTMA 2FVQA 4DSIA 5J2PA 1VQSA 1HQ2A 4ECSA 4OYXA 3J7Z5 3HHKA 5GMKh 1P9YA 4KRWA 2QO3A 3ILIA 4DCOB 2XKOC 3LP0B 1JLFA 3FEXB 2RNAA 1G3TA 1WACA 2YHTA 3W62A 1UETA 4OZ0A 1C6VX 2F1LA 4CI0C 1VMBA 1PRLC 1MMDA 3CMAS 4M75C 3DLGB 2Q6BA 1VQ8Q 3VS7A 3KKFA 1ZBTA 1AD5A 2H1YA 4ZP8A 3ZZTA 4MFBB 3CJKB 1FRLA 2VUGA 2CQIA 1S5ZA 4QW9A 1FJGF 2HFUA 2NPIA 3KG4A 2JM9A 4A54A 4ZN1A 5IAYA 2KBTA 1TL7A 2GS8A 4DR5J 1U1NA 4IOAQ 1GQEA 4A4GA 3ZTSA 1OIAA 3I56Q 1VQMT 3LW5C 3HVTA 3OYDA 5A76A 3CJ3A 3IM8A 2V4JA 2DR7A 2VBZA 4EMKC 2M16A 4GKJF 2MZTA 2YKOA 1G7CB 3CCJA 4DU7A 2YVSA 3HD2A 4E7IA 3HPOA 4M77G 3PRDA 3PMTA 4GKKF 4OHXA 2LQNA 3WC0A 4OI3A 3VAIA 4KHRA 4ED3A 2VONA 3W9HA 2ZFHA 3HSDA 5CIUA 4X4SA 4LF7F 1W6XA 4C0FA 3H25A 1PSEA 2VODA 1JQGA 3CWJA 5KT7A 3W5ZA 1UDLA 1UP1A 3MECB 3PW0A 4R0JA 4YDDB 2EQJA 3Q83A 1RQ0A 1S9FA 3K7RA 4CT8A 1TKTA 2VDIA 3H5UA 3BJYA 5GAN4 3R7SB 3V4IB 4DV4J 2K5IA 2D6FA 4DU8A 4ZPBA 5KYYB 3LX7A 3GFHA 3VVUA 5A8WB 1KRPA 1D0EA 2FVCA 3ET6A 4Q43A 2XYGB 5EGYA 4CLWA 4OMFB 5D3GB 2A10A 2EAYA 3CDBA 4ICLB 4I2PA 3R5BA 2LMIA 3I5SA 3QWUA 4XTYA 5F9NA 3M58A 2VKRA 3AJ1A 2QQRA 3PVLA 3JCMV 3VZIA 3NG8A 4NPOA 1K1SA 2P0QA 2E5HA 2G2OA 1UEBA 3MTJA 4K11A 4II1A 1UVIA 1KKHA 3W9IA 2OEJA 1N48A 5GAHI 2QSWA 2B8QA 3EG9A 3MM6A 1RWVB 1QSSA 3M8ZA 3K17A 4Z2XA 2HQIA 4J6YA 4Y00A 5HQMA 1RWNB 3I6PA 3HFOA 4B9LA 3CBOA 3TO8A 2D3O1 4CC3A 1OX9A 4OL8A 3QJJA 3OYFA 2RDIA 1SVDA 2XHWA 1NB7A 5GAOp 3QSUA 3NNHA 3HSBA 2NXEA 4RG8A 3F44A 1HBUB 5D0EA 4CRJA 2VG7B 1A6LA 4O0IA 3H2LA 5CYMB 4CI0B 2YT6A 4DFPA 3KFWX 5T7LA 4M75B 2HKNA 2EEYA 1P6TA 2RIJA 2F2WA 3X25B 2WAQD 1WA7A 2ZH1A 4Z7CA 3MMCA 1CJUA 2OEMA 4LJMA 4PPZA 2RU9A 1XEZA 5F8IA 2HHPA 2XMVA 3MM7A 3MM8B 1S59A 4ECUA 3G8QA 3RBZA 1ZSZA 1QSYA 5HL7Q 4CCHA 4LF5J 2O01E 4DQ2A 1GXTA 2IM3A 2OPRB 2YKNA 2Q3PA 4J7IA 2BE2B 1QW1A 3ILJA 5F8HA 1LNXA 1TUWA 2JXBA 2RE1A 1FERA 4RUAA 2MKSA 2RQKA 3CD5A 2HEQA 4DS5A 3G71A 1SC6A 2ZEJA 1FYNA 2CQBA 4LF6J 3FB9A 4KV8B 3S3MA 1U47A 3PIPA 3KNAA 4X34A 4F7UE 3KLHB 4ZCIA 1EB0A 4GVBB 5DDQC 5EHHA 4RCCA 4ANJA 3EGXB 2DR5A 3G2XA 3VAFA 1APSA 2MY7A 1NCLA 4M75F 3VAMA 2E44A 3FVYA 2I5JB 1JLQB 2FDNA 1WOPA 3KUEA 4JPBW 2Z0WA 2ZBPA 3TP2A 2M0YA 4RUHA 2DXTA 3UQSA 3MM5B 5E2QA 3ZTQA 2L48A 4LSNA 4CLYA 2KFYA 2V1RA 4IUVA 5AE1A 1MMNA 4RW8B 4DG1A 1BI0A 3PFOA 4ZVOB 1U1KA 3PR5B 3T1HJ 5B09A 2EGCA 5DO2A 2HHHF 1S6QA 3RW6A 4LFBF 1L3KA 3RRKA 1VCTA 2R8JA 1QVFP 4Q44A 4M7DE 4QBUA 2EPDA 4KT0C 2M2BA 4HVWA 1O5JA 1DLOB 1E7OA 5GMKm 1IXKA 1VQPS 3CJ4A 4FU6A 1XR6A 3CSKA 2NQPA 3KK2B 2EQMA 1Q82U 3PGGA 2CNOB 3ISND 4PG5A 1B7YB 3TYTA 1FEHA 1OYEA 2N3LA 1TKDA 4Y65A 1CJVA 2W1BA 2MZSA 1G1XA 1WXTA 4CH1A 4IG3B 2D9OA 3CJ2A 4C8MA 4DFKA 4LNPA 4TYBA 1IKXA 2BW2A 1PAEX 4TVAB 4M5JA 2RRNA 3SEMA 4OYBA 3DLHA 1KQ1A 1VOMA 2W8KA 1XN9A 1QKWA 2VA2A 2GIFA 1BI3A 4LT6A 1B4SA 2DISA 4TKTA 2CH4A 3DLJA 4M7DF 3G8TA 4MIBA 2DKGA 1XIQA 1FXLA 3CMAA 3EGUA 1S1TB 1B7FA 4HKEA 3VGSA 2DEUA 2HBPA 1YG0A 3KOAA 3BBBA 4NRTA 4ZPAA 2YNGB 1NDCA 1FCAA 4ZVUB 5IQ6A 4USWA 3QLHA 1WC1A 2L3MA 1N5ZA 2PEHA 4J9VA 2RHYA 3FEYB 3TW0A 5EDWA 3WXMB 3JB9J 4AG2C 3B54A 3N6LA 4OZ1A 1N32J 4KH0B 2KAFA 1Y96B 4CH0S 1RCXB 1UFFA 2PEBA 2GQ2A 1X4DA 1J3TA 4XQ3A 1Q7YU 1IUJA 2V4RA 1OY6A 4JI8J 4EBCA 4KGMA 1VRTA 5E41A 2QA1A 3HRTA 1RT1A 1J5EF 1AA1B 2DJZA 2PA8D 4WYLA 5KFIA 1WSVA 1IM4A 1H2UX 4F36A 3KLEA 2AJ1A 1RT3A 3JB9I 1AB8A 1MNEA 1IQZA 3MCAB 4PUOB 2PO4A 3CCSQ 1TV6B 2M70A 3IR7B 4TXSA 3JQJA 1KN6A 2XICA 2VOOA 2L08A 4IIMA 4C8QA 2DRKA 1JXEA 3C6TA 1L3TA 3O44A 2QL7B 2CT3A 1OULA 4DOZA 3BDUA 5D4LA 5E3CA 3I4PA 3CXCR 3MCSA 4AE5A 4JI2J 2QL5B 2QEXQ 3CC4T 4C8QD 2CZ9A 4DDFA 1EP4A 3ZZPA 4AL7A 2CPJA 2WSCC 4LQ3A 4MKAA 2ZDOA 4QR0A 1NKEA 2WVCA 3IG1B 3FEOA 1KQSS 2XHCA 2D0QB 5IXBA 3IP0A 1OV3A 1UZHA 1Q4RA 1M27C 4EI2A 3EGZA 4IQXA 3PV8A 4LRBA 2XWYA 2O88A 5B0EA 2ZC4A 4QOTA 1FNMA 1D1BA 1BMQB 3TA2A 2NUTA 1SQFA 4U95A 3CCMT 4KIAA 4C0BA 2VFSA 1X69A 1K1QA 3AXMA 4DV1F 4L72B 2DA9A 4QIWD 2ILZA 4HXJA 1UEKA 3GYXB 4C8NA 3QJYA 2R7WA 2KMTA 3UVJB 2EGEA 2QT7A 2P9EA 4MZTA 4C97A 4ECQA 2JEJA 1KDNA 3POTA 2YNFB 5CHCB 3ZZ0A 4PJOD 3BW1A 3BSAA 2R7XA 3TX8A 3HPWA 1KFSA 2WBMA 4ZLNA 2HHSA 2DVJA 5AJ3J 4EBEA 2L9DA 4EZ6A 2QLWA 1SUQA 3W64A 3HSJA 3PZPA 2RUGA 3OSPA 4OIXA 2Q43A 1S1WA 1AHJB 1TUCA 5ETRA 4DOWA 1Z1ZA 4LBIA 3MWBA 3O2IA 2YNIB 4Y28E 1BU1A 1VYUA 4C92A 1JLGB 3CIZA 5HK3A 1M9SA 2NYSA 2KJVA 3TVZA 2RDJA 4QPXA 2N7CA 3UT1A 4P7TA 2Y3YA 4HYKA 5GMKi 1U2FA 2BKNA 2VG6A 4HCBA 3Q8VA 3QGGA 1PWTA 1YHQT 1AUDA 3V4MA 3BDPA 3F56A 2H65B 2UUBF 2XMFA 3FSXA 1XNRJ 2H3EB 4TY8B 4ES2A 1U2CA 2BBEA 3Q86A 3O6QA 1FXXA 1NZAA 4RNMA 2Z58B 1WHJA 3VS4A 2ZJRQ 5A6WA 1OI1A 1CQNA 2LU1A 4ZIVA 2LP5A 1Q81T 2E7WA 2QLXA 1SRMA 2GQVA 1UE9A 2DIQA 3TVKA 1NYGA 1FKAF 2HBQB 1U1LA 3RUXA 1TKXB 2ABYA 2R8GA 2DIGA 3I55Q 4P2SA 5DQIA 5HK4A 1W70A 1DTTB 1OU9A 3R9LA 3HI9A 1REGX 3GYNA 2VQFF 3BBCA 1Q0NA 3AFGA 1UHFA 5CO7A 1QCNA 1NJIU 4LFAJ 3TA1A 4RCBA 4QQ6A 2WSEE 3BF4A 2ZZTA 1VQPA 5A6PA 5G0RB 3RAQA 3WVEB 1XR7A 2EQUA 2COYA 2IBKA 3VS6A 2P4TA 2AZ1A 3J81j 3KBGA 1BIBA 2D8HA 4M78C 2FRWA 1UFLA 2SRCA 2RHSB 5KYWB 3I82A 4LUDA 2W7OA 2E5KA 1LWEB 3GR1A 2MHEA 3JCMQ 2OGUA 2NUUG 3AA9A 1VGYA 5AT1B 2GMJA 1Q82R 3W3SA 2BKDN 4PLIA 4GLMA 2R8IA 4UC4A 4QWBA 1IWGA 1G2BA 4ZVTB 1M0SA 4WK3A 5LJ3j 3CC7T 3MM9A 1B34B 1KLNA 1EETB 2K79A 1V5IB 3C14B 3D7SB 3OJSA 3CCJQ 3H9NA 1HNIB 4B17A 3K5MA 1JB0C 2DNPA 1KSWA 1IR0A 5CKDA 1V3ZA 1JJ2S 3FNNA 3TSWA 1K8AT 4DBRA 2AKLA 1CQMA 4P71A 1IR2A 2JM8A 4XPEA 2DKOB 4RG2A 2BE7D 2MGZA 1TKZA 2DRBA 3DCAA 3KLFA 1VA7A 1RTJA 2HIQA 1DFDA 3KTQA 1GAOA 4ZHRB 5LOQA 3RESA 4J9HA 1FRXA 5I42B 3J80E 1KQGB 1ZAVA 4XK8E 3D4JA 5F8GA 1NE8A 3SWNA 1OU8A 4DV3F 4FZVA 2CSQA 2MQPA 1HNWJ 1REVB 4OI6A 3NGPA 3UN3A 5H9FJ 4X9CA 1UJ5A 1EKRA 2GMHA 2YUQA 5BR8J 2QJ3A 4X4UA 4WFXA 3AT1B 1N6QA 3NOCA 2M1HA 3V7SA 2Q6CA 1RWUA 1MG7A 3IQLA 4RTUA 3D6TB 1WQWA 1IBKJ 2KXDA 1YK9A 3L42A 2PA3A 2VC0A 4O4GB 3C16B 3D6FB 2MWPA 1RBLA 3H8YA 2XS2A 3QRRA 4HR2A 1CULB 1YJ7A 4ZP9A 2DAQA 3PW7A 4Y34A 3UPFA 3K59A 2QRRA 1CJKA 1S0NA 4O44B 4M75G 4WFBQ 1CPZA 2KXFA 2NXCA 1FVSA 5J3BA 3M0TA 1LWCB 2CQGA 4B9TA 2CPDA 1XQIA 3DDIA 2RAQA 4PK4A 3NAHA 4M5LA 4WZMA 1JJ2R 2AIRB 2HRTA 1LWFB 4DR4F 2ACYA 4NZ7A 2ROEA 4NMXA 4KPCA 1SJFA 4E7JA 3DOLB 3WBZA 4DA4A 1DTQB 2ZWOA 3BH7B 5KCOA 2V68A 2MK5A 3DLLA 4YB6A 1KVKA 3D0HE 4VUBA 2XY5A 3CCRS 4J9DA 1VQ6T 1MMLA 3S3OA 4QYZJ 2E5GA 3MUVP 3ENAA 4PG7A 1BC6A 5IHIA 4K50A 2CPFA 4MYUA 1RE1B 2RJDA 4YB1P 1VQ5T 4KQZA 4PNOA 7FD1A 3F73A 2DK2A 4C5IA 5KOWA 4ELTA 4PPDA 2MQQA 2KZMA 4M77A 2ZZDA 5GMKa 1X43A 2APOA 2HHTA 4C2MA 1D0YA 4Y91A 2L3QA 2QFIA 2L3SA 1QLYA 4A4HA 5F0WA 2ZBRA 4LF4J 2W2MP 4HI2A 3H41A 4M77D 3Q89A 4A8XA 1OO0B 2DH8A 4IUQA 3G71Q 4LD9K 3W2VB 4N0AA 4M7DG 2KVIA 1TTHB 1ZETA 3OYLA 2ESWA 2B9EA 3PIPQ 2VG5B 2J6FA 1E6YA 2CUYA 4HT5A 2QASA 1RLCL 2HFOA 4H4KA 1N8RT 4B9MA 4RW9B 1VHIA 1K9MU 4M7AE 1HMVB 3UD4P 1WC3A 4M5DA 3MP8A 4L73A 3QPIA 4IFYB 2BYCA 1NPPA 5DDOC 4KY3A 5HVHA 5HN0A 3TJ9A 3R6GB 1T0HA 2X4JA 3EG0A 4PJNA 4LDWA 4CH7A 3U02A 2ABLA 2J5AA 2ZVIA 2J6OA 3M6VA 1T05A 2U2FA 3MAHA 2BR0A 2RF0A 3EXYA 1Y4ZB 3BKFA 3RNJA 3OYJA 4DL2A 5D78A 3CMES 4MKBA 1X2KA 1X6OA 1QWFA 2V8JA 1GCQC 4A8SA 1BKBA 3M8PB 3OUYB 1FWPA 2CADA 4KFBA 3A8KA 4OHWA 1P92A 2KN4A 3H5SA 4NOHA 2MAMA 3OL8A 5KFXA 1TUVA 3FJ5A 4NL2A 5GAEU 5KFDA 2P9CA 2RQUA 1SBRA 1AWWA 1EFNA 2YX1A 4M7AF 4X9DA 2ZPBB 5J1EB 2DY1A 2P0KA 3W65A 2CP6A 1VYAA 1EARA 2Y4XA 1TQLA 1BK2A 3MKDA 2LJ1A 4JS5A 4JI4J 3V6DB 4O5VA 1UGPB 2DPJA 2KM8B 2MQLA 2M0OA 1W2BS 4K5SA 3PHEA 3FMWA 4QIVA 4WP3A 2NS1B 2O01C 2ADCA 4RUBA 5IHKA 1FE4A 2J9EA 3LUYA 4FBUA 4L76A 1VYTA 1HNZJ 1PD0A 5GMDA 2NUPB 1HBMB 3NGUA 4RX6A 2FPHX 1BIAA 2JVOA 5DDRC 4U7CA 2VD3A 2BABA 3TQ1A 3AOBA 1M8VA 2LXIA 1CG2A 3ZTOA 3UDEA 4QCLA 2FC8A 3OVAA 1NJIR 2XI2A 2KK4A 3MEUA 3V2UC 3TNVA 3CCUS 3DRXA 3H0HA 3TI0A 4CM0A 4CO4A 5KFTA 5DZ6A 5HQ8A 4BDPA 2KU7A 2KL8A 3ZNUA 2H9ZA 1OSDA 2ZE2B 2M51A 1PG5B 4UOCA 2MZRA 4UOGA 2VC1A 4MK8A 4UUXA 4UOHA 4FP9A 3JCMb 1X5PA 4RKUC 1SQEA 2OD6A 3PMIA 2DMOA 4FBTA 1C4CA 4A8YA 5FWCA 2J0QD 2HS3A 2V4QA 3JYTB 3QKJA 2ZBIA 1D1UA 3SD4A 2EPIA 1M5SA 2GIRA 1N33J 1JLCB 3GCXP 3MP6A 3CCVS 4RNNA 4CO2A 4ECZA 1JJ2A 2GQCA 4A8FA 4LF5F 3V8JA 4CIOA 1GL5A 1W2BR 2R2UA 3TOQA 2ADBA 5GVQA 1ZM9A 2MMYA 4J9RA 4ZPCA 3IBCB 4BWMA 2C2RA 2XGQA 3NTHA 2RS2A 3L2UA 2HBRB 3VUZA 3FQKA 3VAGA 1GX5A 1HYSB 4EMHA 1QSLA 5CQYA 3LP2B 1UGVA 3M6UA 5B0AA 3BQ1A 2FB7A 1RHRB 2V8DA 1GH8A 2HFSA 3R5CA 1O75A 3CJ0A 3ISZA 5ADZA 1BWEA 3KUFA 1IHWA 1TFWA 1HK9A 3T5KA 3BPSP 3I87A 2EW3A 2OEKA 1K76A 3CTRA 3OY9A 4ZDNA 3IGNA 2LC4A 3E8OA 4E7ZA 4YEAA 5LJ3d 4LFCJ 5LXYA 2IAJB 1V3SA 1KC8U 1AYEA 2CKWA 2DH9A 1RYSA 1X6BA 1P1TA 4PJMA 3UDVA 1WNEA 1NZ9A 4ZVEA 2UXBJ 1XNIA 1S76D 3C19A 3D5MA 2W2QP 3FUYA 2CRLA 4NLPA 2O1PA 3I5BA 4DUTA 1T3SA 2CT4A 1TAUA 1SQGA 3I9V9 4RR5A 1NUEA 2IM1A 3N5BA 5AE2A 4DJBA 1IN0A 1URRA 4ED8A 2FLNA 4RL1A 5M9OA 1TVRA 1JKHA 4C0ZA 3EG3A 4IFVB 2OTJS 3C6UB 2RDDA 3Q2TC 1M5OC 1HARA 3ER0A 4I68A 1D9FA 1S1UA 1OPLA 5KFWA 2EJ9A 2HNYA 3ELHA 3ETOA 1MLAA 1J5OB 2FLOA 1K0SA 1VQKQ 4IO1A 3CCRA 4CTAB 2F65A 2GJ2A 2OSQA 2RT3A 4OGCA 2AJ2A 1BWVA 3JB9H 4JZ3A 2DILA 1T95A 2NXJA 5HBMB 2XS5A 1LEOA 1YI2S 3T1YJ 1HNXJ 2LVMA 4MK7A 1SC3B 2B3TB 1FMVA 3U1LA 3PVXA 2NZCA 1HD3A 3P3DA 2VFTA 4P2MA 4PWDB 2EQIA 1Y0HA 3CO9A 3M32A 4R8UB 4NYZA 1ZQ1A 3MMBB 3T5HA 2YUOA 4PQUA 3GQCA 1PM3A 2IFXA 5T7LB 3M2VB 2MTLA 2RH3A 4LVNP 4RWXA 1ZZNA 2D1XA 2FC9A 1HQUB 1QTNB 4ZPWR 4GO7X 1Y5IB 2HQCA 1WHHA 1KOOA 1T9TA 2C3YA 4LN2A 3OTBA 4G1IA 3H7HB 3UDLA 3EAEA 1D0XA 4KKOB 5ETMA 2OO4A 4Y2IA 2ERRA 2A0FB 1UUEA 1HHQA 1D8ZA 3PO4A 2FY8A 5JVHQ 1K0TA 1TUGB 4U7UD 3JCMW 1ZUYA 2ATCB 4JI8F 5AYFA 3IRXB 4KRTA 2CSIA 1MUZA 2F4FA 2BM0A 5ETTA 5GMKe 1KS2A 3R5AA 1B0VA 1BB9A 5L8RC 1PJ7A 2KHCA 3LF0A 4LD6A 2DGWA 5D15A 1I8FA 4JI1J 4RBVA 1OZ3A 1JNZB 1U1OA 2XDBA 1NK9A 4V19X 2YXLA 5HI7A 2RJZA 5FWBA 4HACB 1K9MR 4DR6J 3NGSA 4RW4B 3GV8B 5IWAJ 4C3MA 3B8HA 3PTAA 5C24B 5AXKA 5GMKj 1VQPQ 4BUGA 1KP6A 3CCTA 3FMBA 2B5JB 5B0CA 1NXIA 1KK7A 2IJRA 2QMXA 2R7VA 3PG9A 1LQ9A 2BEFA 2I2LA 4I0WA 1WC4A 3JAMY 4JI2F 1BE4A 1FKPB 4N4IA 2B4VA 1U8WA 2RPNA 1GT8A 3LWLA 4P10A 4CP5A 2RJCA 3DMJA 5DLFA 4JJDA 3NKYA 3NRBA 1VISA 3M2RA 4MIWA 2CJQA 1UWAA 4H4MB 1W2BA 4LRFA 2AKWB 3QYHB 4YP3A 4AD6A 2OTLT 3CMAT 4Y28C 1SV5A 3VYHB 5HATA 4J5OA 2P0PA 2Y9HA 2KVQE 3VS2A 4OX9F 4C4WA 2A2CA 2E65A 1FMWA 4ZP7A 4DV5F 4H4OB 4R0EA 4C98A 4WFYA 4BC9A 3M8SA 3UN2A 2COZA 4L3NA 1VLYA 2ECZA 4WXOA 3GTYX 2DE0X 5IT9Y 4QWDA 1YRXA 2KRNA 1U2RA 4XTTA 4BC7A 4YY3J 4O0NA 1U0HA 1B99A 5GAGU 3CCUA 3CXCP 1RTDA 2ZNZA 3QIPB 3OXGA 1N34F 3PACA 1FX2A 3BR9A 3G9CA 3UCZP 5H9EK 2COLA 4F0MA 3KK3B 4L3KA 5CVIA 2W9BB 4NL3A 1S57A 2FGCA 3PX6A 4J9MA 2RA2A 2ZKTA 4FSSA 1B0TA 1WF0A 3PT9A 1A0NB 3OYGA 3GYGA 2LCWA 2E64A 3LP0A 3L2VA 2P6TA 2ASYA 1X31C 3MZIA 4WF9Q 3V8LA 1YDLA 3C46A 3TZXA 3OXLA 3EHRA 4CDIA 4ZJQA 1X4BA 3DLGA 2EXUA 1YP5A 1PYOB 2W7AA 2LECA 2QYCA 3CCVA 4MFBA 3CJKA 4OJ3A 3HKZD 3TJ8A 2UUCJ 1IBMF 1FDDA 2WHOA 3D0IE 1N9RA 2ZH8A 4WKRA 1UEUA 3OTDA 1AUSL 3FRNA 4TQRA 5A8KB 3EGWB 3BFMA 1R31A 5I3UB 4UT4A 3KUHA 3BDEA 2M7SA 3PJWA 3K0JA 2KROA 3HFVA 2G9OA 1TAQA 3AJDA 2B51A 3D1QA 5EWGA 2BJEA 3RIRA 1VBZA 5CZVA 2M9UA 2ED1A 1HWIA 4ES3A 4DWIA 2F3JA 4ES1A 2ILYA 2LXUA 2VWFA 2EG2A 3EUNA 3EG1A 1PBUA 2CJYB 4ECRA 1RAIB 5D0GA 3D3CJ 2LYVA 5L1JA 4KULA 2CG4A 1GK8A 4PKDB 4S0MA 3TQ7P 2K06A 3MI7X 4DQSA 4ZGJB 4P9SA 4ECTA 1VS3A 4OYMA 3DLLQ 3OSSC 3KMSA 3D9BA 3MECA 3GU0A 3MURP 4Q45A 2LZ6B 2B4PA 1RT2B 5KT6A 2F1FA 3V4IA 4Z02A 4C8QE 3J7A1 5KYYA 1PSDA 2OJ3A 2DJWA 5A8WA 4PABA 4A4EA 2J6UA 1KC8R 3ZFJA 2Y1LB 4EGLA 4XU3A 4M7AG 2LDMA 1FWKA 5D3GA 4O3OA 1PBAA 4ICLA 1NYFA 2OTJA 2CAJA 4RZRA 1R8PA 1MSWD 1FMKA 1Q78A 5HCKA 1IREB 4ECXA 1CEZA 3DGVA 2K3BA 1SB6A 2LJ0A 5LJ3f 4NLDA 4O3PA 1MV0B 1SHFA 4YFUA 1UB4A 1RABB 2ZAEA 2IHR1 3WX8A 5HMZA 3VKIA 4K59A 3LGLA 4BE0A 2HPUA 3M4GA 4K0KF 5EX0A 4JV0A 5FRNA 2CNKB 2V2VA 1KWMA 1M90U 4H54A 1YI2A 1RYRA 3BREA 3M8YA 1AROP 3ENVA 4DBQA 3BS9A 4FYVB 4PJOE 1DQ9A 1QMCA 1YJ9S 3OQ5A 5ECAA 3A8OB 2LRQA 2W7PA 2DHXA 1N52B 2CUBA 3U7JA 3BO4A 4RBUA 4PAAA 1HBUA 3POTB 1IKWB 5THWA 2R7RA 3D54A 2PVOB 3PYGA 4ZNXA 1H2TZ 3JAME 4QVZA 1Y0MA 3Q8UA 2VG7A 1U1SA 3W9JA 3M9OB 5HJYA 1UA1A 3RBBB 2OMOA 5CYMA 3KLVA 3M05A 4ALZA 4B08A 4M75A 4OHYA 2XNQA 2A3JA 3MCOA 2FHJA 3K57A 1YX2A 4HI1A 4IKFA 2HZVA 4BCAA 2E1CA 3R6OA 4A4FA 1HNWF 2NSBA 1NJWA 3OT9A 3EXCX 3MM8A 1G4CA 3CF5Q 4XAXB 5HSPA 4M75D 4J9LA 2EFPA 1WHXA 3CCMS 2AU0A 4NEZA 1TFYA 1M1GA 4JP8A 4C92E 1Q86U 2RQMA 4AXIA 2OPRA 4EMKA 4Y2CA 2V9WA 2BE2A 4BACA 2H5IB 3T5JA 1ZTTA 2YWGA 1IBKF 4J6XA 4OI2A 4BI4A 1HW8A 2HFVA 3IBWA 5HLFB 1SI9A 3SCKE 4IH5A 2Y0SD 2L5QA 3MTKA 2G4BA 2HIYA 3PR4A 2PMZD 2RHQB 4FYXB 3I35A 2QTVA 3S1TA 4WIQA 3KLHA 2W01A 2CGHA 4LF9J 4GVBA 2XBPA 1KHIA 2A28A 3EGXA 2VPXB 1LW0B 2I5JA 1JLQA 4R5PB 2DRAA 1UVNA 4P2XA 1KD1U 4C8ZA 2VQEF 4Q5VA 3DC2A 1NJXA 2O2OA 4CNYA 1X7VA 3MM5A 3QQCD 2ZHBA 3M59A 2AX0A 3FFIA 3HHLC 4DUZJ 1JBMA 2PMHA 3QT7A 3TEEA 4RW8A 2MCNA 4R25A 4B6MA 3CC2T 5T14A 4C92F 1X75C 3CO0P 1TUDA 5SZTA 4WZQA 2MI6A 3VRYA 2F2XA 3A8MB 3N01A 1YHQS 1RWOB 2BUDA 1DLOA 4ECYA 3CDAA 3P6YC 2WB4A 5FJ4A 3JTOA 2DYBA 3KK2A 4M7DD 2W8LA 1NO8A 2WRMA 2ZCFB 3P96A 1H641 2V1QA 4MIAA 3EGDB 3N4WA 4WBFA 3H5XA 3AD8C 1GRIA 2JC0A 4DR7J 3EVWA 1EX4A 2ALZA 2GW8A 5JUMA 2EGAA 4IG3A 1JJ2P 4O3RA 1WGSA 3EFOB 2F7VA 5F3TA 2CVIA 4B9VA 5J2NB 1XNQJ 5EG2A 5C6SA 3U27A 3REAB 1NK5A 3GJQB 3OFFA 1WHLA 4OYIA 1N6AA 1KR4A 4CLUA 5GANh 3AB2B 2RF2B 3CDEA 2FJXA 1Q79A 4EWTA 2MQOA 1DHMA 2LU2A 4C48A 1H7WA 3HTRA 4O3NA 1S1TA 5C7PA 4NRUA 4O6JA 5DM6Q 1HI8A 2UUWA 2ZBCA 5FRMA 4JV5J 2DNOA 2CNLB 2IVYA 3CD7A 3IS9B 2KT5A 2ZGWA 2YNGA 4ED2A 2OPPB 3PW2A 2DBKA 4LDVA 1VQOT 1YJNS 3PFSA 1LV5A 4DBHA 2X1BA 1MU2B 3DU6A 1SKSA 1RWMB 2B9YA 1NKBA 2QV6A 2AYBA 2UV8A 1Y96A 2GX8A 3D2WA 4F50A 4PG8A 2KYXA 1N5TA 4PZVA 1F9EB 2KI7A 4DF8A 3BGRB 1RLQC 3CC7S 1K0XA 4EO6A 2BJ8A 2EKOA 3ZXWA 3BSCA 3QWPA 1A9NB 2HFNA 2OSRA 1X9MA 2E9RX 1DJ7B 1R3NA 1N9SA 2HLTA 4ZA1A 3HZEA 2H5JB 5LJ3h 2UVWA 2DXCA 4DBFA 1R0AB 1TV6A 4OV1A 4QWAA 3CCRQ 3QJPA 3CDUA 4JI4F 2C1EB 3L2RA 2X7IA 1X0PA 1KTQA 4OFZA 1UFWA 3H40A 1P8GA 3HHLB 1Q16B 2KEAA 2VPZB 3V81B 3PRVA 3QT5A 5I21A 4DN0A 3OR2B 1IJFB 1FK9B 4B3RJ 3NS7B 4EYIB 3PO5A 1H7XA 4NYPA 5A8RB 3I5CA 4B3SJ 1PJ5A 5BJRA 3JSMB 1VBXA 2JL9A 1RTHB 5GAN2 3K5PA 3FCHA 2E70A 2OX7A 4PJJA 3IG1A 1RU1A 3X24B 4K2JA 2OLWA 1RI9A 4G1QB 3DU5A 3P45B 4FM4B 4P5NA 5CZXA 1XC9A 1NG2A 1Q7LB 1ZAXA 1UMJA 5GMEA 2FO0A 4J9QA 5GAEI 4J90A 3AD7C 2V63A 1AWJA 5IN1A 1VBYA 3R7BB 3PY8A 4WJBA 4M77E 1NK0A 1WZOA 4RUGA 3CQTA 1YJ9A 3OW2R 4UOFA 1Q7YC 2R57A 2M3DA 2H8HA 3UVJA 3GNFB 3JCMX 4N41A 2FVRA 4P73A 4DN9A 2YNFA 3FZBA 4ZLJA 1HA1A 1EHWA 2JNJA 1I5OB 1KG1A 4ZCLA 1S9GB 1Q82T 4MKYA 2JJ9A 3Q0AA 3W7BA 2GHWA 4CLSA 1UW4A 2L0AA 1N5VA 2J06A 4NLQA 3EFSA 1VQ6S 3RW7A 1HD0A 1WEXA 1S1NA 3EMTA 2KVQG 3CMEQ 2EQKA 3OVSA 3EVOA 1G3YA 2DITA 3VHQA 3CEYA 1YBUA 2FLLA 2Z30B 1NU4A 1YTYA 1RKJA 1VQ5S 2A6MA 1C4AA 1JJCB 3SCIE 4LQ9A 3M5AA 4DSJA 3VS5A 3CCMA 3O3LA 2YNIA 4HT9A 4PKCC 3V8KA 1NLPC 1HBOB 1JLGA 3JSCA 3PVQA 1VIFA 4JRKA 1R43A 4PEOA 2K7AA 1SJRA 2FG0A 3MCNA 4PWWA 3Q8SB 1VBKA 4OHZA 4OYWA 4PYAA 4YR0A 1I94F 3SDEB 2F4VF 2V69A 4X1VA 3SXLA 1PNJA 3BN7A 1LXNA 1B3QA 4U9RA 1W2BP 2DO3A 3FRZA 4TY8A 1KQKA 3GJRB 5F9LA 3JXOA 1Q86R 2CQ0A 4OVAA 1SL1A 2ZOGA 1CVJA 3JSYA 1YJRA 1UCNA 1IVZA 3GIIA 4Z7YA 1NRKA 2GMLA 5ETPA 3DXSX 2NREA 5LJ3g 1R7IA 1PCXA 1GMWA 2VV5A 2C42A 4E6RA 3F41A 3MR5A 5DLOA 3FGVA 4DV2F 4MDXA 3CNQP 4EZ9A 2BJ7A 1C1CB 2HYIB 3ENQA 3K8VA 1TKXA 1S49A 3MXHP 3PW4A 1Q7YT 2RN8A 2EK1A 2WB1D 2R7QA 2MLXA 2K7KA 1WC6A 2J9DA 1QAXA 3CCUQ 3ICLA 2E4HA 2NLWA 2XZWA 1GMWD 3MR6A 3MGJA 3C12A 1KD1R 1R0CB 1HD1A 1YHQA 2JS2A 2JVRA 3RKWA 5GAN7 2CWKA 1V29B 4FPIA 4ELVA 1ZOTA 2O66A 1EIYB 3HFZB 2XYPB 1WFWA 5G0RA 2EI5A 1NZ8A 4IQMA 2R7UA 5KFSA 3T1YF 2BXJA 3QPHA 4JB8B 4P7VA 3EZOA 4RW6B 1W25A 2EFIA 3OS5A 1D3WA 1OS5A 4Q0BB 3MEVA 4F0HA 3CCVQ 5KYWA 2IA6A 1B07A 2BOAA 4QYRA 4EU0A 3H2UB 1FWZA 1LWEA 4A48A 2OELA 2FHOB 4QVCA 1NK8A 2MXYA 3BGFA 3CMQA 2ED0A 2RHUA 2DXBA 3QAEA 4FT2A 2C2MB 2ASDA 3HFNA 2VH7A 5KFFA 2PSZA 3OVBA 5HROA 4Y2KA 3L7UA 1B34A 2U1AA 4WU2A 4A53A 2XYHB 1EETA 3A8GB 3C14A 4CO5A 4LDUA 1HNIA 1CKBA 1NH7A 1WUUA 2YDLA 1GMVA 3NTKA 2HNDB 4C3LA 3ISNC 4J9IA 2V8VA 3VYGA 3M6XA 5F8NA 3KDNA 3L1AA 2IIMA 2GCFA 2W0ZA 4FSXA 4ATOA 1YJNA 3OTOF 2KFZA 2ZH4A 1LCKA 4ZHRA 4ID5B 1QJHA 2DPIA 5I42A 1WHKA 3MMJA 1NKCA 5LJ5h 1TL1B 4JI1F 3G1JA 4F4XA 1X8DA 1YITS 2YRCA 2O31A 3I0SB 4Y6IA 4DR6F 2HZAA 1REVA 1FXRA 4PCQA 4YHHF 2YWHA 3T1AA 5IWAF 2R2TA 2K6DA 1VQMQ 3CCZA 4Z37A 3Q8QB 1GFCA 4DV0J 4LSLB 1NJIC 4X66J 3M8QA 1I4K1 3CC7A 4BDZA 4TVRA 5LXRA 2C0TA 2LQWA 1V5VA 2HWTA 3EFRA 3CCRT 1X4GA 1OY8A 2Y8YA 2OTJQ 3DFEA 4E0DA 2KR3A 5RUBA 4JI5J 3KHRA 3CCQT 3B6BA 4O4GA 2DK3A 3C16A 3J81Y 1U24A 1WF1A 1R77A 2ZPHB 1CULA 5C25A 2YX4A 3T6JA 1BQMB 4BHQA 5F8LA 4F04B 3P8HA 4EYHB 3W5YA 1ZSGA 4O44A 3EPIA 4P72A 4AUKA 3GIMA 2HD0A 4XPCA 3K2YA 2E1HA 4XTVA 4CLFA 1BUXA 1LWCA 4OB1B 5KFLA 5I22A 1YI2Q 1H8KA 3UI3A 1Q53A 1IBLF 3D6MB 3OYIA 1LWFA 1VQYA 1H38A 1TP7A 1D1AA 1Q8BA 4OX8A 5LJ3Y 4C92G 2H5EA 2UXCF 1UTIA 3SFMA 3DOLA 4KGZB 1G6BA 2RU3A 1DTQA 2CFXA 4I6AA 3BV8A 4B3OB 4NLUA 2J7IA 2VB6A 2L89A 1OY9A 4OJHA 3QYYA 5A0DA 2YSQA 3SZ2A 1H92A 3SFUA 3M2UB 3HJVA 1U1MA 2AK5A 3JB9k 2F69A 3ITHB 1FWLA 3MCMA 4DR2J 3KHGA 2EKYA 1JO8A 2CPHA 3D28A 5KG0A 2GNKA 1OJ4A 5HY6A 3NMRA 1VQLS 3GFXA 1NJIT 4OI1A 3DGPB 2LNVA 3PDNA 4FIBA 5KE3A 4QQBA 5FU7C 4KR0B 1YJVA 2I0NA 2M5YA 2HHVA 1PC4A 1QP3A 1QY7A 5J26A 2WW8A 1FESA 1FA0A 2JMAA 1WORA 3ETMA 1YIJT 3W2VA 1VQ6A 4LRDA 1WI7A 2J05A 2Y90A 2XCAA 2VG5A 3KWMA 3CD6T 5KFPA 1M3CA 1VQ5A 3CJSA 3LANA 4KUIA 5JMNA 3EM1A 1HHSA 4RW9A 1H6KX 4LIWA 1HMVA 4HTJA 1OWXA 1SL0A 1CS4B 3EH1A 5EX3A 2LCCA 2GFFA 2BACA 1TWBA 2PC6A 3V5RA 3ZZUA 2FL7A 3ONQA 2XG8A 4OZLA 4ZTJA 4M7AD 2C3UA 4KPYA 4QWCA 4PJOC 4OB2B 4C0DC 2UVRA 4ILRA 2O9SA 4AQYF 1C0MA 1FO1A 3F0NA 1F3FA 1VDHA 1QQJA 1Q8IA 2IDLA 4DFMA 1U6ZA 2XG8D 1VI7A 1ZYQA 1YWOA 1RK8A 3M8PA 3OUYA 1UPMB 1PKTA 1S10A 1SG5A 5K8PA 2W9CB 4DFJA 4JI0J 2PE8A 5MAOA 1S9EB 3AHPA 2XULA 3PIOA 1FNXH 3QT6A 5J1EA 4BI3A 1T8EA 3LH5A 5GAOn 2DNZA 4WE1B 2YQ0A 2CZ0B 1FEEA 4CYUB 2HCKA 3V6DA 3M9QA 5DG8A 5AXMA 5M2PA 2Z2MA 1RAOA 4DR1J 1RT7B 3Q2SC 2KDSA 2OI3A 5D6YA 4JS4A 2KXHA 4MTPA 2CIMA 3KXDA 5KFOA 1F9FA 2ENMA 3CCVT 5DZ7A 4OX7A 2NZ4A 3NHNA 2NUPA 1K73U 2E6ZA 4DZ6A 1HBMA 1FKOB 2HDAA 2GJFA 3BQ0A 3B4MA 3IC1A 3AOAA 2DNYA 3KLGB 3LYIA 3OHAA 1K9MC 4MK9A 1DY3A 1OPIA 2KB2A 3MR2A 2NYIA 4N47A 1QAJA 5MLCV 3J81E 1Z2ZA 4PXEA 3WHIA 3S3NA 3KYLA 2ZE2A 3I56S 4N7TA 4NCGB 3PYFA 2PIIA 1KQ2A 4GLKA 3G4ST 2RQWA 1UWBB 1MMGA 1G3SA 4K4UA 3RERA 3J80U 2YBVA 2OTLS 5FU7B 1HIYA 2FTRA 3IRWP 1H3DA 3RKXA 2UUAF 3GPLA 3N5FA 5FROA 3MFIA 1OPKA 3JYTA 4BE2A 4DV6F 3AODA 1XK8A 1NHKL 3S7RA 4E7LA 2ZM6J 1JLCA 1T3OA 3G6XA 4E7KA 4JI7F 2QDLA 2DZCA 2DETA 2LTOA 2WVFA 3GIBA 4CC7A 3T6BA 3SBMA 1IRXA 2D69A 3VAHA 2C28A 2B56A 2EBGA 4F67A 3H4BA 2KRSA 2VFRA 3DOMB 1HYOA 5KT2A 2O4XB 4W90B 3PXGa 2QLFB 4USUA 1F5AA 3H59A 1V76A 2JN0A 1FJCA 3GSIA 5LL6d 2HQXA 3QRPA 3U1NA 1UA0A 1HYSA 1YITA 3GP8A 1AWOA 5ETQA 2FVPA 3NMAA 2FHKA 2DR6A 3LP2A 4DI6A 2FVSA 4P52A 3MEAA 4MZPA 2OTJT 1YN8A 1MROB 4ETXA 3FBBA 2Z57B 2GTOA 1NEEA 3MMAB 4Y2AA 5DETA 3U23A 4IR1A 3P5TL 4LR9A 5CCAA 2BQUA 3GIKA 4C0DB 2EYWA 1DZ5A 3NCPA 2HS4A 2QQBA 1A7GE 1PJ6A 1RCOB 4NMLA 4JRPA 3M7VA 1GCQA 3QJ6A 2DYAA 2ZUGA 3TAPA 2IAJA 2IVWA 2CREA 4DUZF 1M3AA 2B9XA 3NY0A 2P84A 3KNGA 4X65J 2GV1A 1K9MT 2CPZA 3EX7B 1YI2T 5EN1A 1RAFB 1H3ZA 2N7YA 3M30B 8RUCA 1AT1B 2WBRA 1QKXA 4I2QB 4UY85 1WNLA 1KTVA 2M9KA 2QA4T 4DUYF 1VQNT 3BYPA 3EDRB 5L1LA 1KBRA 2VXFA 3KJFB 2W4CA 3HHNB 2AEJA 2DBMA 1WC5A 1HBNB 5CKHA 2G0IA 2F2VA 1E6VB 3Q23A 2FYKA 1RA7A 4A8WA 2WSFE 4IFVA 4GMKA 4A47A 5AE3A 3TANA 1C2PA 3C6UA 3GZ7A 4LF2A 4Q5WA 5GAMj 4FKYA 3M8WA 1CC8A 1FJGJ 4EK2A 1FDAA 2D9PA 3VS0A 2ZPFB 2V8GA 4DR7F 2XMKA 3A98A 1FTCA 3GJTB 5CH7B 4AFSC 1J5OA 2EYYA 1FI4A 2WW4A 3C66A 4IG0B 1Y00A 3DYAB 4CTAA 3CC4Q 2DTIA 2JJ4D 1XNQF 5KFKA 1HR0F 3UNGC 5HBMA 4GKJJ 3QFHA 2C2OB 4Z8AA 1I3OB 3BO2A 2XQCA 3JV3A 4NLVA 4DPTA 2B8PA 4CLPA 1GFWB 2MSSA 1GTHA 2HZYA 2HNZB 1UGSB 4PWDA 4GRSA 5LSOA 2V26A 1JLEB 3ZC4A 1VQLA 2BQRA 4R8UA 2LQBA 1WSRA 3VCDA 3CCMQ 4EBDA 1YWXA 3MMBA 3DRRB 1T7PA 4E7SA 1DJ0A 5EUHA 2XO7A 3M2VA 3TEHB 3FSYA 3A1YG 4USIA 1C0UB 2VHGA 1YWPA 1R0BG 1DQAA 1KC8C 5KFMA 1HQUA 4M75E 2HVEA 2XB2D 4WFNQ 1N0VC 5B0GA 2G6FX 3WDOA 4K4ZA 5DM7Q 4KKOA 2CPYA 4U8YA 2K7JA 2QMWA 1UVKA 2DL8A 4JV1A 2ROGA 4NA3A 1FX4A 4EMKB 3IRXA 2MY8A 5D8HB 2JLGA 2HK3A 2V8PA 2GZOA 3VGVA 4E98A 3HF5A 1WEYA 2E3HA 3OPKA 4QIGA 1Y7PA 2AJQA 1U02A 3H6ZA 3X28B 3TZYA 1FX7A 3EICA 4PLLA 1LFWA 3L09A 3CJ8A 4M77C 4XAKA 2CPEA 2LJ3A 4HACA 2LVWA 3QJLA 5KOXA 3M1VB 3E2UA 2E1RA 4RW4A 3R1LA 4B9WA 3IA0A 1ICEB 1YHQQ 3W8GA 4DCJB 5IHNA 5C24A 3OLBA 1SL2A 4JYAF 2JW4A 1JMTA 2DD8S 3J7AF 2B5JA 4ZCKA 2KJWA 3FFIB 1MWYA 4X2BA 1ZTWA 2P6SA 4F3MA 1B3TA 3FDRA 3CJQA 4PXBA 4B3RF 4M1KA 4N0AC 4B3SF 1C1AA 4JJBA 1FKPA 4BD3A 3PHTA 1IB8A 2NUHA 1S77D 3RTVA 3INZA 2RMOA 4KC5A 3HCXA 3D1HA 4H4MA 3RRGA 2PD1A 4ZVHA 3DI6B 4OQJA 2DL3A 4OV6A 1RADB 3QO9B 3FZ2A 2RI3A 4JRQA 1AZSB 3C94A 1TELA 2MQ8A 1KC8T 4LRCA 3HD1A 3MF5A 4TY9A 1YKWA 3Q8YA 2LP4A 3BSOA 3CIMA 1JIHA 4H4OA 4K4SA 2W9AA 4B3MJ 4LF8F 3LGFA 4PFZA 5ETKA 2UZAA 4FF3A 4YTLA 3L3CA 4JDSA 2VASA 4V1Ak 1TL5A 1VHFA 2LQ8A 2E41A 4NI2B 2GBQA 1WKKA 2UU9J 4QT7A 1RWKB 2DHGA 4P74A 1RAEB 3QIPA 1Y07A 2F9JA 1CLFA 3DHWC 1K73R 1XWLA 3I56A 4BE1A 2HFZA 2BDPA 4EO8A 3D6HB 3CC2S 1HHTP 3KK3A 2F9DA 3GIJA 2W9BA 5KG6A 2V2KA 2F40A 3RG6A 3GJSB 5KYXB 2OTLA 2D41A 3H0FA 2XI9A 2CYYA 2A2DA 3CUNA 4UY8T 4OI0A 1M2VB 1M1KC 2WOMB 5CKFA 4DX7A 1U06A 3CC7Q 1IM6A 4ID8A 3CXCS 3PKMA 4RMOA 5BYSA 1N5QA 4O3SA 3GOXA 5CCMA 4ZLLA 2BJ9A 4O3QA 2CDQA 3OW2P 1RTIB 1I6JA 3NWGA 5A8KA 2HHHJ 3EH2A 2LEBA 2W24A 2ASLA 3HM9A 5I3UA 2GO8A 1JLAB 1RISA 4ZKAA 3HHEA 2B6AB 3RBDA 4JI3F 2G2ZA 1RGVA 5KCHA 2KGTA 2IVMA 3QATA 1RBAA 4DL4A 1P1LA 1Z4UA 3C0CA 2N4CA 3UN5A 5B08A 4FVCA 3IO1A 2CPIA 3SI8A 1NAQA 1KQFB 4K2XA 4URGA 3M9NB 2A37A 3SMZA 4FF4A 2CNNB 2AQ4A 3L7PA 5A2QY 4ILLA 2M0GB 2QEXS 1DARA 2QN6B 2BJ1A 2MSTA 3CDWA 4ED7A 2L3PA 4IUFA 1WOSA 3C95A 2DBBA 2M02A 2B86A 2EK6A 2VBWA 1VQOS 2KFNA 3BKTA 5KFHA 4GBQA 2HQDA 3W63A 3BY7A 2HKQB 1T9YA 1YJ9T 1RU2A 1RT2A 2NUZA 1DBDA 3OL7A 2QGGA 1VUBA 2DNGA 2GGPB 3VALA 2BQ3A 5KFVA 3WIUA 3LGHA 5A0LA 1KNZA 2AJ4A 4QU6A 2CQPA 4DQIA 4KGXB 5SUHA 4JOUA 4DX5A 3GIRA 3RB3A 1O6XA 5ETOA 1NDKA 2X3WD 1RKIA 3O1LA 1U1RA 4USTA 5I4MA 4DOVA 4KT0E 3OYEA 1BQNB 5ETVA 4J9KA 1FRKA 2V8IA 1QUVA 3K89A 4OI4A 1VQ7T 2C2KB 2WONA 3DRYA 2EYZA 2RQVA 2KI2A 3ZL7C 3EZ5A 1ZM3A 4J9SA 3NMZC 2YPZA 1LK7A 3QUIA 3M4XA 1UW9A 1VQ6Q 3L2QA 2G1HA 5BYQA 2J7WA 2PNIA 1FD2A 3IXQA 1EIFA 3HO1A 3BE3A 3BKUA 1S1VA 4J5YA 4ED5A 1VQ5Q 2VOPA 3K5LA 3TU4K 5GMKl 2DNLA 3M4YA 2XMJA 1K4US 3DLKB 1PGZA 1QP2A 1IKWA 3QDFA 2GF7A 3GR0A 3A8IA 1UHCA 3HHTB 2LEAA 3DNCA 4HLBA 5HP1B 1TOVA 1VJQA 5HVGA 4LDYA 5L9XA 3MUMP 2GAHC 3WVDB 5CAIA 7AT1B 4M5MA 2QLJB 3IM9A 2RNEA 3S6WA 1Y3KA 3RYLA 2QTWA 4PXDA 3A13A 1PCAA 5GAMd 4DF4A 2ZH3A 4YS2A 3THVA 3VVTA 4NXNJ 1I07A 4ZPTR 2YKMB 5IOLA 2MYSA 1IHVA 1YRUA 3TARA 3BDLA 2JC1A 1QCFA 2X1AA 4X62F 2DTOA 4X66F 3AB4B 4DL7A 4ER8A 1UVJA 4DSFA 4QJVA 4OMOA 3O8WA 5GANe 3PIOQ 3A1PA 3VRZA 2RH2A 2K3YA 4MDWA 1S0VA 3L7OA 4ZPVR 4JI5F 5H1SV 5HLFA 1XMOJ 2XSFA 3R2CJ 4EUVA 5KH6A 4C92D 5T41A 2LA4A 3MAAB 5F8JA 4I7FB 3SSQA 5E33A 1UG1A 4LBHA 3HMJG 2CJAA 3MOZA 4V19J 1T9WA 5D0RA 1LW0A 1N56A 5GANj 2IRUA 3MPVA 3A12A 2E5LF 1M90C 4N5SA 4R5PA 4YDXA 4WWSA 4DV1J 1G3OA 4YN3B 5DJBA 3QXEB 1N0UA 2MMPA 2ZVSA 1HSQA 3MOJB 4AFQC 1F60B 4DPOA 1Y57A 1WI6A 1AXQA 2J9DE 4WYWA 2HLUA 3PE0A 5L1KA 2OIHA 4QPTA 3MEWA 1T03B 1JXLA 2BRLA 1HPZB 3QZ5B 2AEMA 2DVEA 2XU8A 3HX9A 2DVIA 2HRYA 2CPXA 4DPYA 2MLYA 3UD3P 2IM0A 3QO3A 2WSCE 2ASJA 5LJ3e 3ULHA 2HBZB 2AEFA 4G65A 1MW7A 3K5NA 3QDRB 3CCES 2XZTB 3BM7A 3ZFVA 1YJNT 3EGDA 1X4FA 1IGUA 1FFWB 3HJFA 3LAKA 2HBWA 2MZ1A 1UTAA 2HAIA 2QTXA 5A2QE 2KG0A 4YOEA 2R8HA 3EFOA 1Q86C 1K0VA 1W2IA 1WLPB 2FPEA 4Q2LA 1S0OA 4IO9Q 5J2NA 2J8SA 2CDRB 2LCSA 3JCMd 2UUBJ 3PRBA 4F4AA 3CC2A 4FN5A 4WCEQ 3BH6B 2F8HA 3H42A 5HROB 5D4NA 3DDKA 5FU6C 1YITQ 2RF2A 2F8EX 1HNVB 1OEBA 2BIVA 2HVIA 1YGYA 3A3OB 3DM2B 2W2NP 1QM9A 2EFOA 5IZHA 1G2EA 2DERA 2JLFA 4OMFG 3GE9A 4Y0FA 4KJIA 2HHXA 3D0GE 5AXLA 2FJVA 3RB6A 4AFFA 3R2DJ 1XQHA 1IKYA 3CXCA 2YUNA 1KD1C 3IS9A 1U09A 3P4UB 1M90T 1TS9A 2LNHB 2OPPA 4J8OA 3R5GA 3VAKA 2OD4A 5DGAA 1HLWA 3CCSA 1YCYA 3A8LB 3UA6A 3TEGA 1MU2A 1IZ6A 2PFDA 2VQFJ 2L8DA 3HVAA 1KVIA 3HP9A 3H98A 4F4KA 3CCWA 4ZVRB 2EKHA 2ROTA 3MDFA 3CB4A 3OL6A 1U6BA 4JJCA 1YRTA 3AH6A 1BQXA 5HANA 3M8QB 5EC7A 2XMTA 4TU9A 2HSEB 3BGRA 1A0OB 4LF1A 5ETLA 3DKMA 2QA4G 1NEBA 2R5AA 2HRUA 4P6QA 1XOVA 2QEXA 2VL1A 4PG4A 3IWNC 3JSRA 1Q7YR 4JRIA 5C25B 2XMMA 1ZM2A 2HNIA 4N56A 1R0AA 4DHVA 4CLTA 3EE3A 4NXMJ 1VQOA 3GP9A 2E9ZA 5IS2A 1VLOA 2FPDA 1FJEB 3IR6B 2XDDA 1Q86T 2VF3A 3MFHA 2J6SA 2UXDJ 3A3PB 4NEYA 1VQ9S 3HHLA 2K1RB 4DR1F 4AT1B 2C2DA 2LT1A 1WC0A 5A0YB 2G13A 1SH3A 5CR2A 3ZO7A 3V81A 2FHDA 3M56A 1U49A 2HQ3A 3OHBA 2E66A 3OR2A 3QGHA 2AYGA 1V3RA 1Z9ZA 1FK9A 4K4XA 2QL9B 4QIFA 5KTQA 1VRUB 2IJNA 5A8RA 2N3OA 4OMMA 1QE1B 3JSMA 2BA9A 1X5SA 4G6VB 1Y3JA 4ORZA 1RTHA 3OYCA 3THKA 3OYMA 4XU1A 3CCQS 1P9QC 3PX4A 4M78B 3JAMU 2ZHAA 1KD1T 1RAJA 1WHYA 4MMOA 4AFUC 4G1QA 1S0MA 4URSA 2YKPA 3SCLE 2KY9A 4DV3J 2W2OP 1D3BB 3MD1A 2VJVA 4CO0A 5JXSA 1X4HA 3M54A 4FW2A 3EYZA 2O67A 1HXDA 2OPSB 1GMUA 3NLCA 4RU9A 2JZ5A 2NXNA 2ZM6F 5FU6B 5DQHA 2RHIA 3U1MA 1S6PB 4YB5A 4U8VA 4UUWA 3BBFA 3UA7A 4ZVPB 1NH8A 2GNCA 2NSCA 4DR5F 4MMLA 3W2WB 2I0XA 1FE0A 4QIEA 3WZ0A 1S9GA 2A1BA 1SC1B 1PAUB 4LR8A 3FJPA 1TL4A 1B64A 3NGRA 3WC2A 3KJQB 1JB0E 1RWPB 2RSQA 4NCBA 5KFRA 1WKJA 2WK4A 3D3BJ 1VK3A 5IQQA 3C4SA 2XDPA 4KHPJ 2DPPB 3IFEA 1X6GA 2O9VA 4M78F 1S4EA 2Z4PA 2C3OA 3UCUP 3AOCA 2ZH9A 4QKUA 4NLXA 4R55A 2EG1A 2VIHA 1HBOA 2CZVC 4F3QA 1ELOA 4NLRA 4C0HA 1SH0A 2HAFA 2MB0B 5J1NA 3R3TA 2QZ8A 1RT4B 4WU3A 1NK7A 1UVLA 3DXBA 2JFDA 5K14B 3SDEA 2ATLA 3OA6A 2K57A 4PRFA 4QQGA 4X65F 4E47A 2KQWA 2DEQA 1YBAA 3M6WA 1M5PC 4KH1B 4UQGA 4DL5A 2D3OR 4DV4F 5GAMf 1GEHA 1YIJS 1SSHA 3DLEB 5IXUA 4FS2A 1SIZA 1V9OA 4FXDA 5L9NA 1M2OA 3CD6S 2C2EA 5LJ5e 5KFYA 2VZ9A 2JOQA 5LSRA 1C1CA 2RMLA 1RACB 4ATNA 2RQRA 1FT8A 1BI1A 3KLIB 5J39A 3QZ7A 4C5EA 3G6ET 2M8DB 1RHMB 4I56A 4ZVGA 3IAM9 1G83A 3C3LA 1RL2A 4ZS6A 3HKSA 2UV8G 4F02A 5LJ5j 4CT9A 1PC5A 2K4YA 4L75A 4C8LA 3C8YA 2CZ6B 2LMJA 2QE5A 2J7UA 4OJGA 4NL5A 3CEDA 1FDBA 3CCEA 3CMAQ 2OTLQ 2RUSA 5DLQE 5KYUB 4ZTFA 4RW6A 3G96A 2H3JA 4AL6A 3LH2S 1IO6A 2RD1A 4Q0BA 2YKAA 3OS1A 1TR0A 2DB1A 2NYHA 1RB0A 4DLGA 1YITT 3UPUA 3UCGA 5GANd 2JTFA 2ZC3A 4HKQA 1LVKA 3MPYA 4J7FA 4KE5A 1S48A 4WCIA 1S72S 4R56A 1EQMA 1M8MA 4USJC 1OMSA 5E0OA 3GG1A 2OP5A 2KZZA 2VGNA 3FEZA 3G6YA 4URQU 2DM1A 2XM3A 4X4OA 2YXYA 5FIIA 2O5DA 2V2ZA 2RKIA 4RTYA 4QR1A 4Q2MA 2NCKL 4M7DC 1RLPC 3UDCA 4DL3A 1I1JA 2HNDA 4X84A 2MKIA 1ITPA 4XU0A 2VPWB 3QG1A 2R2RA 4XDDA 2DHSA 1SKWA 2MF2A 3V6KA 2Z2YB 4ID5A 3WX4A 1R89A 3BO3A 4LF6F 3FSIA 2GGRA 5J1PA 1TL1A 3JCMf 2JT4A 5HMYA 3I0SA 3IR5B 1Z9QA 1RBOB 2E10A 4J83A 4ZOSA 5B7WA 4LREA 4GC6A 4LSLA 4CZCA 4XO0A 3G4SS 4XU2A 1QAYA 2GHPA 2HQHA 4OJ1A 3LWMA 1VFJA 2BZXA 2JEGA 2FJWA 3OR1B 4KGVB 1GXUA 3T1HF 1DQ8A 1H73A 1VQKS 3E01B 2C0IA 2W10A 1BQMA 4RTVA 2VYTA 1GXIE 2CQHA 1KHWA 2D7SA 1F2HA 1GCPA 2ZBQA 2QSFA 2R7SA 3AA8A 2FZCB 1G8XA 3SV4A 3MPWA 1VQ9A 3ILLA 1VQLT 2HQEA 4QZVB 2CYZB 5KG7A 3DOKA 1HWKA 4OP0A 4BWJA 3F70A 1RTZA 1Q95G 2FJAB 4MT1A 5GAN6 2MZJA 3RB4A 2L9NA 4B3MF 4PJLA 5FDLB 1RAHB 2GVZB 2DGUA 5FLXY 2EKNA 1NEGA 2KTQA 2LX9A 4I69A 2RK1A 1LPLA 5JVGQ 2L3RA 4B3OA 2QFJA 1WHWA 3CCQA 2UU9F 1M1HA 2QI2A 5J2MB 1OZ2A 2GCXA 3LTOA 4NYOA 4F7UB 4ZGEB 1LOJA 3VS3A 3MEGB 5IM0B 5KFBA 3M2UA 3R6LB 3HFKA 2J6TA 2B43A 1JQQA 2DHHA 4NLYA 3ITHA 3TUZC 3VWSA 2QA4S 3RB0A 1VQNS 3OS0A 4DQRA 2LDIA 2ZD1B 2QQSA 2IA0A 1Q8LA 1Q5YA 1C1BB 5EWFA 2J76E 1W4SA 2EYQA 3RGIA 3OLAA 4M4ZA 5LM7E 3GNGA 4EMGA 4RTXA 3J7ZT 1AFJA 3ENWA 4Y92A 3HXMA 2K3XA 3DGPA 3TR5A 1ZPWX 1KFZA 4RKUE 3PKYA 4UZCA 5KFZA 4ZMMA 3VGTA 2EWHA 2GFAA 1YJWS 2FZGB 2CJ9A 4X64J 3R97A 3S8SA 4IOBA 2JVVA 2POKA 3KUGA 4HA8A 3GFYA 4M7DB 3QIIA 3JCMJ 1VQ4T 2DGQA 4NLTA 3JB9F 3BEGB 5GAOr 1N32F 5B0BA 2CS7A 3HRSA 3OL9A 2HZCA 4J37A 3ZBDA 2KT2A 1NMEB 5GAMh 2COWA 1BLUA 1Q5VA 4Z88A 2I2YA 4CC2A 2DGOA 3G8SA 1B0PA 1TL3B 2M52A 2WCXA 2LDYA 1MV3A 2D3ZA 4F7UF 1CS4A 5G4DA 3OYKA 2I8EA 3N0VA 4IRCA 1WXUA 5KFJA 5D4PA 5HK0A 4RW7B 3O5TB 3QZ8A 3HT0A 4O23A 4I1TA 3T41A 2F5KA 4YUDA 1EQ0A 1X4CA 4F2RA 1U3OA 1SKUB 2A7YA 3OYNA 3MD3A 4QQDA 5E5NA 1T9UA 4UF4A 1VQ8T 1YIJA 1NHUA 1M1KU 2ZH5A 2ZUAA 2QX0A 1SJQA 4BDYA 2EYXA 1BXNA 1SF9A 2W9CA 1OPZA 1S9EA 3OQ2A 1X0FA 3CD6A 2XIDA 3DB3A 3Q24A 1XMQJ 3PCOB 4BI8B 5L1IA 2R5MA 3I56T 2ZH7A 3VV0A 5K8OA 3EPGA 3TAQA 3H90A 3PEJA 1KVJA 4WE1A 4CYUA 4FNIA 2FVUA 2DD5A 3CBMA 3G87A 5D6GA 3CULA 4NX9A 1T9VA 2CKKA 2E12A 1RT7A 1SH2A 3CC2Q 5JJBA 3GLJA 4PXCA 3OJUA 3R1HA 4DSEA 2KT8A 2IBOA 3RBXA 3EDQB 4J9EA 1U25A 3GV5B 2R9LA 1CBKA 2H4YB 3QRQA 4M5NA 5H9FK 2DFUA 3C15B 1FKOA 4OYZA 4ILMA 4K4WA 5D6WA 2D1CA 2K8GA 3KLGA 3WIVA 2FJEB 2HQGA 1LKZA 1FVQA 3RKYA 3EGVA 1FNOA 1T0JA 2JLEA 3GONA 1RJJA 3DRPB 5HMWA 3EHQA 4FDFA 1S6OA 4K4TA 3SV3A 2AHJB 3NS5A 5HJXA 1M3BA 4NCGA 3GLXA 5AJ3F 2D74B 2BV3A 4PYDA 3JCMh 2R2SA 1S72A 1UWBA 2AYEA 3WQPA 5B0DA 1KLMB 4NXNF 4NLWA 2QLBB 1YZ6A 4AMCA 2D3UA 4MKVA 1CJTB 3ULRB 1HL6A 2P5VA 5CABA 4PG6A 5HVFA 2GO9A 2FY1A 1S7HA 3QGPA 2WSEC 2Y4YA 4IRKA 5LJ5d 1BCMA 3PX0A 5FLXE 3NL0A 2JOYA 2L2PA 5GAMg 4RPFA 5L39A 3DOMA 3LA0A 2O4XA 5GANf 1M5Q1 3R8YA 1XMOF 3J80Y 3KK1B 1VC5A 4M78G 1XNRF 4A8QA 1VQOQ 4LSZB 4WPAA 4QYZK 3K5OA 1MROA 1Q81C 4OX9J 2DRMA 2RQTA 2G1DA 3MMAA 1JLBA 5KG4A 2J0SD 5L8RE 3G4SA 2YNHB 4OYOA 4DV5J 2HVZA 1U1PA 1WI8A 2SEMA 3ZZYA 4F4ZA 4PJOA 2JMCA 1NSQA 3MPUB 3THTA 1NPRA 3CCLS 4NLSA 1IWAA 1K73C 4ENOA 2ROPA 1FD8A 1X9WA 2RHXA 3FLGA 1H0HB 2QGFB 2N4DA 2HMIB 1BYMA 3N6MA 1VQKA 1N34J 1SSFA 5K8NA 1PO6A 4U67Q 5KFNA 2ZJPQ 2RQ4A 2IM2A 2DCLA 3M30A 5F0UA 3D66A 4I2QA 1IQTA 1RT5B 2IYIA 3MEDB 4LFAF 1C0TA 3QBCA 4XIUA 3LWHA 4KO0B 1PHTA 3TQEA 4M95A 1UL3A 4YB7A 3TWZA 3BN4A 3W8PA 2CG8A 2DGTA 3HVRA 1HBNA 4RNHA 3GCWP 3R7NB 4XK8C 1E6VA 3TVYA 2JEIA 1HWJA 3EVMA 1IXDA 5I3QA 2CQ4A 4J9CA 1SXLA 3RBEA 1CSKA 2BJDA 2F5GA 2Z2LA 2E5JA 1F3VA 2Z2ZA 2EC2A 2FB0A 1S1XB 2X1GA 1TK5A 3GFZA 1HQEB 1IBMJ 4JV2A 3PTWA 1QVGS 3BPDA 3TAMB 1KQSR 2AKKA 2WONB 2OAWA 4IG0A 4E2FB 3PNIA 3SQGB 3DYAA 1EKSA 2ZPEB 2HHUA 5KYNA 1D9DA 3I31A 4IUUA 4XTWA 4DXLA 4DMZA 4WTOB 1ARKA 4OHVA 4C3KA 4FXVA 5K9FA 1TMJA 2BW7A 1S1VB 5LMUJ 3SB2A 3TUIC 4F25A 5CYQB 4N8NA 2QA4A 1VQNA 4GC7A 1ABQA 2C2ZB 2OPQB 2HNZA 1K8AC 4ZLPA 1JLEA 3FDSA 5M2UA 3M57A 1X60A 1KEKA 3OYBA 3DRRA 1MN9A 2E1MC 1M1FA 3QSYB 3JCMg 3MEEB 2RB6A 2CH4W 1R8CA 1YJWA 1K73T 2OH2A 2OUGA 1C0UA 3LH0A 2AMCB 1TMMA 1ZHIA 2DNHA 3D67A 5DRKA 1X01A 1JK9B 2MPXC 1VQ7S 4LUEA 3KHHA 3Q1JA 2DX1A 2WVDA 4FL6A 5BR8F 5L38A 1QUPA 2SXLA 2C06A 4C9DA 1LW2B 2DGVA 5K5MA 1AEYA 1QVGR 2FHJD 3AHUA 2GQQA 1U8RA 3NGTA 5IT9E 4OMQA 2CP5A 2LX7A 3V7RA 3LQVA 4GVLA 2DEJA 4NS5A 5CD4H 2GTJA 2QQAA 2AWZA 3FCWA 5F3ZA 2IC3B 4C6AA 4I6YA 4ZPDA 1IKVB 2O3DA 3JCMP 3H5YA 5F41A 2D0NA 4K0KJ 3M1VA 3IBFB 1WWHA 3QSIA 4NXMF 3A4TA 4ANDA 2MEWA 4WK1A 1F6TA 2UXDF 4KUDK 2CZ1B 4N4HA 3JQKA 4HCKA 2W25A 2YKQA 4F0KA 1U5SA 2XC9A 1N27A 3KXTA 3CCEQ 3TRGA 2Y1JA 3QWXX 1KSPA 2ZZNA 3GB0A 1WQ7A 3N9UC 2QIFA 4HDHA 2VUBA 4L5GA 1RUWA 3CPWS 4BLGA 1DRZA 1XR5A 2CJKA 4YR3A 4A63B 1L3UA 1M1KR 2GIQA 8AT1B 3ZZRA 5LT5A 1O8BA 4M7AC 4DPXA 3W66A 1IR1A 2C3PA 1J2VA 4DCPB 2XSJB 2MDAA 1RLDA 2MHNA 3DI6A 4L6V5 3ZZZA 2ZH6A 2NPFA 1WX6A 2R7TA 1I51B 3ZTPA 3QBYA 3J81U 4NA2A 4OLOA 3QO9A 1AWXA 1JXOA 1AZSA 1U8SA 1NB2A 1UKUA 2B7CB 2JTEA 2OFGX 3GWCA 2F63A 1D0ZA 2FHMA 2R58A 1N88A 3FBFA 2JFKA 2EFQA 2FQQB 4FXWA 4M94A 1WDXA 2DLPA 3VF0B 3CCST 4CLLA 3SCJE 2D9TA 1R6VA 4USHA 4NI2A 1B7TA 3E2EA 4LF4F 1MMAA 5D7UA 2AZ3A 2IJFA 2XI3A 2XLIA 5H9EJ 2GAGC 4C11B 1WELA 2V2QA 4DX6A 2I6WA 9ATCB 2NR0A 3BR8A 2RJEA 3I0RB 3OSVA 5IH2A 1N8RC 3DHXA 3RR7A 3NAIA 4X4TA 1SJ4P 2Z8QA 5KYXA 2BM1A 2QEXT 2AP6A 2RD5C 3CPWR 4KHPF 1JJHA 4GY5A 3X3UA 4X4QA 1IKYB 1M2VA 4ETZA 2VQEJ 2WOMA 5BXIA 3HP6A 2YWWA 2KM8C 4DEYA 1N5YB 3V6HA 3NBPA 2OAUA 3X1LB 1UECA 4R0KA 2BZYA 3Q8PB 2K3KA 2KH9A 1L3SA 4ZP6A 2MYFA 3JB9G 1RTIA 1GFDA 3NPFA 2I9SA 3KJVB 1RDRA 4IRDA 2IDEA 1KQSA 1JLAA 1U4BA 2KE9A 3UW1A 2YLCA 1FJ7A 2XMAA 1RT6B 2B6AA 4ZJLA 2BANB 4F7UG 1OX8A 4A8MP 3PM9A 2IIHA 4CNZA 4UZBA 1D09B 3T3FA 4NASA 3LP1B 3PFEA 3CW2C 1VQ9Q 5C42B 5GAN8 2BKPA 2Y8WA 4DQPA <