2LQ8A

Domain interaction in thermotoga maritima nusg
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
177
structure length
177
Chain Sequence
GAMKKKWYIVLTMSGYEEKVKENIEKKVEATGIKNLVGRIVIPIRGGQRRKSEKLFPGYVFVEMIMNDEAYNFVRSVPYVMGFVSSGGQPVPVKDREMRPILRLAGLEEYEEKKKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title An Autoinhibited State in the Structure of Thermotoga maritima NusG.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 28
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lq8A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2lq8A01
3DB3A 3CPWS 3ER0A 5HY6A 1W2BA 3CCQA 3I55A 3CCVA 5IT9E 1M1HA 1VQMA 1Q7YC 3CXCS 3CCLA 2OUGA 1Q81U 3CCQT 1QVGA 3J7AF 3I55T 3CCVT 1YJ9A 1VQMT 2JVVA 3CCLT 2MWPA 1K9MC 3LGFA 4TVRA 1VQNA 1RL2A 3CMAA 3OW2S 1YJ9T 1M90C 3CC2A 3KBGA 2EIFA 3TREA 1VQNT 3CMAT 1Q81C 4X34A 1X6OA 1VQ4A 1UEBA 3CC2T 3CC4A 3PIOA 3CC7A 1K9MU 1NJIC 1S72A 5J3BA 2L3RA 2LCLA 2OTJA 1IZ6A 1VQ4T 3CC4T 2QEXA 1M90U 4ZN1A 1K73U 1YHQA 1KD1C 1VQ9A 2JNGA 1N8RU 1S72T 1QVGS 1KQSA 3LH0A 3CC7T 3CCRA 1VQKA 3OYYA 1NPPA 2OTJT 3CCMA 2DO3A 3P8BB 2QEXT 1YHQT 3JAME 5FLXE 2MWOA 4YTLA 3CCRT 1VQKT 1NJIU 1XNIA 1VQ5A 3CCMT 1XTDA 2KVQG 1YITA 2JOYA 3DLLA 1K73C 3QQCD 1YI2A 1N8RC 1KD1U 2E6ZA 1VQ5T 1QVFA 1YITT 3CMEA 1NZ9A 3A5ZB 3G71A 1YI2T 1W2BS 1Q82C 1M1GA 3PIPA 1VQ7A 3CMET 2IG0A 4ZN3A 3CXCA 1NPRA 3G71T 2K06A 1VQ7T 1YJNA 3J81E 5IAYA 3CCJA 1JJ2A 3I56A 2MI6A 2KDSA 1M1KC 1VQ9T 1VQ6A 2EXUA 1YJNT 2LQ8A 3CCSA 3CCJT 1Q82U 2OTLA 4CRIA 3J80E 1YIJA 3I56T 1SSFA 1VQ6T 5DM7R 1NZ8A 1QVFS 2CKKA 3CCST 2OTLT 3CD6A 5LL6S 1VQLA 1YIJT 3H7HB 1VQPA 3DB4A 2JUFA 3CCEA 3CPWA 2LVMA 1M1KU 5DLQE 3CCUA 1VQ8A 1K8AC 1VQLT 3CD6T 1VQOA 1VQPT 3EWGA 1Q86C 3CCET 2QA4A 1YBYA 1KC8C 3G4SA 1VQ8T 3CCUT 1KQSS 3G6EA 1BKBA 4RG2A 3LPEA 3CPFA 3LGLA 1VQOT 1YJWA 2G3RA 3HKSA 1JJ2S 2QA4T 3G4ST 2E70A 3G6ET 3OW2A 1YJWT 1K8AU 2XHCA 1Q7YU 4QQDA 1KHIA 1Q86U 1KC8U 5A2QE 1EIFA 5J26A
chains in the Genus database with same CATH superfamily
5GMKe 2K2VA 4RTZA 2HBZB 4WFBQ 1Q81R 1RT1B 2AD9A 1B4SA 1U6BA 2RS8A 1U0HB 1SHGA 4LDVA 3RUXA 2PIIA 2MJUA 1OV3A 5A0YB 1IBLJ 4OMMA 1PSDA 3GYGA 1N5YA 4ZN1A 5L9NA 2E5QA 1TQLA 2YRCA 1LPLA 3DGPB 3CCRT 2O3DA 1UJ0A 3CBOA 4M75A 3NKYA 3H0IA 5D0EA 5HSPA 3NS5A 2WSCC 2LQWA 1QCNA 1AZEA 3JYTA 4FYVB 3UDEA 3MI7X 4WIIA 5JJBA 2W8LA 3OL6A 4MZTA 2ZH4A 3PW4A 1N8RT 1DQ8A 5DQGA 3KLVA 1F1BB 4OLPA 4DR5J 3O8VA 4ZGEB 4OYWA 3GV8B 4MKAA 3PRVA 1GX5A 1XQHA 2QMXA 2FQQB 4OJ3A 1RTZA 1HBUA 2HIQA 1U2CA 2MKIA 4QVCA 4FT4A 4PKDB 5FDLA 5J1EA 2YQ0A 5GAOn 2PTKA 4P72A 5DETA 1J5EF 1PM3A 4XTTA 2KXNB 2PD1A 3FIFA 4AFUC 1V76A 1KOOA 4FW2A 4DSIA 2BZXA 4CO5A 1AT1B 2KYBA 2D8JA 2X3XD 4C92E 1FKPA 3X20B 4DLGA 1FMVA 3SIPB 2GGRA 1DQAA 2LCSA 3I35A 4F02A 3PIOA 4F7VA 2CZ9A 3H42A 4X62J 1YJUA 5ETQA 2EFVA 1HHSA 2CT3A 4GLKA 2DXCA 2BM1A 5GAOm 1FFSB 3JAME 2V69A 2J0SD 1RE1B 2JEJA 1U8RA 4RG8A 3D6MB 4K4WA 2HNZB 1S1XB 2A18A 1MMNA 5CH7B 1PHTA 5CKFA 1Q82C 1C1AA 1W26A 1UZDA 1KVJA 4OYAA 3Q2SC 1RT5A 1RWWB 3SXLA 2MQLA 3M8PB 1MROB 1TKZA 4I4BA 4XTXA 3HVWA 3NNHA 1RT3A 1T3NA 3EUNA 3M9OB 5LL6S 4M7DA 1H3ZA 4CTAA 2MMYA 1UJYA 5GAMj 3LAKA 4OB2B 1AB8A 4LXCA 1FXLA 3RW7A 4NLOA 1D1CA 3BV8A 3I56S 2IBKA 3MMAA 5ETLA 2ROLA 3PX0A 2HRUA 4WFXA 2VDIA 3U23A 1KDNA 3J7YI 1J3TA 1HR0F 4Q0BA 3IN5A 2LEAA 3LP0A 5IT9E 3R97A 2FDNA 2BBEA 4GKJJ 2JRSA 3M1VA 4ZCIA 2NXJA 3CMAA 2FD2A 1YJ9T 4JOUA 3HVRA 1EAYC 2R2UA 4IUQA 2J6SA 4QWDA 1MNEA 4PCQA 4V19X 2CVEA 2ZC4A 4MMOA 3D3BJ 5KYWB 4I7FA 1QVGS 4CYUA 3OS2A 1F6TA 2PZ1A 3M57A 5HMWA 2EGCA 4GKKJ 2AK5A 2CQDA 1PYSB 2J5AA 3SQGB 4OI1A 4WKYA 4OB1B 2ED0A 1J27A 5L23A 2ABLA 3SHWA 4LSZB 1EX8A 3POTB 2XIDA 3ZZPA 2YH0A 3PR5B 1FRJA 4LBHA 3WX8A 3DDKA 4C8YA 5IHIA 4NLYA 1CC8A 1KFDA 2POKA 1VQPA 3FEZA 1NK7A 4HT7A 1DURA 3GJRB 3R7SB 1VBYA 2QQRA 1LJOA 2ROPA 1S97A 2AGQA 4OZNA 4RUBA 4USJC 3NMZC 2HFZA 2AGOA 2NQPA 5A8KB 2KXHA 2K3IA 3SCJE 4PEOA 3JRZA 5LM7E 2XS7A 5GAEI 4H4MA 5HK3A 3GV7B 4WFZA 3OYEA 4F4XA 1B3QA 2F4VJ 2LECA 1WHXA 1BGXT 2AEFA 2JLGA 2Q6CA 2HFOA 1IKXB 1JEGA 3S1TA 4A8XA 3VZIA 1HYSA 4WZMA 1TKTB 2ROEA 1HJDA 1SPKA 2XSJB 3MM5B 2IVFB 1TL5A 1MMLA 1GMVA 4KGKA 3WVEB 2KVQG 2CADA 3A8GB 2GMJA 4IRDA 1OY8A 2XK0A 4P10A 3R5BA 1S6QB 3K8VA 2CP7A 5FU6C 2C3OA 1FNXH 3DMJB 4FVMA 1GH8A 3GPLA 3FSXA 3VV2B 5IAYA 2HS3A 3HP9A 5HP1B 2DKOB 2DRKA 5B7WA 8RUCA 3VQTA 2PT0A 2VODA 1IBLF 1KR4A 3CC2S 1QAYA 1VUBA 3KTQA 3SBMA 3A12A 4IURA 2F63A 1FKOB 1DLOA 1EP4A 4Z37A 1S57A 3KLHA 1IKVB 2R42A 1UGQB 5LMUJ 2GHWA 1S0OA 4JI5J 1G1XA 4R0KA 1QVGR 3HKSA 1WI7A 2V9WA 2FRYA 3IRXA 5FU6B 1Q86U 2QLBB 1S76D 3FEXB 4N5SA 1X4GA 1SH2A 2YKNA 2NUPB 3ILJA 3LA0A 2OPSB 5I42B 1Q7YC 4DR5F 4ZCMA 1UHCA 5KFRA 4RW7B 3V7RA 4C9DA 4ZCKA 3E8OA 2HBQB 2QQ9A 3MM8B 2XY7A 4EDUA 1UA0A 2K1RB 5M9OA 2BE2B 3G86A 4NCGA 2CPXA 3M9NB 1K9MU 5H9FJ 2WCXA 2L2PA 1VQ4T 1NEEA 3W61A 4IFYB 2LDYA 5KT2A 2DO3A 3BKUA 1QD1A 4B9VA 3TAMB 3EFOB 3TZYA 4RPFA 3GNGA 1KWMA 1FRHA 3HCXA 1ZYQA 4DUZJ 2DHSA 4AMCA 3JSMB 2QL7B 3SZ2A 1AOJA 2ZDPA 2KL8A 3B4DA 3PDNA 5HK4A 1Y10A 1IR2A 1IHWA 3R5GA 5D0RA 1X4HA 3NGSA 4K59A 1RA7A 2NLUA 1WKJA 4QWBA 4K4XA 4C8LA 2KG1A 1Q8KA 3EDQB 3QT6A 4CLWA 2B6AB 4D8KA 4ZLLA 7FD1A 5I4MA 5ECAA 4FL6A 3Q23A 5CYJA 5HBMB 2QA4T 3EXCX 4J6WA 8ATCB 3TR5A 1GMUA 1H73A 3MMCA 4CIOA 1VQ5S 4OJGA 1QVPA 1LW0A 5DG9A 4FW1A 1WEXA 1O8BA 1E6YA 3UE2A 1W2BP 1SRMA 1ZA2B 4E2FB 3TA0A 2RILA 2XGPA 2QK0A 3DOLB 3B6BA 2FGOA 4L76A 1BY9A 5I3UA 2ED1A 4CLSA 8AT1B 3OYBA 2CNKB 3W1YC 3M8RA 3M05A 1KC8T 2PO4A 4IR1A 2DR9A 3M32B 1S72A 2RIJA 3U1MA 2Y1RI 1NLOC 2GBQA 1WHVA 2MQ8A 3R2CJ 2YWKA 1AFIA 5FLXU 4OYZA 4DV2J 3W2WB 4C0DC 2RQKA 2VL1A 4YFUA 2B4VA 1X0FA 1WZOA 1S0NA 1ZX6A 3CJKB 2ZGWA 1GCQC 5DJBA 2X1GA 1NDPA 1UA1A 1HBOA 1ZM9A 5KE3A 1OQKA 1VA7A 4RW9A 2UVWA 2DXFA 2ZITA 3MP1A 4Z2XA 4DX7A 2EW9A 5EX0A 1OX8A 2LQ8A 3GYXB 4MIAA 3BSNA 1RHJB 4KGXB 1AWWA 1WC1A 1RAHB 3PT9A 2HHPA 3ISNC 4YMEA 2W7AA 3HFKA 4A8MP 3AFGA 4GKKF 1OYDA 1U06A 2XKOC 5AE2A 5CAIA 5D6XA 1RLQC 3NLCA 4ECZA 2QFJA 1ZZFA 1VYTA 2R7QA 1G4CA 1Y5IB 4OIXA 4ZVFA 1PBAA 2JZ5A 2D41A 2EBPA 2C2DA 4NASA 3SWNC 2RHQB 1FK9A 4XTZA 4I6AA 1MG7A 2X3GA 1VC0A 4Y28E 1QDUB 3KLEB 3J7AF 3CCVT 3MDFA 2IRUA 1PCAA 3OBIA 4KC5A 2QA4G 2V5HG 3I9V9 3MFHA 4J7FA 2YVSA 4EIKA 2V67A 5J2PB 2W8KA 1SQEA 5D6GA 4AFSC 3DLMA 5A0DA 3SYZA 1Q7LB 3CMAQ 3AQPA 3FBFA 4MIBA 3H0PA 1PD1A 1N34J 3I0SA 4EO8A 4E8UA 1U6ZA 5A8RA 4DV5J 2GIRA 3SSSA 2HHSA 2P0KA 4XAXB 5CKDA 2EBGA 1ZH5A 1YCSB 2F4VF 3HRUA 2QLXA 4WYLA 5HI7A 1YJNT 4JI0F 3JCMe 2LJ1A 2ZOFA 2DJQA 3I31A 2XGQA 3LP1B 2B9YA 1YRXA 4IH5A 3QPHA 2HVDA 4IUTA 4LSNA 3CC7S 4MTPA 1VQ7S 4R8UA 2OGUA 1KK7A 2DR8A 3G2XA 1V9OA 2NXEA 1TVRA 4AFZC 3HFVA 2JTFA 3EG9A 2JEGA 3A8OB 2IYIA 4F4AA 2OPRA 4RL1A 4ED7A 1W2IA 2DNKA 2AV5A 3MAHA 2J0XA 1C1BA 1UW9A 4FKYA 1JLBB 1EKRA 3OMGA 4I0WA 3M8QA 4C8KA 1X4BA 4J9PA 3CC2A 2EIFA 2OIHA 1VQSA 3G6VA 2YXLA 2BANA 1FXXA 2DVEA 4WTOB 4YR2A 5LMUF 4JI5F 1BUXA 4OL8A 2CG4A 1M90U 2ILZA 3D1OA 2DAQA 4QVDA 3R7BB 3VUBA 2C2ZB 4FU6A 1LWCA 5CCLA 2FO0A 3B82A 3G82A 4M7AD 2CYZB 2IM1A 3QJ6A 3O3LA 4TYBA 2Z0GA 2PFFB 2RQCA 5A6PA 5FDLB 9RUBA 3MEKA 1G3WA 2V8PA 2B0GA 4DQPA 2LP5A 3M9QA 3DRSA 4WFAQ 4PG5A 3OW2P 3C15A 3KK3A 2CVIA 3GCWP 2Z2ZA 2EW3A 5KFOA 2CZ4A 1HHQA 4C8NA 3UD4P 1N5TA 2YY3A 3VKIA 3NGKA 1FKPB 4OYPA 4OZLA 2VQEJ 3S3NA 1H2TZ 1CS4A 4J9VA 4K4VA 2RF2B 3UDLA 5I21A 4DUZF 2RAQA 3RAQA 3LWHA 2R4FA 3U1LA 1ABOA 4BS2A 2J6KA 2ZBPA 2ABYA 3K17A 1U8WA 3EXYA 2BJ7A 4B3MJ 4XDCA 2KFYA 2PQWA 2OFGX 1H3DA 2RE1A 2DNUA 2IFXA 4LDXA 4F25A 1WIEA 5IWAJ 2JVVA 3H6ZA 1L5UA 3C4SA 2ZKTA 2DPJA 1Q81C 3IR5B 2ZDOA 2AJFE 3T6BA 1Q0NA 2H48B 3META 4ZTJA 2BQUA 1X60A 5KG0A 1RT3B 4KV8A 2OTJT 2XDBA 5DQHA 3MD3A 2MEWA 5FLXE 2MWOA 4YTLA 1HXDA 1VQ5A 3RNJA 3NXZA 3HO1A 4ZNXA 2DEIA 3VS1A 1HI8A 5L8RC 3BREA 3MUTP 1DTTB 3MMAB 4JI6J 3JCMd 4LF9F 2NXUA 3EG3A 3V6DA 2A7YA 2GMHA 1ZPVA 1NHUA 3GG0A 3M4YA 3RJMB 4Q0BB 4L3NA 5B0FA 3AA9A 1T9WA 4DV2F 3OS5A 1S6PA 3J7YU 2ZH5A 4XK8E 4C0HA 1AA1B 2Y0SD 4GC6A 2KDOA 4DFJA 2HNIA 4DV1J 4WXWA 4AL5A 2AEMA 4F36A 2MHEA 3EMTA 4XDDA 4DF8A 3S01A 3LAMA 1K8AU 2PMHA 1Q7YU 4I7FB 5CD4H 5IV4A 3R5CA 3IA0A 4CYUB 4X4QA 2YRDA 2CP0A 1BCMA 1FNMA 3ZFVA 4AD6A 1TXQA 4BUGA 4C0FA 2GCXA 2O66A 4RMOA 4X64J 3AD8C 3UA6A 2DR6A 3H9NA 2DETA 4TVRA 3VU3C 2M70A 1MNDA 2VPZB 3W66A 3TREA 4RKUC 4M77F 1WTFA 1NG2A 3QWXX 2V8VA 3UPFA 1RWVB 4K2JA 1BI3A 3CC4T 3O5TB 2QDLA 4IUFA 2JNGA 4LF5J 3DLLQ 1NJZA 4HLBA 3SEOA 1FJ7A 1BI2A 2AYGA 2DNPA 1HSQA 1SC6A 5EX3A 3DOKA 3AHUA 2HZAA 3I56Q 1NDCA 2F3JA 1IKWA 1NE8A 4ED3A 3QLHB 5GJWB 3JCMV 1RWNB 4H4MB 1Z9ZA 2N82B 4HVVA 1WDDA 2O5DA 4DL6A 1S9EA 1WORA 3MPVA 1LOJA 1G2EA 1N34F 3PE0A 1VQLT 3MPWA 2LMJA 3DNCA 4U7UD 3EAEA 4DV5F 4HT5A 5IHKA 3SCKE 3ENWA 1I0CA 3KJQB 4QR1A 1HYSB 1RBLA 3JCMb 3AXMA 3R7NB 1CEZA 3WC2A 3HF5A 2IJNA 4ZPVR 5KFFA 1S79A 1RTIB 3N79A 3KWMA 1YFNA 3V4IB 3C95A 1SJQA 4C3MA 2IYGA 5T14A 2BJEA 5AXNA 1JXEA 4ED5A 4M95A 3CEDA 4X65F 2NZCA 4BDPA 5B08A 2M0GB 3CC7A 1XMOJ 5J3BA 4M7AE 2ZFHA 2E5JA 4ZHRB 3BEGB 1IJFB 1UFFA 3OTDA 3P8BB 1DLOB 5HANA 3BM7A 3CBPA 1NJIR 4RCBA 1B7FA 2R8HA 3JCMX 3CCMT 2EKOA 2CIMA 3EM1A 4P7TA 3KLHB 3DDNA 4OX8A 2XCPA 4ZVEA 3J7Z5 1FERA 3GIIA 4P52A 1M1GA 3CSKA 5CO7A 4C92G 1R8OB 1K73T 2YKNB 2HFVA 1RLPC 5EGYA 3HRSA 2AJQA 4RNHA 2HQFA 2M0OA 2V8IA 2QO3A 4U6PA 4QQ6A 4FT2A 4IUVA 2UUAF 3QBCA 1JB0C 1MV0B 2CUBA 3L2UA 1RBOB 2MY7A 2CJXB 5GAMg 2RDDA 4JJNK 2B9XA 3RAMA 2YX1A 4NCGB 4DOWA 2XMMA 3BBBA 1GTHA 3NGPA 1YI2S 4WTYA 2DPPB 5D4PA 4MFBA 1RGVA 5D6YA 1NSAA 1WXTA 1WI8A 4NLXA 4ECXA 5HKCA 4E0DA 3ET6A 1WSRA 3V81A 3H5XA 1NRKA 1SRLA 2J8SA 2AJ2A 2VV5A 3CDBA 3F44A 3DRPB 1X4AA 1K1SA 1EQMA 5GAGU 3NMAA 2VQEF 2DIGA 2DNOA 1WQWA 1M3AA 4WU2A 2BKOA 4M78A 3D28A 1WG5A 3CC2Q 2ZPEB 3D9BA 3VUZA 2RF0A 4DCPB 3IWNC 1AXQA 2NUUG 4B3MF 2R7UA 3BO4A 4ID5A 3W5ZA 2F2WA 3H8ZA 2KJWA 3RKYA 3MR6A 1PO6A 5IWAF 4O3NA 3QNWB 1K0TA 1TL7B 2Y0BB 3BZQA 3JQJA 4J9QA 2AT1B 4CNYA 2L5QA 2WVBA 3HHEA 2LT4A 1GTEA 1O0PA 4DR4J 1E6YB 3QMQA 1LKZA 5RUBA 2EG1A 3MWBA 3V2UC 1VIEA 3RBDA 3HHLB 1R0BG 3VAFA 1SKWA 4M75D 1N88A 2BKDN 1KVIA 3IBWA 5DLQE 1FWLA 1M1KT 1HQUB 2YWFA 1RWOB 4WFNQ 4NYOA 2AZ1A 1SC1B 5LJ5d 2VZ9A 3T6JA 4N76A 1ITPA 2CFXA 4JI6F 4DF4A 4NLPA 2ZJRQ 2PFDA 5D0GA 1S1TA 3HX9A 4K5SA 2MKCA 2EYQA 2QL5B 4W98A 1OU9A 1WLPB 2DGUA 3NMRA 1QSYA 3IGVA 1HBOB 1SXLA 3VS0A 2FHOB 3JCMf 3EVWA 2P6TA 3R6LB 1BIBA 5BR8F 1FMKA 2XYGB 3QGHA 2KH9A 2DZ9A 3PNIA 4DV1F 2QZ8A 3MMBA 1Q78A 2QSFA 2COYA 4RNNA 3MEDA 3H41A 2AKKA 1JJ2P 2DJZA 5DLOA 3M2UA 1RUWA 4Q43A 1JQQA 4E6RA 1KQGB 4C97A 2JWNA 2WVEA 2F9JA 3QXEB 2QTWA 4Y6IA 3ULHA 1P8GA 3GIKA 4X64F 1W2BS 3QIPA 5GANd 2SEMA 2FC8A 1R77A 4ZN3A 3RR8A 1VQ5Q 2MQPA 4EGLA 4D3GA 1RHQB 3KJVA 2X1BA 3OV7A 4EYHB 1ZPWX 3IMQJ 2RDJA 2HLUA 4ICLB 2GQQA 1N0VC 1FK9B 3OTBA 4F0KA 2D9OA 4DPYA 4PKCC 1XBWA 4LF5F 5CAAA 3CD7A 2DERA 3HM9A 4DPUA 1CKAA 4ZGJB 1YBYA 1VQ9S 3IXQA 3CCUT 2Q6BA 3MUMP 3CWJA 2RHYA 5LXRA 1PRMC 1JO8A 4KGVB 2RJFA 2CPDA 4X9CA 2XHCA 3KHRA 4FXDA 2GTOA 4N4HA 3MEUA 3I0SB 4M7DD 1CLFA 4RUCA 4K4ZA 2GIFA 3TO8A 1Q81U 3FLGA 2V34A 2V8DA 3UN5A 4ANDA 5SZTA 1FT8A 3GCXP 4DSLA 2D6FA 2CQBA 3RB3A 4USMA 2I0XA 3HFZB 2FPDA 2APOA 4I1TA 3ZNJ1 3UFCX 1VRTA 1JWWA 2XDPA 3M30B 3A98A 4LSNB 1ZM4A 2FPFA 1R8AA 4WE1B 4IDKB 2FY1A 5DZ7A 3RERA 2K8GA 5GAOq 3CMEA 2NYHA 1EARA 1TVRB 3C19A 4OZJA 1SC3B 3DLEA 3TNVA 3K5MA 2GQ2A 2XMUA 4UY85 1PKTA 5F8GA 4C3LA 2NUHA 3BDUA 1KLMB 1XMOF 2DLPA 4G1QA 3BDLA 2E65A 3H2LA 2VGMA 3W65A 4ZOSA 2ZPIB 4OYMA 3OMCA 4E7HA 2K7AA 2VBYA 4QPTA 4RTYA 3R6OA 2BANB 3OHBA 1RTJB 1Q5YA 3G6ET 3NG8A 5KYNA 1WNEA 4OMFG 4K5RA 4BE0A 2W2MP 1T05B 3HSGA 1B07A 2KRSA 4QZVB 3DOMA 3I55A 3BGRA 1W2BR 3UA7A 2D3UA 3H8YA 5E5NA 4E98A 1U1PA 3G82B 1RJJA 3JTPA 1RHRB 4LSLB 4AFQC 5KH6A 1JKHA 2RRAA 1VBKA 1WOPA 2B8QA 3X26B 2JM9A 1PYOB 2EQJA 2MYFA 5U47A 2QASA 5EG2A 1LEOA 4OMNA 1X0PA 5F8LA 2UXBJ 3MEEB 3PO5A 2VFTA 1M5OC 3CW2C 1MMAA 2ENMA 4QW9A 2Y1LB 1LWXA 3O8WA 1FESA 4WK1A 3KLGA 4EZ9A 3C15B 3KK3B 2AW0A 1EJ7L 3VTIA 1JJCB 1U6FA 2BZ8A 1YHQT 5HVFA 1TSFA 1OYEA 3CC7Q 4C4WA 1VQ7Q 1YI2A 4E7SA 1NLKL 2QMWA 2G2YA 1U02A 1DFDA 5IN1A 3E3XA 3TZWA 1TS9A 4M75E 3VGVA 4AE5A 5KG2A 3QUIA 3C3LA 4F3MA 3OTEA 4DOZA 4WWSA 5GMKl 5KYYA 2DK2A 4IFVA 1S59A 4M5LA 3E2UA 5M2PA 2OTLT 1D0EA 4C8QF 2K3YA 1LWEA 3C14B 1XTZA 5KTQA 1S7IA 4M7AF 1AUDA 3DLHA 4KFBA 2LQJA 4LRBA 1PAUB 4Q5VA 2KXDA 2L9NA 5ETVA 1ZM3A 4OYIA 4B17A 4DQQA 2DD8S 2OKQA 4OZ5A 4ZP6A 3DC2A 3DLGA 4DR4F 4NI2B 1U1KA 2CPJA 2FB7A 1ICEB 4KTQA 3PYDA 3D4JA 3OW2S 1OY6A 5KYUB 3D2WA 2HFNA 3HHKA 1APSA 1I07A 4HEA9 4A4KA 2XYHB 2Q43A 1U24A 4PJOF 3R6NA 3EDRB 5IQQA 3CCRA 1EETA 2V50A 4M5NA 2D9PA 2XS5A 2R7RA 2ZD1A 2CZ1B 1UPMB 3PIPQ 2WB1D 2O2OA 1L3TA 3U7JA 3PYGA 5KT3A 1ZQ1A 3A3OB 5G4DA 1UAWA 3MPUB 1RB0A 3FDRA 1K9MT 4HHHA 3MGJA 4O3OA 3U1NA 3HVAA 2WACA 3PR4A 1LNXA 3VVTA 4LUDA 2MKYA 2KEAA 3IWLA 4PLIA 4HCCA 1G83A 4URSA 2J7IA 4DZ6A 5GMEA 1EB0A 1KC8C 1M5Q1 2GVDA 1N48A 1DZ5A 3NCRA 4M7DE 4MK8A 2UVRA 2M52A 2DY9A 2QYGA 3OHAA 2FG0A 3EJMA 3P8HA 1YIJS 3CCQQ 4RR5A 5LJ5j 2R2SA 2VONA 1W2BA 3HT3A 2JC0A 3FCWA 4ECYA 4C5IA 3M2VA 4ES3A 2OPPA 3FSIA 3DOKB 3K2YA 2UUWA 3OY9A 3MM9A 3DI6A 1FXDA 3OXGA 3L7UA 3Q8QB 3BW1A 3LTOA 1LWFA 3M0PA 4NL3A 3BKTA 4LQ9A 5KOXA 3MXHP 1KD1C 1VQ9A 2L41A 3H4DA 3EH2A 2BUDA 3HHLD 2HWTA 2GZOA 4IH7A 5CYMB 4IO9Q 4P71A 1GXIE 1M4ZA 2KO1A 3W63A 4FXVA 2RJZA 5FROA 2Y1JA 3RAXA 1YSJA 2NYIA 5HLFA 3K7RA 3PKMA 3QT5A 5GANj 3VV0A 4JS4A 4FF4A 1JLEA 4ZVSB 4IG0A 2XD0A 3JV3A 1X2KA 2YX4A 1HA1A 3WQPA 3OW2R 2CPIA 1I1GA 3M4XA 2DXBA 5F8HA 1SC4B 2Y8WA 2P9CA 2PUOB 2VA3A 3D0IE 1OJ4A 3E9GA 5K20B 2XMFA 2G3RA 4LF8J 4JI4J 3BJYA 2MLYA 2DO4A 3CCLQ 1WACA 4FBTA 4ERDA 4HA8A 2GFAA 2HCKA 5M2RA 2NUZA 3BPSP 3EGDB 5GAMh 2AGPA 2FIUA 5J2NA 4ZLNA 1YJ9A 3R5DA 4CLKA 5LJ3f 3M0RA 1B34B 2D3OR 2C42A 3EX7B 4HHJA 2J9DE 1Y11A 1LQ9A 1PCXA 3JB9J 4MAKA 4M77A 2W9BB 2VB6A 1DTQA 2Y4YA 4DFMA 4UTGA 3NAIA 5E33A 3RR6A 5CXTA 4WKRA 2ZBCA 2FRWA 2LC4A 2P5VA 1TG0A 1S1VB 1QWEA 4JRQA 2DHXA 2E5HA 2XMTA 1K0XA 4PJNA 3KNAA 2CKWA 2B3TB 2ZH2A 3REBB 4E7IA 3EG1A 1T8EA 1IN0A 3S6WA 3FK4A 3QIDA 3S6EA 2DFUA 1NPRA 4DQRA 2W9CA 3Q8VA 2W4CA 1JMTA 1GQEA 2UXBF 3CJ8A 2HWHA 1VQYA 1QM9A 1N32J 3RB6A 1Q82T 2OELA 3ET6B 3V81B 3N4WA 2CKKA 2EYWA 4J6YA 2XLKA 3G71S 4QT7A 1T95A 1YRUA 3U02A 4P2MA 1U1TA 3PRDA 5LSLA 1IGQA 2VC0A 4O4GA 2VPYB 1R31A 1DBDA 3OFEA 2YLBA 3G4ST 3K57A 3QSYB 2CH4A 4M63A 3VAJA 2RHZA 4IIOA 1R6YA 2IA0A 4ECQA 3UR0A 3SDZA 1UEKA 1DQ9A 3V6JA 3PW5A 2CP6A 1DJ0A 1I94J 4KHMA 1JLGB 4F3QA 1SH3A 2VD3A 5LJ5Y 1YJNS 4I6WA 4DEXA 1D8YA 5C25B 3HVTA 4YOEA 1OPIA 4I56A 1TH7A 4PQAA 3GIJA 3IG1A 2B8AA 5D3GB 4LF7J 1JNZB 5KYXB 5K14A 2JC1A 3CJ4A 2EYZA 2ZPBB 1NPPA 3DU5A 3D6TB 4ED4A 1V6HA 2XWXA 3P96A 3GPAA 3KLIA 4JI2J 4KJIA 5IV3A 4LNPA 4FCYA 1MLAA 2DA9A 5JUMA 1RAIB 4C0ZA 2OH2A 1D0YA 1U48A 1KONA 2BKPA 4U8YA 1YI2Q 4DUTA 1VRUA 2P4RA 1S1TB 4TVAB 3HPWA 4QJVA 2NLWA 1GAOA 2P0PA 3PM9A 2E1RA 2CA9A 2ASJA 2WVDA 1FMWA 2E12A 5D6WA 1QE1A 1KIKA 4I68A 1UUEA 4EMKC 4OZ2A 2IJRA 2N7CA 2K5IA 4C11B 5IXFA 2H4YB 1S6UA 3ENVA 3I9QA 2VOPA 2XO7A 1NJYA 2DEJA 3MMBB 4H54A 4B02A 3EPIA 1BBZA 1RYSA 3PKYA 3ER0A 3G8QA 3GMGA 2JXBA 3CGIA 3FCVA 2ALYB 3A8KA 1Y3JA 4DSFA 1AFJA 4M75F 2ACYA 4MH8A 2QLWA 2N3LA 3TVKA 1VQ4A 3JS9A 3KJVB 3VCDA 4PPZA 2BQRA 1Q8BA 3CE8A 4EMKB 3QZ9B 1CQNA 3CO9A 2WTFA 2YWWA 4CQ1A 1C1CA 3PGGA 4L6V5 4LVNP 5IM0A 2LQKA 4KKOB 2KYXA 3FQKA 2X1FA 2E41A 2HQDA 2AZVA 4K4UA 2FHDA 3GJTB 3I5AA 1G3OA 5CA5A 1MWQA 3E9FA 5J2QA 2EQIA 1RHKB 2MI6A 5KCOA 2MMPA 3ELHA 1JRIA 2IDEA 2EI5A 1LV5A 3RKWA 4EFAC 5BYQA 1H641 4TY8B 1FX7A 3RW6A 1BQMA 2DNRA 1LVKA 2L9DA 4M7AG 2OTJS 3SB2A 2L8DA 2QA4A 2C0OA 5F3TA 4A47A 1JJ2S 4C92C 1FYNA 2IMOA 2OPQA 5CKBA 4K4TA 3NWRA 1VRTB 2GV1A 1X5TA 4YB6A 4QU6A 1QLYA 3OTCA 2CPEA 5IOLA 3NHNA 3EVMA 2EVZA 1F9HA 1SUQA 2JEFA 4CLLA 3FMWA 2ROGA 3OTOJ 2HVZA 1TFWA 1WOSA 3MR5A 2F1FA 1JQGA 2A08A 1Q1KA 4LRAA 1Q7YT 2VFRA 1VR6A 4WPAA 4R55A 4NWBA 4ZJLA 5DLGA 2D74B 4LF8F 4JI4F 4G3IA 2W2QP 2OEJA 2VYTA 3N6NA 1AWJA 1G7CB 3US5A 2RRNA 3CDAA 5KG4A 4JV5J 2ZPGB 2HMIA 4JZ3A 4M7DF 4NZ7A 3KUFA 1VQ9Q 1VC6A 4ZIVA 1K4US 1HNIB 2D9TA 2X7IA 4IRCA 3QWUA 4P7VA 1SJ3P 3G7ZA 3GSIA 2KT2A 2QLFB 1UVNA 2G1HA 2RUGA 3JB9F 2E1PA 4KH1B 3BGRB 2KHCA 4A46A 2A28A 4DS4A 3BGFA 3IWXA 2RQVA 2FLLA 3DB4A 1JKHB 4ZVQB 5G0RB 2JTEA 3OS0A 3SDEA 4QIFA 2VHGA 2W2PP 5AXKA 1T03A 1FXRA 1RHMB 3A8IA 3PFSA 3KLGB 4X4UA 2VPXB 7FDRA 2XTJP 2CNNB 5J26A 3Q8UA 1N4LA 4CO0A 3UNYA 3ZNUA 1TOVA 2Y90A 3CCVA 2H54B 4TQRA 2JT4A 1N32F 2PC6A 1CULB 4NL2A 2DBBA 4CLFA 1UVLA 3I5RA 4ZDNA 3J7AN 3QGPA 4X34A 1UETA 2AU0A 2D1CA 1VQLS 1QWFA 2V2VA 1KS2A 1S1WB 2R3VA 2ALZA 2EKHA 4IFVB 4ED8A 2YQ1A 1BK2A 3MURP 1JJ2R 2RDIA 1RTHB 5FU7B 2JLEA 1SV5B 2GFFA 1I94F 5DDOC 2KRMA 2B7BB 2ZZNA 4DSJA 5J2MA 3DRYA 2VFUA 4N4IA 3CXCP 4C98A 4OHZA 1YJNA 1LNQA 5I22A 4YB5A 2F7VA 4J9MA 2LZ6B 4ZKAA 1RTDB 3DLGB 2WOMA 4LF7F 4J9IA 2NPIA 3C16A 1FO1A 2ZJPQ 4CO2A 2DTOA 4TQSA 2BTTA 4H4OB 3QBYA 2VWFA 2MZTA 3FZBA 4JI2F 2LDMA 3W5XA 2BIVA 3CCMS 2D0QB 1NSKL 1WJSA 2KGTA 1YTYA 5KG5A 3CDEA 4V2SA 3M6XA 3N0VA 1EETB 2ZH8A 2FJVA 2A6MA 3ZEHA 4DPXA 3VS6A 2AMCB 1UW4A 2E6NA 4NOYA 3T5JA 3P5TL 1GT8A 2Y3YA 1TL3B 1A6LA 4ZJQA 2FLOA 4QCLA 4F7UF 2YWGA 3CTRA 3MEWA 4DN0A 1F60B 2AHOB 2HIYA 3PG9A 3QWYA 4I2QA 1AHJB 1R27B 2HVHA 1X6GA 4O6JA 1NK6A 2EPIA 2MPXC 3FJ5A 3IRWP 3EVOA 1QCOA 3Q1JA 3PMTA 2VQFJ 2L3PA 2QYZA 4OV6A 5HVHA 2L3SA 1EFNA 4PZVA 2YH1A 2ZJQQ 4M78D 5HQMA 4YB7A 3RRGA 1BXNA 5GAN6 4QR0A 3D67A 1TR0A 2HZVA 3J7ZT 2OPPB 1YKWA 1F3FA 2GJIA 4ZA1A 2M9UA 5CHCB 3CVKA 3T3FA 4PFPA 2BMBA 5F9LA 5ETSA 3G6XA 1EKSA 4IOBA 1ZSGA 5CYQB 1P9YA 4CLYA 3ZL7C 2JLFA 1S0MA 4RTWA 2AKWB 3Q24A 4MYUA 4AG1C 2D1XA 2V4QA 3KXDA 1MSWD 2KRBA 1OQ6A 1VQ8S 3NBPA 1X4FA 6FD1A 4L72B 3Q8SB 4QR2A 1XC9A 2Z2LA 3TW0A 5E7OB 4P2XA 1W4SA 2LXUA 4WF9Q 4QWAA 4RBTA 5HLFB 3LW5C 2ZVIA 3MMJA 4LDWA 1X69A 2HAXA 3TEGA 2CS7A 2OTJA 4DBFA 3FCHA 2F2XA 3M0SA 2QRRA 1ZUUA 6AT1B 1SL2A 2HNYA 2LRQA 4PJOA 1WDXA 2CQHA 5FWBA 1NJIU 1T9VA 3VGTA 3ITHA 1TMMA 4FDFA 1NKCA 1AUSL 4PK4A 1UWBB 1Q8LA 4A8YA 1Y3KA 2DY1A 2MIOA 2WVCA 5DRKA 2VJUA 3OTOF 1N0UA 4DV7F 3DXSX 4ORZA 4EMHA 2PMZD 2XC9A 5GAN4 1OPLA 4X4OA 1QTNB 1YIJQ 2BUNA 3EPGA 4OZ0A 5FD1A 2J9EA 1I5LA 3NY0A 1I51B 4MT1A 3GNFB 4Y2IA 4ENOA 2F5KA 4OV1A 4JV5F 2NWMA 2GX8A 1RAFB 1UE9A 3HSZA 4MKVA 3T9NA 4M77B 3HD1A 3NTHA 4QKUA 4OFZA 2V1RA 1WXUA 4YB1P 2YPYA 2QQSA 4ED0A 2WB4A 5IXBA 1LW2A 3LGHA 4LQ3A 1TFYA 4M75G 3GTYX 4HCZA 1I5OB 4NXMJ 5HMZA 1CC7A 2UXDJ 1KEKA 3DHWC 4P73A 5E2QA 1T9XA 4DWIA 4LUBA 3R2DJ 3CC4A 1R8CA 2CWXA 1BC6A 1XR6A 5IS2A 5D8HB 3M6VA 3BO3A 2WBMA 3FFIB 2FGCA 2P2CB 1C0TA 1T0TV 3C66A 1N6AA 1U1OA 3K59A 1Q81T 4OGEA 2Z58B 2QYCA 4RTTA 3X24B 5KFNA 3JCMc 1RAJA 2OEKA 2P0QA 2CZ7B 1Y96A 2IIMA 3EGXA 4TN2A 2AWZA 1B7YB 5THWA 1IWGA 2MSTA 4FPRA 1YNZA 2QTXA 4JJCA 3BYPA 2HK3A 1UJ5A 3C6TA 3V8KA 4Y00A 2PVGB 2QJ3A 2CP5A 4U8VA 3P45B 2HQ3A 4KO0B 3KOAA 1VQLA 2MB0B 3Q8RB 1NLPC 4B3OB 3VVUA 1M1KR 4C7QA 2DL5A 2BZYA 5T7LA 1WTBA 4CLTA 3GJSB 2C2MB 3JCMJ 3MHXA 1WF0A 4Y28C 4URGA 3IG1B 4NLRA 3QFWA 5DM6Q 2AQ4A 1LFPA 2B9EA 3QDFA 4O3PA 2GQCA 6FDRA 4YHHJ 1KFSA 4A8KA 1TK5A 1GFWB 3G8TA 1BQNA 5KAKA 1WNLA 2HDAA 1FTCA 2HVEA 1TL1A 2XI3A 2ZUGA 1DJ7B 5LJ5g 2R57A 4YDDB 3KLIB 1UPPA 3N6LA 1WG1A 4RTUA 1YJVA 3OUYA 4IQXA 2W01A 4UW2A 2HS0A 2FJWA 5B0CA 1WF2A 1IUJA 4XU2A 4CO3A 1VRUB 3VRYA 1N36J 3DCAA 3JCMP 4TKTA 2NREA 4HCBA 2G2ZA 4M7DG 2V8HA 3CUNA 3G6ES 3CCMA 2E9TA 2RHUA 4XU0A 2A37A 2J8AA 3G71Q 1OYXA 4M78E 1U1LA 1TUCA 3M56A 3GF5A 4KSEB 1QE1B 1UMJA 3LYIA 1R8HA 4GC7A 3UD3P 2LQBA 2NSBA 1TU0B 2XG8A 4JLIA 4ATOA 3VAIA 1SG5A 2EFQA 1DARA 4PYDA 1UFKA 2BZ2A 4DX6A 3G96A 5GANg 2EXUA 1VBZA 1Y0HA 4G1PA 5IT9U 1IHVA 4KUIA 4DMZA 2GVZA 3A4TA 2VOOA 2R7TA 2KYMA 3UI3A 1YJNQ 3PHTA 3EG0A 1YK9A 3RESA 1VYVA 2FJEB 1Q86C 3HLUA 1CJKA 1YHQS 4OX7A 3LPEA 1WJ9A 2VQFF 1H7WA 1HWIA 4CP5A 1ZUKA 2QA1A 1T11A 1LK7A 3PVXA 3P4UB 4MKYA 2QMUB 4FYXB 3UCGA 3I87A 3L7PA 4DBQA 4LD6A 4Z8AA 2ASLA 2GCFA 2DXTA 5IM0B 5F0WA 4YUDA 3ZTSA 2GNKA 4NLUA 4F67A 1K9MC 1QUVA 3QGIA 3BH6B 2WW4A 2OTLS 3TX0A 4QYZK 2EKNA 5J2QB 4EU0A 1F5BA 4BY6B 2HW3A 3IP0A 2ACMA 4JI3J 3ILIA 1YJ7A 2ZNYA 3RRHA 1OZ2A 3W7BA 1RLDA 3OYYA 4JB8B 4JV2A 3OYLA 2E7XA 4M94A 4LFCJ 5D7UA 2YNGB 3X3UA 3REAB 2MAMA 2GO9A 4OP0A 4C3KA 3ADAC 4E47A 3KMSA 2ZHOA 2DHGA 2LYVA 2FHKA 3J80U 5ETNA 5I2MA 2FPHX 2FLNA 3PTWA 2ILYA 2MSSA 1SSFA 1SUQB 3M8YA 5E3RA 1MU2B 2EWNA 1MV3A 2H65B 1FJCA 3GOXA 4LF1A 4TLQA 1TZ0A 1K47A 4KIAA 2C0IA 2E70A 1F0XA 3BYRA 4CO1A 3QJJA 2DMOA 1NB2A 4CC3A 2V63A 1KSWA 1S4EA 2MJNA 1FKAF 2DRMA 2YRVA 5HROB 2HMIB 1Y07A 2LCCA 1IKYB 4UT4A 2A6OA 1HD0A 4ECSA 1O75A 3EZOA 1H6KX 2JOQA 4DCOB 3ILOA 2ZE2B 1VQNT 3B54A 4CI0B 5L9XA 1U8SA 1P92A 1RWXB 1FDNA 5H9EK 1NU4A 3EFRA 4Q7AA 4TU7A 3AQOA 4NOHA 4F17A 1S12A 3GIRA 3L2RA 1R0CB 2Z0WA 3G6YA 1WJQA 1RXOB 2OTJQ 2E1CA 4J9HA 4PJJA 1WD6A 4ED6A 3Q83A 5F8MA 4NXMF 3TUPA 2QLJB 3DM2A 5FWCA 2UVUA 2UXDF 4MK7A 1PGZA 2YUNA 4XK8C 3UDVA 4BI3A 3TZXA 4KAIA 3M7VA 4ELZC 3I56T 1VQ6T 1CJVA 2GS8A 1NZ8A 1ZTWA 2HSPA 4PXEA 5MLCV 1QJHA 1ROFA 1HMVA 1J5OA 4HTJA 3CCUA 2HHVA 3VHQA 1REVA 5LSRA 2B9WA 2F8MA 4RU9A 1W1FA 3ZTOA 4HXJA 5KOWA 4CC4B 3KK2A 4ITSA 3AODA 3D6FB 1M27C 1HPZB 4HHUA 1RABB 1FEEA 4P6QA 3PV8A 5KFSA 1FWKA 1BIAA 7AT1B 1H3HA 4HT9A 3ZZOA 3H5UA 4I6YA 5GAOp 1W70A 1RT7A 3DRRA 3UR3C 2O4XA 3SFUA 4RW4A 3OYCA 2IAJB 3JSYA 2MZRA 2W2OP 2J6UA 2MYSA 5KFJA 4LIWA 3MAAA 3GFZA 4NRTA 3MEVA 4ETZA 2MGZA 2XLJA 3C12A 4YHHF 5DO2A 1ZA1B 2JSXA 2ZZDA 2VBXA 4PG7A 4HDHA 4HH0A 2OI2A 4ZK7M 4ELUA 2K2MA 3LP2B 4WK3A 2RSQA 1S72S 4NYZA 3MF5A 3UVJB 4M77D 1K1ZA 2Q1LA 2YTCA 1JLQA 3HT0A 4M1KA 2CNOB 5E3PA 4EZ6A 4Q44A 1L3SA 1HW8A 4OI6A 4OHWA 1N36F 4O4RA 2M02A 3FSYA 4ALZA 2HBPA 3WC0A 4H4KA 2MDAA 3VS5A 1NDLA 4PL6A 1S9FA 3G6EA 1KTQA 3F73A 4A63B 4Y2MA 2W4PA 2DR7A 3TQ1A 2J7WA 2IM0A 1VQLQ 4PJMA 1Y0MA 2GMLA 2YKMB 3KDNA 3W5YA 1VK3A 1V5VA 3E01B 3TU4K 1RKJA 2EKYA 3IFEA 4KT0E 1O9SA 3HI9A 3OBYA 1YQHA 3CXCS 2FC9A 2G0IA 2YWHA 2K7JA 3EZUA 2Y8YA 4ESRA 2KKHA 2NUTA 4LBPA 2KM8B 1M90C 3JB9k 4N8OA 1UKUA 5CQXA 1T7PA 1BLUA 3DLBA 1RI9A 1R89A 1GXUA 4O0NA 3ICLA 1IXDA 3L9ZA 1FE4A 1YHQA 5DY9A 3G4SS 3H20A 1BHNA 4PG8A 2KROA 4BACA 3GONA 4RW6A 4C8QB 2D3O1 4XTWA 3CEYA 4KE5A 3OLBA 3IGNA 4P74A 4O44A 2DX1A 4RO0A 3KG1A 3QZ7A 1IM4A 4M7AB 2VASA 3GV5B 3MZIA 2FYKA 3OSVA 2DISA 2GTJA 2R7XA 2OTLA 1AEYA 4CRIA 3J80E 5B0DA 4JI3F 3BR9A 2FZCB 3LGNA 3MR7A 3QPIA 1JNRB 3JAMY 3H7HB 3H40A 2JUFA 2M8HA 2WONA 1AZSA 3OD2A 2F5TX 3LANA 2CUDA 1D9DA 4LFCF 4GVLA 4L73A 1S9GA 5ITHA 2CJYB 4ELYC 4RWWA 3SSQA 2RUSA 2EEYA 3I4HX 4P9SA 3IO1A 3C0CA 4DR3J 5GAN2 4XU3A 2HNYB 4M78F 4PJOB 4JI0J 4DFKA 1P6TA 4PABA 1WHWA 3KKFA 4QQGA 3ITHB 4EBCA 2HMAA 2DGXA 4KB7A 3K58A 1GNKA 2CPYA 2DHHA 2KXFA 2DEQA 4PWUA 3O44A 4M5DA 4GO5X 5MAOA 5IQ6A 1NDKA 3TWZA 3BSAA 2DJWA 1L3UA 2WAQD 4BE2A 3TZZA 2W10A 2EGEA 4F7UA 5KFTA 3IAM9 2V2ZA 4QIGA 2AJ4A 4F8RA 3N6MA 5CZVA 4DI6A 1Y9OA 4X4RA 3W60A 4ILLA 3PY8A 2P9EA 3LX7A 4JUZA 3NL0A 2R8GA 3EHQA 1QKXA 4J9LA 1KHWA 2FHJA 2E6ZA 5IC6B 4TYAA 3PYFA 5KG3A 4OX6A 4FIBA 2B5JA 2KI7A 2J6OA 2RQTA 2B43A 3CXCR 2L9WA 4KYZA 1KP6A 2VC8A 2LX7A 1Q82R 2EFNA 4C48A 1VQ8Q 1N9RA 2PGCA 2GHPA 1FD2A 1WF1A 2C3MA 3EZ5A 2C22A 2MOXA 4ZVUB 1RLCL 1K8AC 1XR5A 2EC0A 2CNLB 2E64A 5KFHA 2DE0X 3MEGB 5K8NA 4DL4A 4JJDA 3PEJA 1WC3A 5GMKm 1C0TB 5GMDA 3M2RA 4RTVA 4MZPA 4V1Ak 3PRBA 2BW2A 3DGPA 1CBKA 3TRGA 4YEAA 2YHTA 1QQJA 2GJFA 2EK6A 3GWCA 3X1LB 4HT8A 2XWYA 3NCPA 3EGXB 3M8ZA 1RCXB 2DH9A 1QKWA 4ETXA 2RNEA 2KXCA 5LJ5h 2L3MA 1UEBA 4EO6A 4EI2A 4UOFA 2LLZA 1CKBA 3W64A 2RPNA 4B9SA 2UP1A 2CH4W 5A8WB 2LQNA 3HJVA 1XMBA 4OB3B 3MM7B 4GO7X 4M77E 3FBEA 1KHVA 2BJ3A 2HHTA 1XN9A 2HRTA 5T7LB 3VS3A 2RNAA 4C8ZA 1N5VA 2RM4A 2KFZA 4U7CA 1BQNB 3JQMA 4FXWA 2YKPA 3LO3A 1NMEB 3BO2A 1S1UB 1Z1ZA 2PDAA 3MTJA 1YBUA 2YXYA 1K9AA 2RT3A 3GIMA 3E19A 3NFCA 3KK1B 3M6WA 3W62A 5K9FA 5GANh 2XZWA 4LF9J 4M8LA 3GIBA 1PC5A 2V4JB 2ZC3A 4QQBA 1FVSA 3GBQA 2A10A 3R5AA 1B70B 1VJQA 1OX9A 1FVQA 2VKNA 3MCNA 1WFWA 4DS5A 3OB9A 4U95A 1S1XA 3ETOA 4IQMA 2BR0A 2EPDA 3BF4A 2H1YA 3PIOQ 1FWPA 3UN2A 3FQLA 3MPYA 1NXIA 3M8PA 4MK9A 1MROA 1ZAWA 3BGOP 4M5JA 3L2QA 2P8IA 1SI9A 3KNGA 1NAQA 5DG7A 3A8HB 2GVZB 5D77A 1LCKA 5KFVA 4WYWA 2V8GA 2CDTA 1T3OA 2JOYA 4Y91A 1XNQJ 4RUGA 1CJKB 1KD1T 2RK2A 5L46A 3LWLA 2FJXA 3P8DA 3CXCA 2LXIA 3UO0A 5J1PA 2VC1A 1VQ7T 2OO4A 4WP8A 1F9EB 1Y57A 2V68A 1RWMB 2RKIA 3JSCA 2L3QA 2DH8A 4KHPJ 5GMKj 1VIXA 2R2TA 2K2PA 1I1JA 1J2VA 3QZ5B 1G5VA 3M8WA 1M2OA 2LNVA 4USHA 4R25A 1TP7A 2NZ4A 2MKHA 2GJ2A 1JJ4A 2GIQA 2UV8A 3G4SA 1X5SA 1C2PA 3QJPA 1ZSZB 2CP2A 2AIRB 2G0JA 2EAYA 4G65A 5KYWA 1TUVA 4QYRA 2E5GA 3OQ5A 2FZGB 3JB9I 1W25A 3MECB 4ZITA 3DB3A 3I5SA 2IDLA 5CCAA 3G6EQ 2QT7A 2VH7A 3R9LA 4FF2A 1RAOA 1M5PC 3SQGA 2Z30B 4R5PB 5GAMe 2PI5A 3AJ2A 5KFGA 5FRMA 1ZBXA 4UC4A 1FHTA 2D69A 3QFHA 1WPYA 4DLEA 1ZAVA 2HHQA 1RWPB 2HHWA 2LX9A 3CO0P 2CQPA 3TOQA 3QO3A 1H92A 4ZVPB 4BDZA 4DR3F 4M75C 2YNHA 2DXUA 5DZ6A 1I3OB 2W2NP 1XMQJ 4LD9K 4MJKA 2PE8A 1QVFA 1YHQQ 4UOCA 4X65J 4OHYA 2JMAA 3CJ3A 2MK5A 4N7TA 4X4SA 3GR0A 2X3WD 1OQ3A 4YS2A 3CBMA 1E7OA 5EC7A 4DFPA 5LMNJ 3OFFA 1VQPQ 1N5YB 1BQXA 4I64A 2RU3A 1TKDA 3X28B 1TKXA 2M0YA 2RJEA 4UQGA 2X4JA 3CCST 2J0WA 3QRQA 2BQ3A 1YBAA 1JIHA 4QW8A 1IKXA 2OTLQ 3NS7B 4M75B 1SIZA 3W9IA 3HZGA 1QAIA 5CKEA 4CDIA 2IRXA 5IT0A 3KFWX 3MEAA 2WK4A 3I96A 3L4BC 2PMWA 1PYTA 3JYTB 3D0HE 1TKTA 5HK0A 2WSEE 1FE0A 1SIWB 4GVBA 3SMZA 1RSCA 1V3SA 2UUAJ 4BE1A 2C2KB 2HRYA 3P3DA 3CCQT 4C8QD 1S6QA 3DMJA 3FNNA 1QMCA 3M58A 1HBUB 3GLXA 2J6FA 4ZVGA 3LH5A 3ZO7A 2ZOGA 1KTVA 4LR7A 5DS7A 5J1EB 4Z88A 1WI6A 5AT1B 2X4WA 5E41A 3G8SA 4J8OA 2CQ3A 2P6SA 1X7VA 4RTXA 2M88A 3R6GB 1GBQA 1FKOA 2U2FA 1CSKA 1HMVB 4KH0B 1YJTA 4DV6J 1D8ZA 4TXSA 2R8JA 2YPZA 3QQCD 4OMLA 1IKVA 1HQEA 3PVQA 1FD8A 2F8HA 1REVB 4PG6A 1RHUB 4OMOA 3SSRA 2BJ9A 1N5SA 1WOOA 2N4DA 1BE4A 1SKUB 3ZTRA 4OI0A 4C0OC 2W9AA 4YR0A 3KK2B 4ANCA 1PIEA 1YZ6A 2E5LJ 4PJOD 2NUPA 3PXGa 4M7DC 1UJ6A 2X51A 2OPSA 3EH1A 5I42A 4O3RA 3CCJT 2I5JA 2AEJA 1EIYB 3HTRA 3HMJG 2FYXA 2M8DB 4WZQA 4KRWA 2XBPA 4B9WA 2COWA 1UECA 2CJBA 3MM8A 3DRRB 2O4XB 2K1RA 2KJVA 4M78G 1QSSA 2QE5A 1NYGA 4DR7J 3BN7A 4IFYA 2M4MA 1RT5B 2MLXA 1TKZB 3OYNA 1VK8A 2MGZB 3X25B 5GAMd 4XO0A 3TAMA 1WYXA 4QIEA 1X31C 1M1HA 4I67A 4YDXA 4M7DB 4B3TJ 3CCLT 1UFLA 4CTAB 1U45A 1VLOA 4IO1A 1HL6A 4DR6J 3T19A 2XNRA 1C4CA 1YVFA 2AJ0A 4XTVA 1HARA 1KNZA 1PJ6A 1T3SA 2DTJA 2LDIA 4LF2A 1AD5A 5KFEA 2MZ1A 4NLWA 2B6AA 1N54B 1XTDA 3LP0B 4HI2A 1D9FA 2KG0A 3M1VB 1RACB 3LF0A 5HBMA 4QPXA 2RB6A 1WGSA 1ZBJA 3D68A 1KN6A 3K0JA 4PR6A 5BR8J 2HHXA 3QIIA 3FBCA 5CZXA 1M30A 5CQGA 4LF6F 4LRFA 2RO0A 4HL9A 1TELA 1S4FA 2UZAA 1RI0A 4OVAA 3DOLA 1KHCA 2K3KA 4JDSA 2I8EA 4OZ1A 4AUKA 4J9UE 3CD6T 1FEHA 3L2WA 2NUTB 4JI1F 2O01E 3VAKA 1Q8IA 2PEHA 2E3IA 5A0LA 1XNQF 5C6SA 2G1DA 3M59A 1UTIA 2HL3A 4KBIA 3W2WA 1BWVA 2K6DA 4O5VA 4L3KA 3CJKA 3C94A 2LKZA 1UGRB 3WHIA 1IRXA 4RW6B 1U1SA 4KHPF 4Y3CA 3PFEA 2EJ9A 2JMCA 4RNFA 4HVWA 2KFNA 1S72Q 2VIHA 1RADB 2VU5A 1TK0A 2DGSA 2LCLA 4IKAA 5B0AA 2BDPA 3AT1B 2OAUA 4GBQA 1FI4A 1A7GE 1OPZA 1M8MA 1Q5VA 3VYHB 2MZQA 4YQWA 1W7WA 3IBCB 3RKXA 3GQCA 2HAFA 3KFVA 4FPIA 1M5SA 1M5VC 5BYRA 5B09A 3MP8A 1S9GB 5GAEU 5IT4A 1GCQA 1HFEL 3ZXWA 2ERRA 5CKHA 4B6MA 1NK0A 2JFDA 3C8YA 2PEBA 1U0SA 4IOCQ 3CMES 4FS2A 3PW0A 4OJHA 1NEGA 1K1QA 1ZZNA 3CPWA 2XG8D 2OD6A 4GRSA 5AE1A 3FDSA 4Y2CA 1N6QA 4E7KA 1O6XA 1XMQF 3V4MA 4F7UB 1HNZJ 2B56A 3CJ5A 3GB0A 2ZH6A 2AX0A 5BXIA 4C8QE 3KXTA 3BDPA 3UCUP 1Y5LB 1IREB 1H2VZ 4OZ3A 5LMNF 3W3SA 2W1BA 2J6TA 2NR0A 3SWNA 1YG0A 3IR6B 3IC1A 1VQMT 2CP3A 4JRPA 2LQ5A 1EP4B 1RISA 2AZ3A 4RBUA 5L39A 1WUUA 1ZLMA 2B5JB 5IHNA 2A0FB 2RD1A 3NGUA 3I55S 1IZ6A 5B0GA 3IRXB 4QIVA 4DJBA 1IO6A 1D3BA 1VCTA 1FJGF 3LP1A 3RB4A 3TVTA 4F26A 2RVJA 4F0HA 2PVOB 4ZVOB 5EN1A 2CG8A 3PNWC 4AFFA 4PJOE 1URNA 2H4WB 1YCYA 4C5HA 3JSBA 1IB8A 3WVDB 3AOAA 5KFKA 4N77A 2QV6A 4DX5A 3GP9A 2ZPHB 2AX1A 2XCAA 3KUHA 3M2RB 4BCAA 3SEMA 2MKSA 2BJDA 4PWWA 4ZTFA 3D5MA 4A8QA 3CD0A 3PFOA 3JXOA 4JLGA 2WBRA 1JLBA 3ZC4A 1E6VA 1M1KU 3D54A 4DL3A 4WCIA 4DV6F 1WEZA 1XEZA 4DN9A 4RUHA 1Y7XA 1SB6A 4KGZB 4DA4A 1WG4A 2V6AA 2CZVC 2VKRA 5KFMA 3TI0A 1EIFA 3ENQA 3L1AA 3HHLC 2IIHA 3OFGA 3HHTB 1BCOA 2YLCA 2YWEA 2E5LF 4XIUA 3IQLA 4B3RJ 5K8MA 2DL8A 3TUJC 2B4PA 3M55A 3M0QA 2KHDA 2W4DA 5DGBA 2MLZA 2PUKB 1LFWA 1S0VA 3K5OA 4JV0A 1X6OA 1CJUA 4NPOA 1R7IA 5F8JA 4JUVA 2HKEA 4FYYB 3MMCB 4DR7F 2CREA 5KFDA 1LW0B 2OSRA 2O88A 5LJ3e 1ZBTA 3OS1A 3N9UC 3RMQA 4QWEA 4DSEA 5JXSA 1XNIA 2LU1A 2Z2YB 1VDHA 1VHFA 1F9FA 2I38A 4LBIA 4URQU 2RF2A 1YX2A 1HBMA 4NXNF 5I3UB 4B3TF 3SCIE 2LNHB 1VGYA 3CCRS 4KGMA 2OFHX 2CJ9A 4DR6F 5GAMf 1VQNS 1VQ9T 4KPCA 1MN7A 3A8JA 1NKEA 4CT9A 2QL9B 3TX8A 4XQ3A 2C0TA 2YT6A 3GILA 2FVUA 3K5LA 1HKAA 1V1CA 3V8LA 2ZNZA 4II1A 3PACA 2HS4A 1MMDA 3B8HA 4RW9B 5KFLA 4AL7A 5KFZA 3A8MB 4O0IA 4JYAJ 1KBRA 1NKBA 3HK2A 2K5LA 2ZKUA 5C42A 3AD9C 1U25A 2PNIA 3IBFB 4PJLA 3KHLA 3VYGA 3S7RA 1TWBA 4DL7A 1H8KA 3S3MA 1I8FA 3EE3A 1VQ6S 1DTTA 1Q53A 2IRYA 3URGA 4DG1A 2E10A 1H98A 3RBXA 5KFWA 2RKIB 2IVMA 2Q66A 1X4EA 3SI8A 2RQMA 2HQHA 2E29A 1EZZB 4NMLA 4JPBW 3MPDA 5C2GA 2DNNA 2QEXT 3C6UA 3ASKA 3OYFA 4FNHA 4BB7A 1X4CA 3HSDA 2E1HA 1S10A 1TV6A 2W25A 2Z56B 4NX9A 3TP2A 5KFQA 4O23A 2EQMA 3QATA 5GJVB 2RA2A 1SL0A 2QAZA 1JLFA 2MZSA 3VS2A 1WJRA 2U1AA 2DEUA 1OI1A 2P84A 2VDHA 4ZP7A 4JBCA 3WIUA 1QAXA 1UL3A 3I6PA 4Q8EA 1HWUA 5KG7A 5H9FK 3A13A 4A4FA 1UJ4A 3DN9A 4IR9A 2IY5B 4EPCA 3QDRB 3THPA 1JXLA 4G6VB 5A8RB 3MJXA 4PQUA 2HBRB 4ZLPA 4C6AA 4Z7YA 1ZUYA 2LU2A 3UPUA 4FSXA 3C46A 3TVYA 1TAQA 1NZAA 2DHAA 1QTMA 4DBRA 4ES2A 4U9RA 4USIA 4LFAJ 3MD1A 2BKNA 3JB9D 1U1RA 2YNHB 2DNYA 2F1LA 1NJXA 2IPOB 1SKRA 1ARKA 1S49A 1K0SA 2C3YA 2MWPA 1SJ1A 4J90A 4KBMB 2VICA 4R8UB 4LIRA 2W7PA 3IR7B 2MKKA 1WC5A 5GADI 5LJ3d 3QLHA 3PZPA 2OD4A 2K57A 2MPUA 4HTIA 3EG9B 2EFGA 1N8RR 4FNIA 1HNZF 1TKXB 2OPRB 2HL5C 2J9DA 2LQ9A 1YJ9S 4BI4A 2B51A 2FLPA 1C1BB 1VQKT 1R43A 5IC4B 4OJ1A 1IR1A 3JCMQ 2IVWA 2EJGA 4QW2A 3M8QB 1U1NA 1Z4UA 1SL1A 1HWJA 4JP8A 2R2RA 1HNVA 1TK8A 4BI8B 2KU7A 1XR7A 2BM0A 4GVBB 5D0HA 3PYEA 2FY8A 1RTIA 3V4IA 1I6JA 5D78A 1RT6A 5ETOA 1RYRA 1RT4A 3BE3A 4LN2A 1LWCB 4NYPA 3AA8A 2HZYA 1R6VA 1E6GA 1RQ0A 4EYIB 2AYMA 1SH0A 3EGWB 2DF6A 1YGYA 4M77G 3DXBA 5FJ4A 2KN4A 4IUPA 2LT1A 4CNZA 5CCMA 2L48A 2XMKA 4ZHRA 3MCMA 1NK5A 1FF2A 3OYIA 3VQSA 3DRSB 1U26A 2GA7A 2JS0A 2JVRA 4RNMA 1B0TA 3IS9A 1NBEB 2HKQB 4PUOA 1ZAXA 1HQEB 4X4NA 2ZHBA 1IBMJ 3R1LA 3I5CA 3L3CA 1NJWA 1CS4B 3ZZUA 4YY3J 3HXMA 3DLKA 3I0RA 3NS6A 1U1QA 2GFUA 1TAUA 2I5JB 2XI2A 1QP2A 1KQSP 4N47A 4J83A 2ZBQA 1HK9A 1PJ5A 2ZBRA 4J6XA 2QN6B 4USTA 2FUG9 3NOCA 3MO8A 3K5PA 1MMGA 4B3RF 3THVA 5LL6d 2I6WA 3P49B 2JM8A 3A5ZB 1U47A 3AAWB 2F2VA 4EK2A 4BLGA 4ZJOA 4PPDA 2WSFC 1JLAA 2ZZTA 3CIMA 4ECTA 3OL7A 2C2OB 3LW5E 5GAGI 3P6YC 1WKKA 2G4BA 4KV8B 1X9SA 1UTAA 2FHJD 2AKLA 3I9ZA 3TVZA 1YIJT 4HCKA 5L1KA 1M1FA 3DRPA 1FRLA 1HNXJ 2YSQA 4ANJA 3BPDA 2KMTA 4CCHA 3R5JB 4EMGA 3EICA 3JTNA 3QYGB 4W92B 4LUEA 1TTHB 3OT9A 4L74A 5KFAA 4I2PA 2BV3A 4X62F 3V6DB 1BYMA 1Q86T 1HI0P 5EUHA 1IQTA 2Q79A 2BX6A 5B0EA 2RH3A 1RBAA 2HVIA 5E3CA 5KCHA 4JZ4A 4HYKA 1XK8A 4W90B 1S6PB 1VQNA 2JJ9A 2RHIA 1RDRA 2A2CA 4NLVA 1D1UA 3PVLA 1TL7A 1KKHA 2A36A 4WP3A 2B4OA 1ZS6A 3QGGA 1T9YA 2IHR1 3AJ1A 1JU5C 1RWKB 4D3HA 2DNZA 3HHLA 4ED1A 3OXFA 1IGUA 4DSKA 2RH2A 4DUYJ 4JYAF 2HQGA 1HQUA 3DLLA 3HP6A 3T5KA 1WHMA 2V26A 2DGTA 3M0TA 1VQ4S 1YITT 3IM9A 2F65A 3T1AA 1X8DA 4E7JA 1NM2A 1G8XA 2FEIA 2DXEA 1V3ZA 1SBRA 3WIVA 4NLGA 3FC3A 3I56A 2VG5A 1VQ6A 2H8HA 1WHYA 4FKXA 1NO8A 2F69A 2EWHA 2HG4A 4JI8J 2HFUA 4DEYA 3AXKA 4LREA 5F9NA 3DDIA 2NPFA 4GKJF 1KQFB 4ZLJA 2BYCA 5EWFA 1H74A 4BC9A 3CCET 2RQWA 4Z02A 4K7QA 1S99A 2XSFA 1UFWA 3GFXA 5GAHI 3OJUA 3M9MB 5HCKA 3OVAA 3UT1A 4C92F 2FJDB 1HWLA 1NUEA 4LDYA 1IKWB 5C0MA 2Q3PA 2Z2MA 2QGFB 5HY6A 4ZIWA 2H3EB 1F5CA 1RP5A 4G1IA 4C0DB 2QA4S 3CJ2A 1NK8A 1QVGA 1S9EB 2CQ2A 2QA2A 3BB5A 2DGVA 1WHKA 4F0MA 3QJYA 4LDUA 2NYSA 1FRIA 2R5MA 1FA0A 3VWSA 4ICLA 1ULRA 4B9LA 1G3YA 1BWEA 3ZZZA 4CC7A 3SV3A 4LFAF 3FJPA 1LOUA 2M9KA 3RUBL 1N6QB 3W9JA 2LEPA 1YBTA 5EHHA 3FEYB 2RS2A 2JNJA 3V6KA 2CGHA 1N9SA 2CRLA 3VS4A 1NB7A 4A4GA 3G71T 2LTOA 5CABA 2HBYB 1WKLA 2DB1A 4WP9A 2DIVA 1Q82U 2MQMA 1UG1A 3OA6A 4J9DA 2ZH9A 3SWNB 1UVMA 4P2SA 3LUYA 2LJ0A 3I82A 3AHPA 4ZS6A 3OBWA 1UWAA 2PA8D 2E1MC 2HK2A 2HNDA 2M2BA 1XERA 1XOVA 3CPFA 3OSSC 2OHDA 4PRFA 1YJWT 3KHHA 3OFHA 1D3BB 5A6WA 3M30A 2GGPA 1Y00A 3AB4B 3CDWA 2HQCA 4WE1A 4IDKA 4OI3A 1FFWB 3O2IA 1A0OB 4M78C 1RU1A 4LVOP 2IA6A 4KR0B 1U49A 1X2QA 3FKBA 2KK4A 2ADBA 3EGZA 3CCVS 1KLMA 4UF4A 5LJ3j 3HL8A 3EGNA 1U09A 3AOCA 4FS1A 3OLAA 4ZPBA 4J91A 1VYAA 4MFBB 3S3OA 4F7UE 3CMEQ 1E6VB 3D0GE 2CDRB 2JS2A 4TLRA 5AE3A 1T9UA 2JL9A 4ED2A 1RTJA 2VKZG 3RBZA 3H98A 1IBMF 2X35A 1P1TA 1UDLA 4NZ6A 2HSEB 3M4GA 4J9KA 2DO0A 2XZDB 4CH7A 2ZBIA 4DCJB 1T05A 4YY3F 4EWTA 2EFIA 1UVIA 2KT3A 3HZEA 4M78B 2KRRA 1MGQA 4USVA 4DQIA 5DM7R 4LSLA 4EEYA 2CSIA 2F9DA 4C0BA 3B4MA 4MKBA 3MP6A 4NEZA 1NSQA 3D3CJ 1JXMA 4AL6A 3S8SA 4ID5B 4OF1A 3MEEA 1BU1A 1CJUB 4A4JA 2Z57B 1VQOT 1PD0A 5JMNA 2W7OA 4F2SA 1T0JA 2E5IA 3D66A 3I55Q 1KC8R 1RAAB 4IIMA 2LVWA 3BY7A 3UD5A 1P9QC 4OX9J 2MQNA 5C5JA 5E0OA 1HNWJ 3RGIA 4PYAA 4M4ZA 1ZETA 2GF7A 1HBMB 4NLDA 3CCSS 3W9HA 1HNXF 2UUBJ 1T3LA 4M5MA 2QIFA 2ASYA 1NJIC 4F4KA 4QVZA 3F0NA 4ME7A 1CJTA 4K8RA 1M90T 2K4YA 2JN0A 3BKFA 3FGVA 1KG1A 2EVRA 3FRNA 3A8LB 3L09A 4P75A 2JFKA 3BBFA 2KI2A 3C14A 1KD1R 4D8DA 4MMKA 2V1QA 1TUGB 1D1BA 1S6OA 2HEQA 3OVBA 2L0AA 3CCQS 3D1HA 5I11A 3OL9A 2DT9A 1FRMA 3EHRA 1F5AA 1IXKA 1Z2LA 3T9ZA 2RQUA 2IC3A 1NK9A 4J37A 2KDSA 5ADZA 3HHNB 3FZ2A 5C42B 4Y34A 2I9SA 4MMLA 2VUGA 4NI2A 1Q16B 4LJMA 3HRTA 1O51A 3MEDB 2XULA 4IKFA 2WSCE 1GK8A 3M2UB 1PBUA 5KT4A 5KYUA 4DUYF 5BYSA 3W8PA 2MQOA 1C0MA 4KY3A 4F04B 5H1SV 3LGMA 4DG1B 2BXJA 3ZZ0A 1NH8A 4AQYJ 3QIPB 2GAGC 4I69A 1SSHA 3H4BA 3VALA 2JHEA 3EFSA 3W8GA 4ZPAA 4N0AC 3C6UB 3TUZC 1PNJA 3RRKA 5D4LA 2XEXA 2VBZA 3UN3A 4XTYA 4JI8F 1R0AA 3CCJS 1TV6B 5HQ8A 4JRIA 1C4AA 1AWOA 3TANA 4B9XA 3OR2A 2UU9J 4Q5WA 1JLFB 3CCRQ 1F2HA 3M53A 4NLSA 3SCLE 2M1HA 1VQNQ 4RBVA 2KTQA 2KSSA 4YR3A 2IJFA 3ZBDA 4HVUA 5FRNA 2ZOMA 2J7KA 5HVGA 1K0VA 4C8QG 4CM0A 5LJ3Y 4PQUB 1P1LA 3T1YJ 2RD5C 3OXLA 3QT8A 4K2XA 1K44A 1TUWA 2ZWOA 2ZH7A 2ZM6J 2MTLA 3CCLS 3Q8YA 2QQBA 1HIYA 2OAWA 1T9TA 2GNCA 3AJDA 3FMBA 4WIQA 4PLLA 3K89A 1JJHA 2VUBA 3INZA 5KFPA 3OYDA 3KG4A 4M5KA 1XNRJ 5A76A 2DD4A 3TSZA 1B99A 2RQ4A 1GBRA 2DNQA 1S7HA 4OLOA 1VQ6Q 1H0HB 2DM1A 2UVVA 4DV7J 4C0GA 1HWKA 3DLEB 4F14A 3KLFA 4PJOG 5GAN7 3QRRA 1K8AT 1B3TA 2FTRA 3MR2A 1VFJA 4DU7A 3NNAA 4DEZA 5CYMA 5GADU 1M0SA 1CSJA 2HQEA 3OYHA 3A3NB 4DL5A 4G1QB 1GFDA 2HQXA 4KQZA 2KY9A 4J9RA 2LXFA 4B9MA 1UB4A 4EUVA 4TU8A 4DV3J 1HNVB 4Q2MA 3CD6S 4RW8A 4N56A 1D1AA 5AJ3J 5LJ5e 1X27A 2FHMA 3MOJB 1RT6B 1RT4B 4ZP9A 2RJDA 1CG2A 3DOMB 3RBEA 4ZPWR 3ZZRA 2HYIB 3CC4S 5EWEA 3CJRA 5KT5A 2J76E 1ELOA 1VQ7A 1PILA 1FDDA 1Y4ZB 5HJYA 3BSOA 1SJRA 2O31A 4CC2A 5C2CA 1UGVA 3EGDA 3VGSA 3KDOA 1OSCA 1UVJA 3IS9B 4X4VA 5FU7C 3THKA 2RI5A 1I4K1 3R8YA 4OMPA 4C5EA 3DKDA 2QQAA 3HDSA 4PUOB 4C8MA 2DR5A 1RKIA 2AJ1A 1B34A 4KT0C 2XM3A 4RJVA 4HACA 4BWMA 3NWGA 1M3BA 2E1AA 5F8IA 1WHJA 2CPHA 2EYYA 3DLKB 3I0RB 5KFXA 1RUSA 1FNOA 5GANe 2W9BA 4CRJA 5GMKh 4A8FA 5K8PA 3MCSA 1YJ9Q 3TJ8A 4LRDA 4EBEA 3PO4A 1S1VA 3V5RA 2WW8A 5KYYB 2RI3A 2DTIA 4FF1A 2F4FA 3CJTA 3H0FA 4J9FA 5B0BA 2AYEA 3ISND 2EJFA 1WX6A 1RAGB 1T02A 1LWEB 1SJ4P 3FRYA 2GW8A 1SJFA 1JLAB 1ZM2A 4DR2J 4KFBB 4N4GA 3BGUA 1Q79A 1IBKJ 2DNLA 2CWKA 4U67Q 1KQ2A 1NYFA 1V3RA 4DDFA 4Q8FA 4BD3A 3JCMg 2BE9B 4F16A 3K8WA 1X5OA 5LXYA 1N8RC 1UEUA 2VXEA 4OX9F 3F56A 1HNWF 5IXUA 4Q2LA 1JK9B 3PIPA 2ASDA 5AXMA 1VQMS 4I2PB 1QW1A 1D3WA 3V7CA 2UUBF 3ZTPA 2GO8A 2JVOA 3CCSA 2FL7A 1JLGA 2H5JB 4HR2A 1HLWA 3AB2B 2YBVA 1V29B 2ZD1B 5C25A 2CQ4A 4UUXA 2FZKB 1C6VX 1PG5B 2DK3A 1VQ8T 1KQSS 3LALA 1SQFA 3QKJA 2NCKL 4NZ0A 5D3GA 5KYXA 4Y92A 2DCUB 1KQ1A 2C2EA 3CJQA 1FRKA 1VYUA 3OSNA 3CCQA 4A4EA 2VG7A 2ZH3A 2A2DA 2YUOA 4ZPCA 3CQTA 1GRIA 2BRKA 1HD3A 4J7CA 4X1VA 1YWXA 2DYBA 3LGFA 5GAOl 4QU7A 3Q89A 1DY3A 3KBGA 4KULA 2O67A 2XMVA 2GVDB 1FFGB 1QVFP 4BC7A 4U7UK 3KG0A 5ETPA 2IBOA 1HI1A 4AXJA 4PG4A 2OX7A 2YUPA 2VG5B 1AVZC 4AQYF 3FVYA 5F0UA 1G3SA 2K9GA 1MUZA 5JVGQ 4NMXA 2M16A 2B4UA 3NGDA 2HWIA 4JV1A 2DVIA 2CDQA 3M2VB 1U2RA 3BN4A 2I1RA 1B64A 3MM9B 3WBZA 2OEMA 4C11A 4PXCA 3DI6B 4USKA 2LP4A 1WXBA 3QRPA 1NH7A 3MM6A 3CCJA 2EFPA 4X84A 4ZPTR 2UU9F 5L1LA 1FRXA 1LWFB 4F4YA 3GG1A 5GAHU 4NE9C 3JCMW 1ZHIA 3L7OA 5KE2A 2MXYA 2ROTA 5KFYA 2XI9A 5K5MA 1X4DA 1O5JA 3GR1A 3GFHA 4BWJA 2WHOA 3BDEA 3VAGA 3R27A 4X4TA 3RBBB 1L3VA 2XO6A 3Q86A 1UGSB 3JB9H 3T1YF 4IUUA 1VC5A 4EMKA 2AZSA 1U4BA 3CNQP 4X2BA 4ER8A 4K4SA 5IH2A 2ZM6F 1JLEB 4HVZA 4IG0B 2OP5A 3Q0AA 3CCLA 3D6HB 4KKOA 4WXOA 3RIRA 1N5ZA 4OHVA 3H0HA 1VQ4Q 2H3JA 1XNRF 3QAUA 2Z4PA 2ZPFB 5AYFA 2F5GA 2VF3A 3DHXA 4M77C 2H9ZA 2YKAA 4FVCA 5GAOr 1GMWA 1N56A 2BRLA 2EBEA 2ATLA 1K73R 2ZCFB 1OOTA 2CQ1A 4TY8A 4NLQA 5GAN5 4X9DA 1KQSR 2YKQA 1CQMA 4N0AA 1IR0A 5I3PA 4Z7CA 2E7VA 5J2NB 2HNDB 1G2BA 2RQRA 3LPYA 2HAIA 3ZZTA 4B9NA 2DD5A 1PC0A 4DV3F 1C0UA 2LFVA 2N3OA 4ZMMA 1PKUA 2GGPB 2P9GA 5EDWA 2XQCA 2E9RX 1DTQB 1OO0B 1MHNA 5AJ3F 1PKSA 2QA4Q 3LLRA 3CD6A 3EG2A 1NHVA 3R3TA 2LJ3A 1WA7A 2QEXS 4M5GA 5D4OA 4ECRA 1WHHA 5DM7Q 3EYZA 5CQYA 3DLJA 2DPIA 5DGAA 1OEBA 4NRUA 4DPWA 2W9CB 4C92A 3IAS9 3CCUS 1F2GA 3ETMA 5FIIA 4UOGA 3A8EA 4UQTA 4Z89A 3RB0A 1FWZA 1YWOA 2VFVA 4CWBA 3M5AA 2LMIA 1XWLA 3O6QA 1HNIA 5GAN3 3TARA 2RN8A 2LA6A 3CMAT 4O4GB 3HFNA 3VRZA 1VI7A 1HQ2A 3H5SA 2MQQA 5FW9A 2L3RA 3RMSA 3CIZA 4Y2AA 3MTKA 1KSPA 2UUCJ 3N5FA 1DAXA 1OY9A 4LFBJ 5G0RA 1N27A 4GLMA 1FTRA 3DRXA 3CB4A 3QJLA 2QG9B 3BS9A 2IMWP 1NZ9A 3UWTA 1PSFA 3HVTB 5E3AA 1WC6A 1CPZA 3TEEA 2JJ4D 5CVIA 3QYYA 4F2RA 2ESWA 3CF5Q 4A8OA 1JLCA 3OR1A 4DR2F 5K14B 2CQIA 5ETTA 4OI4A 2YNIA 1M3CA 5EWGA 1CULA 1IBKF 4QOTA 5CD4A 4R56A 4IH6A 1YZ7A 1VQPT 2AHJB 4A54A 1VQKS 4RG2A 4WBFA 1S1WA 4RWXA 4XTUA 4B9UA 2R9LA 1CJTB 3CCVQ 3VAMA 2A3JA 3F70A 2XNQA 1M9SA 2A1BA 4WCEQ 1RTHA 4XPCA 1VQMA 1SV5A 2R5AA 4OYBA 4IOAQ 1Z9QA 3M54A 3Q22A 3QT7A 4RZRA 2L89A 1UHFA 2JEIA 5J39A 3HJFA 2BOPA 2CZ0B 2IC3B 1EHWA 1S77D 2XDDA 2FVQA 2UUTA 1RTDA 3JB9G 1GL5A 1MWYA 2VG6A 4USUA 1BI0A 2V2QA 1KQSA 4B3SJ 3G87A 4CT8A 3SFGA 1D09B 2N4CA 3HULA 3ME9A 3HFOA 3A1YG 3W2VA 4H4OA 1AWXA 1SF9A 2XU8A 1GFCA 3DFEA 5AXLA 3CD5A 2RB7A 3TEHB 5HMXA 3KYLA 3CPWP 2B86A 4IRKA 4ECUA 4BY6C 3NRBA 3J81j 3I32A 2DRBA 1WHLA 4RCCA 3UF4A 5IFMA 2BA9A 1RZMA 4XPEA 4WU3A 5J1NA 3HKZD 2JX2A 2I2YA 1R0AB 1C1CB 4CH1A 3A3PB 2WSEC 1TL3A 3V8JA 1B7TA 1PC4A 5LSOA 5LJ5f 2XY6A 2V9KA 2BJ8A 3CCSQ 2YKOA 3OR2B 2K3XA 2VPWB 2W24A 3WZ0A 3DYAA 4YN3B 1M2VA 3GZ7A 4UZBA 1M8VA 3NGTA 1B0VA 1XQIA 4XAKA 3GLJA 3V6HA 2OJ2A 3TA2A 3PMIA 4A8WA 2M5YA 1FJEB 1Y71A 4NLTA 5A2QY 2SXLA 2COLA 1NK4A 2MCNA 4CLUA 4ZPDA 2CJKA 2ZAEA 1KJWA 1OZ3A 5DG8A 1BQMB 3FC9A 3NCQA 3QHSA 4AYBD 2C1EB 1WELA 2C3UA 1A0NB 3JQKA 5KG1A 4X4PA 3IM8A 4DX8H 1OU8A 1G6BA 4Y2KA 4FYDA 2OPQB 1N8RU 3VAHA 3MKDA 4GMKA 5LJ3g 3N01A 3T1HJ 3UDCA 5GANf 2DYAA 2PU9B 2L08A 4ZGDB 2XLIA 4N41A 1VOMA 1N33J 4CI0C 4RNOA 5I2SA 5CYQA 2EQKA 3KLFB 5KFCA 3OVSA 2K06A 3NGRA 2OJ3A 5M2UA 4J9GA 2DL4A 1SKSA 4JJBA 1HBNA 4KRTA 5L8RE 2MF2A 3FUYA 2D8HA 4DZDA 3CCJQ 1YDLA 2FB0A 1RU2A 2C2RA 4F7UG 3JSRA 5F41A 5HO4A 1P27B 4PXBA 1G3TA 4RW8B 2OSQA 3ENAA 1YITS 4V19J 4TY9A 1HYOA 2G2OA 2SRCA 5F3ZA 1R3NA 1UGPB 2JZ2A 4NS5A 4DU8A 4DBHA 1UWBA 2QC3A 2EFOA 2DITA 3B78A 3TA1A 1ZTTA 1OULA 3SDEB 3DKMA 4ELTA 3U27A 2ZH1A 4C5GA 4ID8A 1NNDA 2A3LA 1T03B 1GEHA 3T5HA 3CCES 2DGQA 2AYBA 2KZMA 4K4YA 2QEXA 5C24A 2ECZA 1S72T 1OMSA 2K3BA 2KE9A 2W0ZA 1FX4A 4PWDA 4RKUE 4TU9A 4HACB 2KQWA 1E6HA 2G0CA 2LEBA 4CH0S 1N52B 4LMZA 2LCWA 2EK1A 4HDGA 2COZA 2O01C 1D9AA 2HEKA 3JCMh 1REGX 4DV0J 3RTVA 4WJBA 4JS5A 3J81Y 1WWHA 3HHDA 3M8SA 1HHTP 1CVJA 4EMDA 2UUCF 2BW7A 4LFBF 3ZZYA 4QYZJ 2XY5A 3PX4A 2C28A 3NNCA 3Q8PB 4LRCA 3NTIA 3CD6Q 5J2MB 4J9BA 3D1QA 3FFIA 1Q86R 3MR3A 2K7KA 3AY0A 1Z2ZA 1AROP 3TCJA 3UCZP 3T5LA 1FDAA 2IM2A 4N8NA 1VJWA 3TQ7P 2WOMB 2ADCA 3C16B 5HAOA 3L2ZA 1L3KA 1RT2A 3TYTA 5KT7A 3CC4Q 1VISA 4ZVHA 1IQZA 4PAAA 5KT6A 1LXJA 4KUDK 3CULA 3QYHB 2BABA 2P4TA 3PJXA 1K9MR 5LOQA 2K79A 1LXNA 1KLNA 1JBMA 5HN0A 4DQSA 3NPFA 1VQKA 1VBXA 2K5FA 4KO0A 4GY5A 1YJWS 4B3OA 2R7SA 1BB9A 3MFIA 1IWAA 1WSVA 1DHMA 2GQVA 2KM8C 1QAJA 4WF2A 3NOGA 1SEMA 2DNHA 3VS7A 5DQIA 3BH7B 4KPYA 3KUEA 4MDXA 2FPEA 2PSZA 2YNFA 2CJQA 2UXCJ 1Q4RA 4LR8A 4LF4J 4L5GA 1GCPA 2YDLA 1I81A 2DKGA 1R8BA 3G9CA 3QWPA 1Y5NB 2VG7B 1X9MA 2ZWPA 2CZ6B 4I2QB 2R8IA 4JRKA 3CJ0A 2EGAA 4C8QC 2DGWA 4B3SF 4ES1A 1SVDA 1URRA 4ZP8A 4M7AC 4J5OA 1UVKA 3FEOA 3CCTA 4OYXA 2HD0A 2JH3A 5H9EJ 1U1MA 4O3SA 4C8OA 3OW2A 3HSBA 5GMKa 1IM6A 4TNOA 2FVSA 2ZZMA 4K0KJ 3QO9A 3C2PA 5GVQA 4EBDA 2HHHJ 4J9CA 1JB0E 1KFZA 2R7WA 3PEHA 1HW9A 4FN5A 3OSPA 2RHXA 4S0MA 2ZUAA 2DTHA 1WQ7A 4ATNA 2ATCB 1VQMQ 3CC2T 3MM6B 4PJOC 3CCMQ 3PJ9A 1X9WA 2GQIA 2KR3A 1VQOS 1KVKA 2IM3A 4P2FA 3Q2TC 2D0NA 3OYKA 2XMWA 2UV8G 3NBPB 2CJAA 1D0XA 2OMOA 2CAJA 1KOHA 4ZVTB 1BMQB 1VLYA 3NAHA 2JTMA 2HZCA 4NCBA 5GAN8 4ILMA 2DIQA 2YUQA 3WX4A 3PW2A 2CT4A 3BBCA 4MZMA 1YIJA 1QVFS 2KT5A 4A48A 1H38A 2DRDA 2XHWA 4DV4J 4CZCA 2DRAA 3O5ZA 3T1HF 2FVRA 4WFYA 3CDUA 2I0NA 2KVIA 3L95X 4NL5A 2NXCA 3LQVA 4NEYA 1N33F 3HKWA 1JX4A 2J7UA 4B9TA 1MW7A 3AOBA 1IVZA 3OJSA 4FBUA 2RJCA 4CLPA 3FRZA 1AW0A 3K5NA 2GHVC 4DPOA 1VIFA 4BHQA <