2LQBA

Metal binding repeat 2 of the wilson disease protein (atp7b)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
AGHMQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper chaperone Atox1 interacts with the metal-binding domain of Wilson's disease protein in cisplatin detoxification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 2
total genus 12
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lqbA00
1JK9B 1FVQA 1W2IA 3HDSA 2AJ1A 2FB0A 2ROEA 5B0FA 1CC8A 1SI9A 4Q2LA 2XMVA 2XMJA 3LO3A 2PD1A 1TUVA 2N4DA 2PGCA 3BR8A 2HLTA 1KVIA 3MCSA 2JDJA 1MWYA 4ZOSA 1TL5A 1AFIA 1P6TA 5A6WA 5KAKA 3FMBA 1FD8A 3HX9A 2HFNA 2XMTA 1N5VA 3F44A 1YRXA 2W4CA 1AW0A 2RU9A 1OQ6A 2VH7A 2AP6A 5F0WA 2OFHX 4ZA1A 4FNIA 3KG0A 4HI1A 2L3MA 3WDOA 4NL5A 1ULRA 4EFAC 4YEAA 5B0DA 4QOTA 1S6UA 4Q2MA 2RMLA 3KKFA 3I9ZA 4A48A 1N5SA 2GO8A 1JWWA 3BGUA 4HL9A 1YJUA 2LQ9A 4Y2IA 2K1RA 1YJTA 2HIQA 2OFGX 4DN9A 1FEEA 1V3ZA 4HH1A 1IUJA 2XMWA 3T9NA 3BDEA 4NPOA 2VV5A 2IYIA 1U7LA 1FESA 1Y3JA 1LQ9A 1AFJA 1N5QA 4YDXA 2KT3A 1FVSA 2LQBA 3BB5A 1GXUA 2W4DA 5T7LB 3IWXA 5B0CA 2FIUA 3IWLA 1KVJA 2GFFA 4A46A 1YJRA 2XMMA 4HH0A 4F67A 1APSA 2W4PA 2FTRA 2KKHA 2GGPA 2QYCA 2RILA 3E8OA 4U9RA 1Y0HA 2ASYA 3LGNA 2ROPA 3BF4A 1MWZA 2CRLA 2ZDPA 3HHLC 2K2PA 3K7RA 3TRGA 2LDIA 2G9OA 1OPZA 1URRA 3BN7A 4OIXA 1TZ0A 2K7JA 5T7LA 3QGPA 4Y2MA 2N7YA 5A6PA 2OD6A 1R6YA 5IXUA 1X7VA 1Y3KA 2BBEA 2N4CA 3BM7A 5B09A 1Q53A 1KQKA 3FGVA 5B08A 3DCAA 1X0PA 4FNHA 2BUNA 2GCFA 2HQIA 2KT2A 1TL4A 4OJ1A 2GGPB 5F0UA 2BYCA 1TR0A 3LGMA 2QLXA 5B0EA 4OJHA 2K7KA 1VQYA 1Y9OA 5B0GA 4DPOA 2GV1A 2Q3PA 1Q4RA 1Q8BA 1WD6A 1GXTA 2IFXA 2QLWA 3MZIA 4Y2KA 1FE4A 2BJEA 2IYGA 2KYZA 1YG0A 3GZ7A 3DXSX 5B0BA 2EW9A 2HFOA 1Q8LA 2BJDA 2XMKA 2ZDOA 3KG1A 1SB6A 1YJVA 4A4JA 3TNVA 3FRYA 3UDCA 5B0AA 4OJGA 1OQ3A 2FHMA 5K9FA 2GA7A 3KNGA 4OJ3A 2AW0A 2HLUA 3HFKA 1K0VA 3QMQA 1XBWA 1N5TA 4A47A 1CPZA 3HHLB 3TOQA 2K1RB 2QIFA 2XMUA 1X8DA 3CJKA 2AJ0A 2OAUA 1OSDA 1FE0A 3CJKB 1VQSA 1P8GA 3HF5A 1SQEA 3HHLA 2RSQA 3VTIA 4DL0C 4HI2A 1S6OA 1QUPA 2ACYA 2OD4A 1RJJA 2OKQA 2OP5A 1CC7A 2OMOA 3HHLD 2ROGA 2LXFA
chains in the Genus database with same CATH superfamily
1VK8A 2YKMB 1FWPA 5DDOC 3OPKA 4M63A 1R7IA 1ZZFA 4MKAA 1NMEB 3W9IA 1PSDA 4FN5A 1FX4A 4KPYA 2UUCJ 1WG1A 3ILJA 1ZYQA 2MTLA 4X2BA 1UFWA 4C98A 1QM9A 4WZQA 3NS6A 1N32F 2YKMA 1I5OB 4NXNF 2DIVA 1XR5A 4YB7A 2EI5A 3GONA 3TZXA 4JI1J 2J76E 2MZQA 2W1BA 3CEDA 4CO5A 4MKBA 4C8ZA 5AT1B 4O3PA 4OX9F 4E0DA 2CPZA 3HLUA 1D8YA 3DRPA 3BZQA 1KFDA 2RNEA 3GLJA 2X1AA 1QAIA 2IJFA 3BN4A 5ETSA 2IBKA 4NCGB 2W4CA 4HT5A 5FD1A 2HFSA 1SV5B 3RBDA 1AXQA 2RHSB 3B54A 3KOAA 2JZ5A 3RJMB 4FPIA 1W26A 1SC6A 2IA6A 1NHUA 1VISA 3SV3A 1NM2A 4U8VA 3DKDA 5CH7B 5ETMA 5A0YA 4DU8A 4Q44A 4ED1A 3NMAA 4NL5A 3AD9C 4OYPA 2Y0SD 4RJVA 2LVWA 1NPRA 4JBCA 2MHEA 2HSEB 2V8HA 1N5SA 1EARA 1RWWB 3EUNA 2GX8A 4EBCA 1NCLA 4U7UD 4GC6A 3GCWP 1QSSA 4O3OA 1RDRA 1JMTA 1NXIA 3MM9B 3KLGB 2VOOA 3M30A 1NO8A 3EYZA 1E6VA 4Y28C 1DLOA 2C2KB 3DRSA 5LSRA 3DGVA 2GS8A 1SJ3P 4LFAF 2VDIA 1IKYB 3KLHA 4Q8FA 1Y4ZB 2MLXA 1RBAA 4HTJA 1CEZA 4MAKA 1AFJA 2ZZNA 3GTYX 4HDHA 3ITHB 4DV2J 1Y5NB 3W9JA 3HD1A 3SDEA 1HNZJ 1TKZA 4P7TA 1LFWA 3SI8A 3IWXA 4HTIA 2H3EB 1UKUA 4ALZA 2YWFA 2V8PA 1QD1A 3AOBA 3WC2A 1UVLA 1I3OB 2IDLA 4HH0A 3MM6A 1E6VB 2IM0A 4DR6F 4WKRA 3SBMA 2QMUB 2AD9A 3GU0A 5K14B 2BACA 2BZ2A 2RILA 4U9RA 3RAMA 3R1LA 3DI6A 3IAS9 2ROPA 2HNDB 2AEFA 4F2RA 3TA1A 2V2KA 1UJ5A 1HWUA 5KT5A 2XY6A 5IV3A 2ATLA 2IY5B 4UQGA 2ACMA 2KXFA 3MECA 3UO0A 1M0SA 4F25A 1KLMA 1K73T 4NLRA 1QAYA 4KYZA 4YR2A 3L3CA 2WW8A 2A18A 1WSRA 1UVJA 2OGUA 1HQEA 2CQBA 4KSEB 3C3LA 4J7CA 2DCLA 2VG6A 4JV2A 1FJCA 3B8HA 1YVFA 3MAAA 2FDNA 1G1XA 1NDPA 3DLGB 4WJBA 4HHJA 1S72S 4DSEA 1TKTA 3UE2A 3UD4P 1RU2A 2DRAA 3OW2R 5LSLA 3KJFB 1FFSB 2Q3PA 1NU4A 3GYNA 3BQ1A 2R7VA 1HNXJ 3PYGA 4ECXA 1NJIT 1CSJA 1Q8LA 4AYBD 2C2MB 4DUZF 1SC4B 2YH1A 3HHKA 2COLA 2NYHA 3OVBA 1RUSA 4EYHB 1NK8A 2MKJA 1OWXA 2GA7A 2O3DA 3EICA 3HFKA 3L4BC 4O23A 3AAWB 2HMIA 3M32B 3NBPB 3LTOA 3AD7C 5LMUJ 1GX5A 2BANB 2B7CB 2DD8S 5J2NA 2IJRA 2OPSB 1I1GA 2QC3A 4QIEA 5F3TA 4DPTA 3CJKA 2CZ9A 2XEXA 5CYMA 2VFRA 1RT2B 4A8SA 3LWMA 1IWGA 6AT1B 1M5PC 4JI5J 1EETA 1WEZA 1IBCB 1RJJA 2OP5A 2YNIB 5IC4B 3M9NB 4PWDA 1FT8A 3V6HA 1N56A 3CJ3A 1W2IA 2UV8A 1KOHA 1ZZNA 1CC8A 1XN9A 1QSYA 3RYLA 1PAEX 3LGHA 5E5NA 1CULB 5HAOA 3N0VA 2EG2A 2DO4A 1X60A 5F8HA 4ELUA 1C0TB 1GFWB 4U96A 4I0WA 2Q66A 1WI6A 4RW9A 5KFFA 2WTFA 1RTZA 1HWIA 4YN3B 1U1OA 4LF9F 2AIRB 4NZ0A 2VIHA 4EYIB 4IYQA 3M2UA 3R27A 2B43A 2YQ0A 1J5EF 1JLFB 2G13A 3W1YC 3QT5A 3W7BA 2BOPA 2XMTA 3F44A 1U02A 1V5VA 1HI8A 5KT4A 5HROB 5J2MA 4P2FA 1F9EB 2DITA 4I64A 4F4KA 5F0WA 3OUYB 3HPOA 1VQ6S 3LOUA 3M32A 3NBPA 4M5IA 3B82A 4FNIA 1B99A 4KH1B 5I3UB 1RYSA 4YR0A 4Q0BA 5C2GA 2P6SA 1T9TA 4ATNA 4XDDA 2PA8D 1K0TA 1GEHA 1RWVB 2FLLA 2E5LF 1JWWA 2FPHX 1LK5A 4M95A 2MEWA 3GR1A 3SCIE 1SQGA 2C2OB 4L76A 1LKZA 2LFVA 4NLYA 4C0OC 3KJQB 4PG8A 2ZBRA 3VQSA 4ECTA 4USKA 2BJ8A 1SJQA 1NSQA 5GMKa 3JB9k 1XMBA 1ZTTA 5THWA 5C24B 4DL7A 2EC2A 3SMZA 3TWZA 4OI1A 4FDFA 5M2UA 4DUYF 2OJ3A 4B3MF 2FJEB 2KXHA 4C8YA 2V2VA 4FZVA 3I6PA 1H0HB 2E1AA 4WIIA 4NASA 1NK5A 3MPDA 1HLWA 2DR5A 1LWFB 4GC7A 1JQGA 1MNEA 3IAM9 3HJVA 4C97A 2CQHA 3C15A 3DI6B 1KC8T 2UXBF 5FLXY 4RBTA 2IDEA 4LFCJ 3WX4A 5KG3A 3KK3A 3A12A 3THTA 2U2FA 4XPCA 3G96A 3DLKA 2WOMB 2DPJA 4EBDA 4DDFA 2K7JA 2DNNA 4CO2A 2NYIA 3HKZD 2AGQA 2KDOA 3SDEB 5DQHA 2OD6A 2N3OA 2PFDA 1X7VA 3H7HB 1GK8A 3CCZA 3D1OA 3GP9A 5HK4A 3KK3B 1VC0A 4B3SF 1FNMA 2GZOA 2JLGA 4U8YA 5BXIA 5DDRC 2YWWA 3KLHB 2LEBA 2BQ3A 1IKVB 3T41A 1S76D 1N8RT 1S0MA 2ABYA 1A7GE 1RSCA 3IS9A 1PO6A 2VHGA 3B4MA 3MTJA 2KHCA 1FJ7A 3HFVA 4PXCA 2DISA 1FF2A 1WD6A 3M6UA 3TAPA 4WFAQ 2KYZA 1NK0A 1BWVA 3DXSX 2VPWB 1EJ7L 4H4KA 5M2RA 2XMKA 1FDAA 2B8PA 4AD6A 5B0BA 4CDIA 1U4BA 4PRFA 4K4SA 3QT6A 1K47A 3QZ7A 1NEEA 2EFVA 4UY85 5K9FA 1UVIA 2RU3A 2DNYA 1VLYA 3SSSA 1T9VA 4DV7F 1HNVB 2B4PA 2FQQB 3HZGA 1UZHA 2ZOMA 3MAHA 3MMAA 1UJ4A 4WP3A 5LM7E 4FKXA 3V5RA 3ZNUA 5KOWA 4ZPTR 2FVSA 2K1RB 2MZTA 3DOKB 3Q8PB 1T9XA 3BKUA 5G0RA 4G1IA 1B0PA 1VK3A 5HJXA 2JFDA 4K4UA 3QRPA 4BS2A 4ANDA 1NJXA 4QYZK 5K8OA 4DBQA 3OVAA 2OD4A 1GAOA 2OTLS 2V9KA 2VDHA 3CDBA 1RT1B 2ROGA 3CVKA 2XO6A 2JL9A 1NKBA 1A9NB 1FVQA 3EVMA 5B0FA 1YJNS 2K8GA 2MHNA 3MWBA 4I4BA 1F1BB 5K8NA 3M2VB 4DV0J 4OX9J 2DR8A 1HW9A 5F41A 5HN0A 3EGZA 5H9FJ 2GQ2A 4ZLNA 3ZTSA 5J2PB 5KFPA 2CDRB 2CADA 1TUVA 4UW2A 3SQOP 3E51A 2P8IA 2I0XA 2PGCA 4ZN1A 2C3UA 4XO0A 2AGPA 1KBRA 3KUHA 2BJ1A 4DPXA 1RBLA 1RXOB 3KJNB 3R5CA 1KTVA 3HP6A 1JLAA 4NA2A 1QDUB 3OL7A 4JP8A 2Z2LA 3DLEB 3DRYA 4Q5VA 5J2QB 4I2QB 5LMNF 2XS5A 4LSZB 4KAIA 3D7SB 4USUA 4KTQA 2FY8A 4WCEQ 2AX0A 3QO9B 1UA1A 4U95A 1OO0B 3I5AA 4CO0A 4F0MA 4TU7A 5IT9U 3WDOA 5MLCV 1IBKJ 2CPEA 3C6UB 2YNIA 4JUZA 2MQPA 1U45A 1LFPA 1ZPWX 4Q2MA 1N6QB 2GAGC 1S1VA 1ZH5A 1FEHA 3IM8A 2HG4A 4LFBF 1FDNA 3ISNC 1PYSB 3IGNA 2F40A 3G4SS 2VD3A 1FTCA 1JNRB 5KFZA 4KY3A 1T05B 3TJ8A 3KLFB 4M5DA 2ASLA 4X65F 1FXRA 3GJSB 3HK2A 3FDSA 2R7RA 1JLGA 3R5JB 2AU0A 5HVFA 3T9NA 4LF5F 1QVFR 2UXCJ 5HI7A 1IWAA 2QL5B 3ZZZA 1O51A 3QFHA 2JRSA 3LP1A 1QE1B 1FVSA 2KT3A 2QFIA 5D78A 4DEZA 1HBUA 3BB5A 4TYBA 3ENVA 2ERRA 1VHIA 2YQ1A 1UWBB 5G4DA 1SBRA 2OH2A 1Q5YA 2RJZA 2XMMA 2VPZB 2QL9B 3L95X 2FTRA 2KKHA 3M4XA 4GO5X 3VV2B 4F4XA 4JI3J 1VQ8S 2UXBJ 5CYQA 1RKIA 2ASYA 2VQFJ 3PJ9A 1FXDA 3I82A 3N5BA 4M5GA 2K06A 3R7BB 2LQ5A 4A8MP 3CPWR 1VQ9S 1U1LA 1D9FA 3KTQA 4G1QB 1SL1A 1QSLA 1JLQB 1RT4B 2FGOA 2IM2A 3N79A 4JI2F 2GHVC 5DRKA 8AT1B 2HBYB 1LK7A 3DLHA 3VVTA 1AROP 3ZZ0A 4L3KA 3W66A 2N4CA 3C2PA 1SUQB 3PG9A 4NYPA 4RU9A 4YR3A 3H4DA 4JI6F 3UCUP 4ZVFA 2PI5A 3G6XA 4NXMJ 4B02A 5C25B 4V19X 3RBXA 3SYZA 2DY1A 3DYAA 5GAEU 2E9TA 5B0EA 3JQMA 3ILIA 4RKUC 2NXUA 3D0GE 4O3SA 4J9SA 1RWKB 4FP9A 3RB3A 3OV7A 1YHQS 3ZZPA 3MM7A 2O66A 3EZOA 4M5HA 1QJHA 3R1HA 4PQAA 4C4WA 5D4PA 4URQU 5GAGU 4DV1F 1JLBB 2GW8A 4NZ6A 3DRSB 1RWXB 2E9RX 5JUMA 1NZ8A 4J9RA 1VRTA 1EX8A 4A47A 5IT4A 4O44B 2MSSA 3FCVA 3UDEA 2AJ0A 2RQMA 1NK7A 2IM1A 3PZPA 2DCUB 1SJ1A 3G9CA 3D0HE 2AQ4A 2KFZA 3HF5A 4RUBA 5E3RA 3PVXA 9RUBA 3D3BJ 1BQMA 3S01A 3QJJA 3MEEB 2OTJS 3G86A 2OMOA 5D6GA 4IH5A 4B08A 2WAQD 3RGIA 5KOXA 2BJ9A 4O3QA 3LPYA 3CW2C 3Q22A 1D9DA 1LWCB 1P27B 1SH2A 4DZ6A 3A1YG 1RT3B 1VQ5S 2W7OA 2BX6A 5AXKA 3DRPB 1EB0A 4H4OA 1TK8A 2Z2ZA 4KE5A 1SJ4P 1GX6A 3QGIA 5K5MA 4JI8F 2WRMA 1TL3B 5KFGA 1R0BG 5CZVA 3N5FA 3BKFA 2RF2A 1FD8A 4N7TA 9ATCB 2EC0A 1WEXA 5KFXA 2FJAB 1HI0P 2R8JA 3THVA 2PC6A 4ZP6A 1OQ6A 1Z1ZA 2N3LA 2IBOA 2RIJA 2ZBPA 2DHSA 3DMJB 2EBGA 3NNHA 5A8RA 3ONQA 4IUFA 4C11A 4F0KA 4Y6IA 3FEXB 4HEA9 1RT1A 3W60A 3GIIA 2LQJA 3ILLA 2XY5A 2F4VJ 1RWPB 1S49A 2P9EA 4HT7A 2GJIA 3MUMP 2IMWP 2HGNA 2AYGA 3GG0A 2V68A 4HL9A 4UOHA 2V8GA 3A8JA 2VF3A 2K1RA 2CDQA 4QYRA 3OHBA 3T5LA 2I2YA 4TQSA 1QUVA 3PR4A 1QLNA 1HYSA 3MD1A 2RKIB 2H9ZA 2ILYA 4CH7A 4DV4F 4NLPA 2DR6A 2VBXA 1U25A 1S1TA 3AHPA 1OJ4A 2XMWA 3AOCA 3I31A 4NPOA 4O3RA 5A2QY 3DLLQ 4B3RJ 3QLHA 1RISA 1CJKA 3M8SA 5FJ4A 2RQKA 2XYHB 1N5QA 4ZPBA 1X9MA 3BSAA 1HWKA 3D6HB 3U02A 2Z4PA 4L6V3 1UVMA 1S0VA 1GQEA 1RT5A 2D3UA 1VOMA 1BY9A 2W4DA 4MIAA 4J9LA 1S1TB 3I87A 4OX7A 1UAWA 1SH3A 2MQOA 2OPQA 2E5LJ 3CMQA 5GAHI 2VG7B 3CO0P 3T1HJ 2W4PA 1X4FA 3GILA 2KRRA 1L3KA 2RH3A 3O3LA 2W2OP 2FGCA 5DO2A 5KFQA 5KFDA 3HHLC 3HHEA 3R9LA 1OS5A 2HZAA 4PG5A 3MR2A 3ZZUA 2MXYA 8ATCB 4Z37A 3H90A 1XJWB 4L73A 1URRA 4DX8H 2CYYA 4X4OA 3DDKA 3G87A 5DDPC 2QL7B 1ZM3A 1WKJA 2B51A 4GO7X 4FXWA 4KFBB 4C11B 4IRDA 2DTJA 3W64A 1HKAA 4I2PA 4BDPA 1DQ8A 1KQGB 1R8AA 4ZITA 2XGQA 3AXMA 1H7WA 2Y1LB 3LALA 3QJPA 3CCSS 4Y34A 1VMBA 2ALYB 1S79A 3T1YF 4KO0A 2GGPB 1DFDA 2OHDA 3QATA 5I3PA 3KHLA 1KHVA 1AZSA 3I5BA 4OJHA 3DGPB 4YMEA 3OL8A 1MMDA 2WVCA 4GVLA 2UUTA 4ICLB 2C2RA 2CZ4A 2LU1A 1VIXA 1W7WA 4QCLA 2EFGA 4WIQA 1IJFB 2DNGA 4DXLA 2XI2A 2HQGA 2YXLA 1XMOJ 1T9WA 2RUSA 1DRZA 4B3TJ 4LRFA 1WC1A 3N28A 2FHMA 2H65B 3QIPB 1FKOA 2DKOB 3NGDA 3G6VA 2DXFA 1TV6B 3FZ2A 4W92B 3VZIA 3T5KA 2HVEA 1TUGB 1TP7A 2RE1A 3K5PA 5KFTA 1NBEB 1WI8A 4ED2A 1RHKB 3LW5C 3M6VA 4O0IA 1PKUA 1CQMA 3OTBA 3FMWA 2MZ1A 2ZUGA 8RUCA 4X66J 1JLEA 1Q0NA 2I5JB 2VJUA 1CJTA 1T95A 1JLBA 1UJ6A 4Q0BB 3I4PA 2E1CA 3FSYA 4UTGA 2Y9HA 1M5SA 1YBAA 2YX1A 3OBIA 2WSFC 4TY9A 4DV6J 1FRMA 2HGLA 3EGWB 3BR8A 2I5JA 1LXJA 4AL7A 4ED3A 2DNLA 2ZH7A 1JIHA 2B4UA 2DNQA 1XK8A 2Q6BA 3MM9A 4DR1F 2VFVA 3AXKA 2HPUA 2GIQA 4QW9A 3HX9A 1HNWF 3VF0B 3DYAB 1MWQA 2CJAA 4HDGA 4DS5A 1Q7YT 2IIHA 4X64F 2HBQB 4CCHA 3H5XA 4JI5F 3SIPB 3ZZTA 2NREA 2R4FA 1URNA 3D3CJ 5EHHA 4DV0F 2HQDA 2C2NA 3FC9A 2HGMA 3M05A 2DNKA 3HVTA 4P2XA 1MU2B 2HQFA 1RLCL 1RHQB 2DGOA 3CJ2A 3ISND 3FZBA 3W3SA 4MIBA 2MJUA 1RT2A 3RUBL 4YDDB 2XHCA 1NK4A 2Y1JA 4P10A 3PKMA 3LQVA 4MK8A 1HQUB 4PPZA 1BMQB 2I8EA 4RUHA 1XWLA 2F5GA 2RDDA 2RRBA 1HA1A 1WELA 2YWHA 2OFGX 3DM2B 3WHIA 2ZM6J 3OVSA 1HWLA 3I5CA 1YBTA 3GIJA 2KRBA 5T41A 1RA6A 2FZKB 3AH6A 1YJ7A 3CJ5A 1HMVB 3G6ES 2ZOFA 2ZH8A 3K8VA 4M5JA 4QIGA 1DQAA 3JAMY 4DV3J 3RBZA 5IT0A 3U1MA 4BCAA 3OTOF 3QZ8A 3UD3P 1X0FA 5ADZA 2NXCA 5DM7Q 2QFJA 1XNQF 4AQYJ 2QA2A 1H2VZ 3RB6A 4YFUA 1X9WA 1SL2A 4MYUA 4NXMF 3TUPA 3QGHA 1KNZA 2IAJB 2G9OA 1VJQA 4IOAQ 3M2RB 4X4SA 2J0WA 1N54B 2HWHA 4KPCA 4L72B 3QGPA 4Y0FA 2UUWA 3GIKA 2Z2YB 1N34F 1RAGB 3DOMA 4CH1A 2MLYA 3B4DA 1WDDA 3MECB 3NNCA 2QA4S 1S9GB 1Y3KA 3M8QA 4V19J 3K0JA 3W8PA 3CMES 4RUAA 3DCAA 3J81j 3PV8A 2XULA 2J0SD 4N77A 2BEFA 2YQ3A 3QRRA 3OXFA 2M70A 3P5BP 2AEMA 2F8EX 5L1KA 1RAHB 1GXLA 2BVZA 3CJSA 2L41A 2Y1IA 4K0KF 4ZVTB 3T19A 1L3TA 3GV5B 4J9MA 3PW4A 2ZH6A 4XIUA 5HQ8A 2NR0A 5DS7A 2R9LA 1L3UA 2UUAF 1YJVA 5B0AA 2QSWA 3D1QA 3U27A 4LF5J 3SV4A 1RADB 2AZ3A 1MROA 4EGLA 4ZP9A 2PIIA 3BGFA 1AT1B 2KYXA 1VQKS 1ZBTA 3KK2B 2JEFA 5CCMA 2HQ3A 1TUWA 1ELOA 4WFYA 4U7UK 3D0IE 3HHLB 3KLGA 1CPZA 2XMUA 5C2CA 1TL1B 3OD2A 5ETTA 2OAUA 1OSDA 3MI7X 5EWGA 2BKPA 2YNFB 2VBZA 3D4JA 3M1VB 3VTIA 4X62J 1M5VC 1QUPA 2C3PA 2R8KA 4WK3A 1CC7A 1B64A 1RTIB 2R8IA 5KFHA 1GT8A 5KG6A 4IDKB 1DQ9A 3QIPA 3JTNA 5DG9A 2W2PP 2X7IA 1FRLA 1OMSA 2CQ0A 2DH8A 3FBEA 5KFSA 2C28A 2E66A 2NS1B 2HRUA 2AYMA 3JSYA 1J2VA 3ULHA 1JJ4A 1AYEA 3MDFA 1F3VA 1WTFA 1R8BA 2LA6A 2PMZD 4ES2A 1VJWA 3AODA 4Q43A 3LWLA 1XNRJ 1FRIA 3Q83A 2EFQA 2CQDA 3HVRA 1REGX 4K4XA 4ECVA 1WOPA 1IXKA 4ILLA 5KFBA 5KG1A 3MFIA 1SC1B 5F8NA 1YRXA 4ERDA 4PG7A 4BC7A 1UW4A 2JC1A 1RB0A 3MMCB 4ZPCA 5L1JA 4ZA1A 1X4CA 2KVQE 3GJQB 1S97A 2DGVA 4RU2A 3PRBA 4QIFA 2HWTA 1TMMA 2RDIA 3JTPA 4QPTA 4ZMMA 3GV7B 3OSNA 2FLPA 5I3UA 4PABA 1YZ7A 4KT0C 3R7NB 3HSZA 3UFCX 4P74A 3KXDA 5KG5A 1LW0B 3H59A 3I9ZA 2W7PA 4DCPB 1MG7A 1F0XA 4I6AA 3PHEA 1JLFA 2CQGA 3EGVA 4RBUA 1S1XB 2RQ4A 1RLDA 2BRKA 4QR1A 3UVJB 1F2HA 2UXDF 2HHUA 5DJBA 4USHA 2VG7A 3G8SA 1HL6A 5D4LA 4IFVA 1F9FA 1RE1B 4P7VA 1FWLA 5AXMA 5LSOA 5LXYA 5DG8A 3NOGA 4NA1A 2E9ZA 3I56S 1HHSA 3EDQB 1LQ9A 3QSIA 1JNZB 1R43A 2J0XA 5KG2A 4X4VA 3EPIA 2G2ZA 3GFZA 4IQXA 4ZIWA 2DBBA 4JI0F 3CCUS 3A3NB 3GFXA 1BWEA 3T6BA 4EI2A 5K8PA 2KZZA 4ZIVA 4G1QA 3KDOA 1YJRA 4PR6A 1U1RA 1AA1B 1F5AA 4WPAA 2DHGA 2VOPA 5CYMB 3CMAS 2KZMA 4ZPVR 2PA3A 3K58A 2ZBIA 2VZ9A 1HNWJ 2PMHA 2AHOB 2C42A 2X3GA 3H25A 1HR0F 3CD0A 4R8UA 1VFJA 2G4BA 1VBKA 1KHWA 2KG1A 2JHEA 2QRRA 1HPZA 1EP4B 3Q2SC 4DCOB 2VG5A 2YBVA 3MMBA 2Q43A 1N34J 1YSJA 1KLNA 3MOJB 5LXRA 3BYPA 1HFEL 2XCPA 3OTOJ 1T03A 3NGKA 4LVNP 2MQQA 2KFNA 3D6FB 1Q53A 3HI9A 3WC0A 1IM6A 1SIWB 3M8ZA 4AE5A 2FVQA 4UZBA 2SXLA 2QMWA 4FYDA 1FJGJ 3PHTA 4LRAA 4DL3A 2ZNYA 2X51A 3WBZA 2VFSA 3D68A 1TKTB 4NLTA 4E2FB 1VQYA 5HMZA 1CBKA 2B4OA 5C42A 1S4EA 1RHUB 3BSOA 1VBYA 1VQNS 2F9DA 3O5TB 3QYYA 1VHFA 1Q8BA 2C3MA 4Y65A 1FFWB 2EFOA 5GMDA 2HFUA 1UFKA 1FE4A 2BJEA 1D8ZA 2I1RA 2VBYA 1G7CB 4F0HA 5LT5A 1B70B 1LWCA 1OYDA 2EW9A 1VBXA 2DEJA 4B3OB 1SB6A 2OO4A 2J9CA 2OEMA 3EZUA 3UDCA 4NEZA 4JV5J 2QMXA 3PCOB 2BA9A 1KLMB 5EX0A 3RRKA 2CXEA 2R7TA 1N36J 5U47A 1HNIB 4KHMA 1K0VA 4KRWA 2DB1A 3QMQA 2RHQB 5KFOA 3SZ2A 3FUYA 1XC9A 3UVJA 2HNDA 5CQGA 2UVUA 3ZTRA 4IOBA 2HVZA 4M8LA 5K14A 4JYAJ 3JXOA 1JJCB 4NLXA 5L9XA 3PFEA 4RNMA 2BANA 1S7IA 1ZETA 2HVIA 3HHLD 3PY8A 3VAMA 2JSXA 1SKUB 1ZAWA 6FD1A 2LXFA 3Q89A 4NOHA 1SVDA 4X4QA 1T02A 2P2CB 3FFIB 2V9WA 4DR6J 2AX1A 3K5LA 2V2ZA 4FF2A 2X1FA 2MQMA 2CQ3A 2NXNA 3CJ8A 2MQLA 1Q1KA 4GRSA 2XS7A 3KNAA 2KH9A 4USIA 4KGKA 4HLBA 1OY6A 5E3CA 1KVIA 4JV1A 4ED7A 3A8IA 3TJ9A 1JLEB 1U1PA 2VC1A 4MFBA 3PDNA 4CLTA 2MKIA 4PYAA 3I0RA 1DURA 1Q8KA 2NPFA 1X4GA 2Z2MA 1JJHA 2RAQA 3FMBA 4DU7A 5AE3A 2W2MP 1NRKA 4W98A 5KAKA 5HO4A 2UUCF 1N5VA 3N6MA 4LBHA 4LF9J 4IG0A 2PO4A 5ETVA 3ET6B 2WVDA 3KUEA 4X66F 2OEJA 4ZHRA 1NJWA 3VGVA 3KG0A 3ZZRA 4HI1A 5A2QU 2NQPA 2V5HG 2F4FA 1HBNB 1NNDA 3IRXB 4OLPA 2QA4G 2YTCA 4IDKA 5C5JA 3FRZA 2CQ1A 5A0YB 4TU8A 3VAGA 1S99A 1RTIA 1IKWA 3Q86A 4NXNJ 1S6UA 2M8HA 1SV5A 4I1TA 5AXNA 3M1VA 3ZTOA 3I0SA 4AXJA 1RYRA 3KJVB 2M8DB 2PN6A 1YJUA 2O67A 3VGUA 5CYQB 4QW8A 3P8BB 4KC5A 4QQBA 2FUG9 1GTEA 2JLFA 3DGPA 1IQTA 3MM6B 4OL8A 5DQGA 5H9EK 2GIFA 2AYEA 4RBVA 1GNKA 1C2PA 2VASA 1BHNA 2DGWA 4KO0B 2DR7A 2Z30B 2DEIA 1HHQA 1NH7A 4F7VA 1JX4A 1PJ7A 2ZH4A 3BO3A 3UNYA 1T3OA 2Y1RI 1GH8A 1P9YA 1XTZA 3V6KA 4I2PB 4ANEA 3U1LA 2WONB 2YPZA 2LQBA 2LDYA 3PX6A 2YX4A 1BGXT 2GAHC 3F0NA 4KFBA 4L74A 5B0CA 2HHPA 1FK9A 4ES3A 5L39A 2MGZA 3E2EA 4QU7A 3CJTA 2H5JB 1DLOB 2FC9A 2HVDA 3PYDA 4ID5A 4M5KA 1H3DA 4DL2A 2B9YA 1X5PA 1XIQA 2HVHA 5ITHA 2CWKA 3C15B 4DX5A 3RR7A 2DGSA 1KONA 3EDRB 4FBTA 2K2PA 5KFJA 2DJWA 3MPVA 3R97A 3T9ZA 3BBFA 4CT9A 1KEKA 1Q86T 5IT9Y 1U8SA 5DQIA 4OQJA 5CXTA 3NS7B 2JX2A 3PRDA 3SFUA 3K5MA 3JSMA 2DNMA 5IM0A 1KVKA 2MZRA 4WFZA 3SQGA 1Q82T 2XZDB 3RR8A 2CG4A 3C14A 5IFMA 3J81Y 3I96A 2JVRA 4OFZA 2FJVA 4DR4F 4P73A 4OX8A 3X3UA 5IWAF 3IRWP 1R89A 1N52B 3BH7B 1G3OA 3GPAA 1PJ6A 3CCQS 3LPEA 1NH8A 3GYXB 4ZN3A 1RGVA 4LSLA 1KS2A 2JEJA 3T1HF 3DHWC 3SXLA 1A6LA 1CJUB 3GSDA 2OEKA 1LWEA 1S1WA 4UF4A 3MZIA 3MCNA 2DIUA 2DH7A 4RW6A 4OYAA 3W5YA 4DSJA 1LEOA 1QVGR 1RAJA 2R2RA 4ZVQB 5KFYA 1YWXA 2MKYA 3ENQA 7FD1A 4HKQA 1C1CB 3EXCX 4LR8A 2R2SA 1WHVA 4C8KA 1O8BA 4O3NA 2G1DA 1OYEA 1T8EA 3FVYA 2EEYA 2OSQA 3EGNA 1NB7A 4LF6F 2HRTA 2QLBB 5CYJA 4DR7J 4ANCA 4DX6A 4OHWA 2OSRA 5HBMB 3F41A 2O1PA 3DOKA 2ZWPA 2AJQA 4CWBA 3W5ZA 3DRRA 4CTAA 3D54A 2WVBA 4OYIA 2W9BA 3F73A 3CF5Q 1N33F 1S6QB 1MU2A 3CDUA 2QZ8A 1JK9B 2F65A 2O01C 4GKKF 2ZWOA 1JXVA 1S6PB 1W25A 2XMVA 1C0TA 3HSGA 4TY8A 4YHHF 3KMQA 1XR7A 2XZTB 2ZE2B 1CULA 4C3MA 2CJ9A 4CLZA 1VRUA 1IQZA 5D4NA 2VKRA 4PCQA 4ZCIA 3CXCR 2ZD1B 2R2TA 2ZH5A 1KSPA 4B9NA 4JI2J 4GKKJ 2AF6A 4DLEA 3MM8A 4DPUA 4DCJB 1VC6A 4ZVUB 3BO4A 4KJIA 2ZOGA 3KHHA 5GVQA 1L5UA 4OI0A 1Q95G 7AT1B 2HHHF 3GWCA 3PACA 1VRQC 4RW7A 2W8KA 1J5OB 2CWXA 4RWWA 2EFNA 4FKYA 4LMZA 1TVRA 1V5IB 2JVOA 3W61A 4F50A 5IZHA 4KIAA 4ZJQA 2UUBJ 2CA9A 2GQCA 4WFBQ 2W7AA 4I56A 4Y3CA 2EVZA 3PW7A 3IO1A 4GMKA 1TKDA 4B3MJ 1ULRA 5ETLA 4EFAC 5ETNA 4ILMA 2GMLA 4WZMA 3QJLA 2RMLA 4KBIA 2QYGA 2BE2A 4A48A 3G6YA 1VQ7S 2CIMA 2KT5A 1RT7A 4RW7B 4YB1P 4KKOA 1VQLS 2D3ZA 2FLOA 3M8WA 3MPYA 3TA0A 3CUNA 1KN6A 1M1HA 3AOAA 4EZ9A 1VQOS 4ECRA 1FEEA 1FRHA 4KGXB 1TFWA 2JC0A 3B6BA 2ZD1A 4IR9A 3BDEA 2MB0B 5SUHA 1VRUB 4EZ6A 4K0KJ 1WTBA 1SUQA 3AQOA 3QNWB 3VZHA 4ITSA 4OV1A 1IR1A 4PG4A 4BBYA 2ZH1A 1SH0A 3PO4A 1CQNA 2RD5C 2DRDA 1S6QA 2WB4A 3IR6B 2ZH3A 3A13A 2XI3A 1FKAF 2ZZMA 4NRTA 3B78A 4ED5A 1S5ZA 3L7PA 1U2RA 5LMNJ 1KRPA 3BGOP 2DNOA 1RA7A 2D9OA 2VPYB 3K7RA 3Q24A 4B9LA 3KK2A 4KHRA 2FVPA 1U1QA 3KLEB 1M90T 4FYWB 4ZVHA 3MMJA 4NA3A 1QAJA 3DN9A 1TZ0A 3JSRA 2VG5B 4N8OA 4OZ0A 2UP1A 4K5RA 2YKNB 4Z7YA 4Z2XA 5F8GA 2ZH2A 4IRCA 4ID8A 3Q2TC 1S12A 1UL3A 2WVFA 4MH8A 3KHRA 1DTQA 3SCJE 4Z7CA 4LF2A 3HCXA 2HNYA 1RHRB 1IKYA 2K3KA 1Q16B 2BUNA 4FYVB 4WU3A 1PBUA 1TL4A 5HL7Q 1S7HA 1PBAA 3TO8A 1N5YA 4LVOP 1RQ0A 2AV5A 2IC3B 4NRUA 2BW7A 3KLFA 4LSLB 4LF6J 2K7KA 1GMUA 3IC1A 2CG8A 4RWXA 2NZCA 3KYLA 2F1FA 4DPOA 5J1EB 5ETRA 2MDAA 1Y10A 3MCMA 2GV1A 5D0HA 4FXVA 4CYUB 3CC2S 2HURA 4TLQA 4KHPJ 3R6LB 3BPDA 5HQLA 1YG0A 1H73A 2AJFE 2ZNZA 3EVOA 1X5OA 2IPOB 4H4MA 4I68A 3BSNA 5KFKA 4DL4A 5HLFB 5EDWA 1IBLF 2M5YA 5KT6A 3TNVA 1T7PA 2XC9A 2J6UA 3KNGA 3DDNA 3KLIB 3QO9A 2PMWA 4LUBA 2EPIA 4PZVA 3MXHP 1OSCA 1LNQA 1BD6A 1ROFA 3FEZA 4DV5F 5A8WB 2M3DA 1Y7PA 3S6EA 3RBEA 1H2UX 1RTHA 4EO8A 1TKXB 1UVNA 1HBOB 3CJKB 4X4NA 1JLAB 2WBRA 2RSQA 4ID5B 4X4TA 4HI2A 4DHVA 2F3JA 4USVA 3Q8YA 4N5SA 3G71S 1K9MT 2FVRA 2UU9F 5JXSA 1TFYA 3I4HX 2FZCB 4NE9C 4FF3A 3UN2A 4J9QA 4PUOB 2KN4A 4E8UA 1L3VA 5J2PA 1HMVA 4FF4A 1R3NA 2YNGB 3DMJA 3H20A 3H2UB 1U1MA 2BXJA 3C16B 2FJXA 4HACA 3CSKA 1S1WB 4RNHA 3IXQA 3FK4A 4K4ZA 4FF1A 4D3HA 1P1LA 4BWMA 1FTRA 1YLXA 4FYYB 2KM8B 4LFCF 5KFIA 2G0IA 1JLCB 2CNLB 3CIMA 4X65J 1RT3A 3QWUA 2B6AA 3MUTP 3I9V9 2AMCB 1IKWB 1U49A 2CPJA 1QTMA 3OQ2A 3SQGB 4F36A 5M2PA 2LQ8A 2ATCB 1REVA 3MPUB 3TA2A 2H5EA 4GKJF 1S9EA 2F9JA 5HLFA 2MQ8A 1ZM2A 1S48A 5KFRA 5I3QA 3KKFA 1RTDB 3DLJA 4EK2A 4RZRA 3BGUA 4U67Q 2ZKUA 2LQ9A 2HS3A 3MTKA 2J9EA 3VAHA 1D3WA 4CO1A 2CPIA 2ZC4A 2H1YA 3OFGA 3IS9B 4WF9Q 2YX7A 5J1PA 3WIUA 1PILA 1Q8IA 1V3ZA 2JJ4D 4ZP8A 3J80U 2OI2A 4DFPA 2JFKA 4LIWA 2PDAA 4DR2J 2ASDA 2NXJA 4DR4J 3V4MA 1B4SA 1DTQB 4IO9Q 5HSPA 5GAGI 1IR0A 2CJXB 4ECWA 1ITPA 4ZLPA 2KJWA 2QX0A 2X1GA 1CJTB 3R5GA 2M7SA 1I6JA 4PYDA 2GVDB 1VQPS 3FSXA 3IWLA 3BQ2A 3DLBA 5H9FK 3CC7S 2R7UA 2MZSA 1K44A 5D15A 1WOOA 2QTWA 3V6JA 3PW2A 1WKKA 4CI0B 5C25A 1BXNA 2U1AA 3D9BA 3BF4A 3NY0A 2CRLA 1RWMB 3CIZA 4IG3A 5FIIA 1FDBA 5HVGA 3OFEA 4LIRA 3KDNA 3J81U 1U47A 3FCWA 4N76A 5H1SV 5F9NA 2Y8YA 3BN7A 4DV5J 5IC6B 4LF7F 1S9EB 2BMBA 4OYWA 1QAXA 3O44A 4OIXA 5T7LA 2KFYA 3H5YA 3LP0B 4FS1A 3BQ0A 2LECA 1JLQA 1RT4A 2P6TA 2HZVA 4ZJOA 4M5LA 3TVYA 3E3XA 3UNGC 1SKSA 2W24A 2IM3A 3AB2B 1RTJB 3IA0A 3QT7A 1CLFA 2DR9A 4HR2A 2B6AB 4WU2A 1GMVA 1WWHA 1YBUA 2DGQA 1RZMA 4CLWA 4QWDA 5ETKA 4ZVPB 1DJ0A 2HQCA 5JVGQ 3NGUA 2VFUA 1VQ4S 2AYBA 3FQKA 4BLGA 1AZSB 5A76A 1KD1T 1SQFA 4ELTA 4F3MA 1P9QC 2KJVA 3RRGA 2XY7A 1M5OC 4KKOB 3OLBA 2WSCC 3GSIA 4OLOA 4JV5F 2W25A 1SJRA 3MR6A 1O5JA 3PYEA 5EUHA 5FDLA 2N82B 2P9CA 3KG1A 3JS9A 3NWRA 4DL0C 2H48B 1FHTA 2Q6CA 1NDCA 5EWEA 2CQ2A 3M9OB 2QJ3A 2X3DA 4GVBA 4M5DB 2BM0A 4B9SA 2ZEJA 3DU5A 3OUYA 5HP1B 2CNKB 2PEBA 2XNQA 4NLSA 1HQUA 5HROA 4ZCKA 2AJ2A 3TAMA 4EUVA 1TKXA 5IQ6A 4N56A 1WEYA 2XQCA 3MUVP 1R8CA 1RHJB 3WZ0A 4DFKA 1PG5B 2C2EA 5A8WA 2E5GA 2V67A 3M6XA 5CA5A 2ACYA 4O4GB 2GO9A 2D1CA 1MSWD 2R42A 2ASJA 2CQPA 2GJ2A 4KH0B 1IVZA 3PEHA 4NX9A 2RT3A 3HDSA 3R7SB 1RU1A 3G2XA 4YY3F 4Q2LA 3IP0A 1JXLA 4K59A 3TUIC 3A3PB 4Q7AA 4DL6A 4H4MB 1ZOTA 4PAAA 3TAQA 3MURP 2ZITA 3QLHB 4J9OA 1PGZA 2ZBCA 4P75A 3OL9A 1T9UA 1WHWA 5HANA 4ENOA 2W9CA 3ETMA 4R0EA 1TAUA 1NDLA 3U1NA 5J1EA 4JI3F 2H5IB 4JI7J 4O4GA 4ZVOB 3D67A 1FNXH 3CB4A 2MQNA 2MY7A 4R0JA 4ZVSB 3UCZP 4MTPA 1OPIA 4ED8A 3TEGA 1VS3A 4DS4A 3OR1A 2CQCA 1YGYA 3PIOQ 4R5PA 3IMQJ 4DV7J 1VCTA 1NKEA 1XEZA 2XG8A 4EMDA 5HMXA 2R7WA 4DR2F 3SCLE 1UA0A 4K50A 1FRXA 4DQQA 3M8YA 1HPZB 2NPIA 1KQSR 2FHKA 5FDLB 3IBWA 2FJBB 4K4YA 4KGZB 1CVJA 3NLCA 4JOUA 4WTYA 5SZTA 2V2QA 2XYPB 1BUXA 4TU9A 4QWCA 3V4IB 3GCXP 1RTDA 1WNEA 1YQHA 1K1SA 1U26A 3SSRA 2KL8A 2V69A 1HNVA 3MMAB 4I7FB 3W2WA 4LJMA 2B9WA 2Y3YA 2YNHA 3GJRB 4O0NA 3C66A 2FY1A 6FDRA 1S1UA 1G4CA 1FESA 1R27B 3S8SA 3A3OB 3LP2B 4B9VA 4LREA 5JJBA 1Y11A 1VR6A 3MEDA 3V81B 2HW3A 2Q79A 3ZC4A 2B3TB 1WF0A 1IM4A 2LXUA 3JTOA 3NGTA 2GFFA 2KB2A 4YHHJ 4JI7F 5IQQA 4DR3F 2OMLA 1EKSA 3MCOA 1UEVA 3FQLA 2B7BB 1M1GA 1TL7B 2ZDPA 3GE9A 3NGSA 3VQTA 3TANA 3UWTA 1R8PA 3OL6A 3TI0A 4FVCA 1LW0A 3BBCA 4B9MA 4MMOA 2XLKA 3POTB 2MKHA 2I38A 4WP8A 1ZM9A 4K2JA 4DOZA 1H74A 2F8MA 4ECSA 1ZM4A 5DETA 2GHWA 3D6TB 1DY3A 1KWMA 4OYOA 4YUDA 4J37A 3ETOA 5B09A 1TVRB 5HMWA 1NAQA 3BGRB 4RW4B 2GCFA 2RS8A 4OJ1A 1LWFA 2CPFA 4F02A 1Y5LB 3HHNB 2QSFA 1X4BA 4RUCA 4NZ7A 3HZEA 3OR2B 1NHVA 4IO1A 3V2UC 2B0GA 2RVJA 3Q8RB 4CQ1A 4AL5A 3MEDB 2KXNB 3V81A 1Q4RA 4FXDA 2IFXA 3PM9A 3I0SB 1U2FA 2R7OA 4I69A 4CRJA 2E7VA 2L9WA 2ZE2A 3TYTA 3DOMB 4TY8B 4IR1A 2YKAA 2YNHB 3O8WA 2DNZA 2GVZA 1SJFA 1HBNA 2AW0A 3L7OA 2WB1D 4OZLA 5CHCB 2FYXA 2GJFA 4NYZA 2AT1B 4ZPWR 4C48A 1GMWD 2QE5A 4C8LA 2BKOA 3TOQA 2YWKA 2J0QD 3ET6A 1T0TV 1X8DA 4ZK7M 3J7YU 1FE0A 1IBMJ 2R3VA 3VAFA 1SQEA 3RAQA 1KR4A 4CLPA 1S6OA 1F5BA 3P5TL 4DUZJ 3PX0A 2VUGA 4DSIA 4NCBA 3I32A 3G82A 2EKNA 1S10A 4XTTA 3GYGA 3BDPA 4KHPF 1UWAA 3TUZC 3MM5A 3HSDA 4JI6J 2FB0A 3T1AA 5A8RB 1SI9A 4HACB 4UOFA 2KVIA 2QV6A 3TZZA 4NCAA 1NDKA 1RWNB 4YB6A 3W65A 2IMOA 2YNGA 4MIWA 4ZLJA 2A6OA 4C9DA 1F2GA 2MLZA 2QLFB 3FFIA 4RO0A 3SEOA 5BYSA 1I51B 3UQSA 3P6YC 2FZGB 2JDJA 2Z56B 1PYTA 3DM2A 3CCES 2GHPA 2HHHJ 3HFZB 4PXBA 3H5SA 2GIRA 2JNJA 4H4OB 4KGMA 5F9LA 1R0AB 4TLRA 4F3OA 4LBIA 4BHQA 2HAIA 1WC5A 5E3PA 1AW0A 2LCWA 3IM9A 4WXWA 2MKKA 4PXEA 4PKDB 2J5AA 3C14B 4M1KA 4RW8B 4WBFA 3BKTA 2OPRB 4OZ5A 1YRUA 1Z4UA 3JSMB 1UFLA 4DFMA 3UW1A 3M2RA 3TW0A 3E01A 2L9NA 3MEEA 3CCJS 4FBUA 4B3OA 2MKSA 4CLSA 1SC3B 2CNNB 3BYRA 2E7XA 1R0CB 4DF8A 3RB0A 3C8YA 5K8MA 2WHOA 2W9AA 4ZCMA 4E98A 1CG2A 1YJTA 2HIQA 3W2VA 1NB2A 3CE8A 2UUAJ 4ZPAA 3JQJA 1PC4A 3SCKE 3VAIA 3VVUA 2QLJB 2XWYA 4NLWA 1FK9B 4LRBA 5D77A 1TU0B 4X4PA 4WYLA 3EPGA 2YVSA 3AJ2A 4ER8A 4OYZA 5LOQA 3QWPA 1FFGB 4FS2A 4QZVB 1BC6A 3R2CJ 2FD2A 4OI6A 2XM3A 4JI4J 1DTTA 4EWTA 3M2VA 4YDXA 5CCLA 1FKPB 1MMNA 4ECUA 1WF2A 3MR7A 3K57A 3MM5B 2JLEA 5KG0A 3A4TA 3J80Y 3MMBB 4DSFA 1FJGF 2AJ4A 1C4CA 1FDDA 3KLEA 4AFFA 3C19A 4OYBA 1IKXB 2DHAA 5F8MA 2BQUA 2E5IA 3ZTPA 4QU6A 2YWGA 5G0RB 3CO9A 2HBRB 1MLAA 4KB7A 3PYFA 2VG6B 1DARA 5AE2A 1YJ9S 1HQEB 3ELHA 4M94A 2WBMA 1RWUA 2AGOA 2GVZB 3J7AN 3N01A 4FPRA 1HR0J 3DOLA 3LP0A 4Q45A 2J9DE 3PR5B 2E7WA 2IVYA 3IRXA 4ZJLA 3TJAA 2CUYA 2V94A 1R6YA 4C3LA 4DI6A 4AQYF 2V4JA 3EVWA 1N88A 2EBEA 3CNQP 3MGJA 1KQKA 4USTA 1C4AA 4ICLA 2IRUA 2KT2A 2KM8C 2RDJA 1RABB 3A8EA 1EHWA 2NUUG 1V9OA 2NZ4A 3QIDA 2HRYA 2NSCA 2RRAA 1UP1A 1UWBA 3KMSA 3W63A 4H54A 4KV8A 4ED4A 4M5NA 1IKVA 1U09A 2GVDA 2HS0A 3UDLA 3DHXA 1WF1A 2BE2B 4OZJA 2POKA 4EEYA 1G2EA 2IVFB 4L75A 2DGTA 2K3IA 2LA4A 3AD8C 5ETPA 2UVWA 2GC8A 1RCOB 2EWHA 4DG1B 5JMNA 1WJ9A 2XWXA 3DFEA 2XNRA 2PT0A 1RCXB 4OJ3A 3GMGA 4CNYA 2J9DA 3QRQA 4USJC 4U6PA 1IN0A 3T6JA 1N5TA 2HIYA 4IKAA 3W2VB 4F26A 5DLFA 1I94J 3EZ5A 5LJ3Y 3PX4A 1WACA 3BR9A 1U0HA 2HK3A 4JV0A 3MR5A 4B9UA 2KTQA 2D9PA 2W2NP 5E2QA 3PXGa 4NLGA 1SCJB 1U2CA 2DNRA 3KLVA 3KK1A 2M52A 5D3GA 2YKQA 1HNIA 4C8MA 3MM8B 4W4MA 3S7RA 1PJ5A 4C7QA 2Q1LA 2QG9B 3FEYB 3PEJA 3JAMU 2IRXA 3MHYA 2PI4A 3LP2A 3TZWA 1CJVB 5E0OA 4MYTA 4LSNA 1DZ5A 1HIYA 4ZP7A 4TQRA 1W2BR 3AFGA 1DHMA 1HQ2A 3D1HA 1NUEA 4OZNA 3W2WB 3OTCA 3PKYA 1WSVA 2G2OA 2ZVSA 1FCAA 1YKWA 3US5A 5C42B 1P6TA 1B0TA 2W9BB 2B9XA 2BQRA 1XMQJ 3BJYA 2YNFA 1OY9A 2GMHA 4YB5A 2IHR1 5E33A 3UD5A 2BM1A 4RLEA 2C3YA 2AWZA 1Q79A 4DMZA 2QN6B 2HHQA 4PWUA 4N41A 1EIYB 2UU9J 3UCGA 4P6QA 4NLOA 1MROB 4A8WA 4YY3J 3K17A 4P52A 2J6TA 4LF8J 2L3MA 4DV1J 3ZZOA 2UV8G 1F60B 3OXGA 3OHAA 3G82B 5KFMA 4LR9A 3UDVA 1Z2ZA 4QOTA 3NS5A 3T5JA 2XGPA 3CTRA 3J7ZT 4Y2CA 4JYAF 3NG8A 1UTAA 1SPBP 2ZHOA 3CT9A 3HT3A 2BRLA 3DC2A 4Y2IA 1TK5A 3BS9A 4LF8F 2Z58B 1VYAA 3WQPA 4NWBA 4USMA 4RL1A 3N6LA 3J7YI 3RRHA 1H6KX 3PJWA 1V6HA 1NKCA 3EE3A 1RT6B 1IBLJ 3KLIA 3CD7A 2WSEC 3M8PA 3V6DA 2UXCF 1UW9A 2ZH9A 1D9AA 1U1NA 1RK8A 4XAKA 1AUDA 4K4VA 4UUXA 3TR5A 3UPFA 4RR5A 2V63A 5DGAA 2XLJA 2HHWA 4OYMA 5T14A 1U1KA 3PRVA 3V6DB 3EXYA 1I94F 2J7WA 2YH0A 2RS2A 2DVIA 2GMJA 2IAJA 1FWKA 4MK9A 1ZS6A 4F67A 2UUBF 2DPIA 4OYXA 1UPMB 3E8OA 4P2MA 1HD0A 3D6MB 4RW4A 3TAMB 2V34A 1LOUA 1MWZA 4WWSA 4X4RA 4B3SJ 4P72A 3DU6A 2E1MC 1OPZA 5I42B 1AB8A 2MPUA 1YK9A 4QR0A 4V1Ak 1RACB 3LH2S 4LQ9A 2MYFA 1U8WA 2D41A 3DDIA 1UVKA 2VKZG 4C3KA 5A6PA 5IXUA 4CLUA 2E29A 4U7CA 1Y5IB 5ETQA 2V8VA 4F3QA 3HXMA 2N7CA 2PE8A 3ZO7A 3EM1A 4ELVA 2JH3A 3CJRA 1YDLA 1X0PA 1H98A 1S57A 3L9ZA 1OY8A 4FNHA 4NYOA 2YKPA 2V6AA 5D0RA 3HMJG 3BEGB 4X4UA 3LGMA 3RZAA 3H42A 1FXLA 1F6TA 1UEUA 2BABA 3ADAC 4TN2A 5B0GA 2OIHA 1JKHB 1RWOB 2M4MA 4OHZA 2A3JA 1ZAVA 2CVEA 2DY9A 3DNCA 3H0PA 3PJXA 4B3RF 3AJDA 3Q8QB 4P71A 4DPYA 2CVIA 4LSNB 4ZVGA 2V4JB 2C2DA 3O1LA 2APOA 2B5JB 1S1UB 2MZJA 1O6XA 2BJDA 2CPHA 2XYGB 4NEYA 4OI4A 5KFAA 1U24A 3BGLA 5L46A 3M8RA 2HHXA 3DOLB 1HW8A 1SXLA 3LUYA 1NLKL 4ZVRB 3VALA 2LEPA 2BE9B 1HBMA 3OTDA 1X9SA 2VA2A 1ZTWA 4ES1A 2CNOB 1XBWA 3NKYA 4IG3B 1HI1A 2UXDJ 1A0OB 2F4VF 1D0EA 1XQIA 2P5VA 1U0HB 1TL1A 1NHKL 2M0GB 1MW7A 2VPXB 2Z57B 3BPSP 3HHLA 1B7YB 2H4WB 2VL1A 1VRTB 3OFHA 3I0RB 5HMYA 4CNZA 1M5KC 1H2TZ 2V8DA 4A4JA 4DN9A 2I9SA 5BR8J 1TKZB 4HHUA 1WUUA 3VGSA 4RNNA 3CCWA 4DF4A 3HHDA 4R5PB 4CZCA 2XMJA 2XSJA 2PD1A 2A6MA 3MM7B 1WDTA 4OX6A 3LAKA 3PTWA 2N4DA 3FCHA 1RAFB 2AEJA 4OV6A 4AUKA 4DN0A 4TKTA 3NCPA 1T05A 1N4LA 2Y8WA 1AFIA 4LR7A 1S4FA 1RP5A 4X62F 1ZA1B 3PNIA 5CD4A 1M1KT 2V4QA 1RI7A 4IH6A 4IOCQ 3IFEA 2EFPA 5DDQC 3CD5A 4D3GA 5L38A 2VJVA 3GFHA 1N6QA 1O0PA 3UI3A 2VH7A 5D4OA 3W9HA 2LP4A 1Q78A 2DGUA 3C6UA 3GG1A 3HVWA 3IBFB 4DJBA 2DGXA 3D66A 5E3QA 3T3FA 2J8SA 4FYXB 2Y0BB 1X4HA 1X4AA 3LF0A 5ETOA 3GJTB 1GMWA 2BOAA 5KFWA 3R2DJ 3EX7B 4DR7F 4PWDB 2B5JA 3CDAA 2BW2A 2DH9A 5FLXU 4LT6A 2CJQA 4A8FA 5F8IA 3NNAA 4UUWA 4F4YA 3OTEA 1JLCA 3JYTB 5J2QA 3CDEA 4JI0J 1ZA2B 1G6BA 3D5MA 3RB4A 1KKHA 5J2NB 4A8OA 4DV4J 2BDPA 2DNHA 1IKXA 2F63A 3NAHA 1K8AT 1PCAA 2FJDB 2C3OA 4B17A 2KI2A 5HJYA 5HQMA 5GADI 3QQCD 3J7Z5 1RAAB 3HKWA 1S77D 2CQ4A 2B56A 3C16A 2V50A 2HZCA 4OZ1A 3WIVA 2IYIA 1U7LA 3RTVA 3LP1B 3NRBA 1DTTB 1TELA 4M5MA 3CCRS 4LF1A 3MEKA 3HD2A 3SSQA 5KT7A 2VQEF 1ZAXA 4A8YA 4MKYA 1EP4A 1JLGB 2FIUA 4DZDA 4WE1B 1WHXA 4R8UB 3BSCA 4NI2B 5D8HB 3N6NA 1HBOA 1YRTA 3HM9A 1QY7A 2VB6A 5K20B 4K4WA 1Y0HA 1QTNB 3G8QA 1HWJA 3LGNA 5IOLA 3UR0A 2WW4A 4ZS6A 4WTOB 1Q5VA 2MMYA 3PW0A 3SFGA 2OPQB 2J6SA 3K5NA 3BO2A 1EQMA 3AA9A 5DZ6A 1VC5A 4CH0S 4RPFA 1NK6A 4OHVA 2D3OR 4QR2A 2A0FB 3QBCA 4EBEA 3KUGA 4C0HA 1NZAA 3AQPA 1GTHA 4G3IA 1WOSA 3BM7A 3LANA 3T5HA 1FRKA 5JVHQ 2YKOA 2DYAA 2LYVA 2G2YA 4IFVB 2C1EB 1HARA 2FHJA 2HBZB 2R8HA 4DV6F 4QWEA 3CDWA 2R7SA 1B7FA 1F9HA 1WG4A 1Y9OA 1ZPVA 5C7PA 4PQUB 2VFTA 1MN7A 1Q7LB 5E7OB 2F8HA 2VU5A 3M7VA 3WX8A 2HFZA 3D2WA 2VODA 3ITHA 2CPXA 3LAMA 5CZXA 3GR0A 3HVAA 3K59A 5KFVA 3FRYA 3T1YJ 5D0EA 4QWAA 2WOMA 2R2UA 2GNKA 5DG7A 2J7KA 3M30B 2NCKL 4USWA 1IBKF 4C8OA 3TP2A 3VGTA 2QIFA 1ICEB 5L1LA 1EAYC 3KJVA 2RRNA 3H2LA 3ICLA 7FDRA 2C22A 3W8GA 4DR1J 2GQQA 2CJKA 2QO3A 3FNNA 2ZZTA 1JB0C 1TV6A 3R3TA 1HBMB 2ZUAA 3THPA 5D0GA 4URGA 3QSYB 5I4MA 2ROEA 2LEAA 3FKBA 4C0BA 2XO7A 1CJVA 3BV8A 3LO3A 4DX7A 1V3SA 3TX8A 1YTYA 2EG1A 3S1TA 1VLOA 4IG0B 1DBDA 3MCSA 2H4YB 4UQTA 5F3ZA 1JKHA 4PXDA 4ZOSA 1TL5A 5D3GB 2H51B 3PFOA 4LRDA 4MFBB 5A6WA 3QAEA 3W62A 5BR8F 2VC0A 3ENAA 3H40A 2UVRA 3Q0AA 5LMUF 3W5XA 2MSTA 2HHVA 1IR2A 2NSBA 2YWEA 2DK2A 1MN9A 4PUOA 1X31C 4OI3A 3EMTA 3AY0A 4QIWD 1FNOA 1NJYA 4CO4A 3ENWA 3MPWA 3DLKB 4YEAA 4B9TA 1EZZB 4NLDA 4QYZJ 4UT4A 2L9DA 4IRKA 2GO8A 1YI2S 1TL7A 1UCNA 3H8YA 3CJ0A 1C0UA 4DV3F 4EO6A 2QA1A 3NCRA 4ED6A 1VDHA 2JWNA 1KP6A 5KFCA 2XTJP 1L3SA 5GAEI 3HT0A 2DXDA 1Z2LA 4UZCA 5B7WA 2KO1A 4S0MA 5DGBA 3OLAA 3CCMS 1VI7A 4KQZA 1N33J 1IUJA 2XSFA 4RW9B 2CPDA 3CCTA 3HO1A 1RT5B 4K8RA 2D3O1 2VV5A 3K2YA 3M9MB 2KG0A 4A8KA 4G65A 3AB4B 2XLIA 2CPYA 1YIJS 3QPIA 2NLWA 1S0NA 4KGVB 1EQ0A 1D09B 2HAFA 2EXUA 1BQNA 1FERA 4K5SA 1RT6A 4MJKA 5AXLA 3U7JA 2RKIA 4UOGA 1XNRF 1APSA 2XMAA 1TMJA 4CLYA 2CQIA 2QYCA 4W90B 4C2MA 3D28A 1OIAA 3NP5A 2LU2A 5HBMA 2EK6A 1FO1A 3TEHB 1XR6A 4NI2A 4N47A 2WK4A 3TRGA 3ZZYA 1CS4B 4HHHA 4YS2A 2JEGA 3MEGA 4WE1A 1AUSL 3NXZA 4GVBB 2YKNA 1RAIB 2PEHA 4FVMA 1J27A 1YX2A 2ZFHA 3L09A 4ZDNA 3ILOA 4XDCA 2LLZA 2N7YA 4QJVA 4XK8C 2OPPA 5A8KB 4LF7J 1FKPA 2LKZA 5J1NA 3GIMA 1LW2B 5L1IA 1HHTP 2BBEA 4JI4F 4QBUA 3P49B 3MD3A 3FGVA 1LWEB 1V3RA 4F04B 5GADU 4WFXA 1CJUA 3AT1B 2HQIA 2C2ZB 2RB7A 3AJ1A 3C6TA 4ZCLA 3RG6A 3TQEA 2XS2A 3PO5A 1S59A 1PIEA 3MF5A 2Z0GA 2DO0A 1WKLA 4WK1A 1P1TA 3CJ4A 5KTQA 5AJ3J 3HJFA 3KG4A 2BE7D 1EKRA 3MAAB 4MK7A 4ZVEA 2DHXA 4F4WA 1RTJA 2VICA 2KU7A 4BWJA 1PYOB 4NLQA 4O4RA 3E01B 4NMLA 1NPPA 2M88A 5F8JA 2I6WA 4OJGA 2LXIA 2BV3A 5IWAJ 5AJ3F 4QWBA 4OMFG 3HULA 3OJSA 1WG5A 1IBMF 3IG1A 3MOZA 3LA0A 1BQMB 4DWIA 1SIZA 3KK1B 4RX6A 2CZVC 2CJYB 2ZC3A 4X64J 4C6AA 3R8YA 2JOQA 1RT7B 2RQCA 1K1QA 1FI4A 1R0AA 1VQSA 1P8GA 4O44A 5HP1A 3N4WA 5KT3A 2G0JA 2HMIB 2PSZA 3A8KA 1VQMS 2MGZB 3OT9A 2W8LA 3BBBA 5EN1A 4IFYB 2AJ1A 2WONA 3CWJA 1RAEB 4DFJA 3CGIA 3FBBA 3MMCA 5KG4A 2XSJB 4J9UE 2A1BA 4J9NA 3IWNC 1E6YB 3QGGA 2A10A 5HVHA 1N0UA 1R8HA 4EU0A 5IV4A 4ECYA 2E1PA 4DQPA 1X4EA 2G0CA 3NOCA 4DQRA 4KV8B 3K5OA 4K2XA 4LBPA 1PAUB 3JSBA 2ADBA 1UMJA 2H54B 3TQ1A 4CLLA 2FJWA 3VHQA 3ZTQA 3DLGA 3J7A1 2DRBA 1BLUA 2YY3A 3CJQA 3F56A 2VBWA 5HATA 5KFLA 2AP6A 3MFHA 2ALZA 4AXIA 2VA3A 2ZBQA 1FD2A 4DQSA 3KFWX 1N0VC 2NUHA 4G1PA 4HVZA 4UOCA 3FSIA 3OSPA 2VQFF 4WXOA 4WYWA 4TNOA 5B0DA 2IVMA 1Y00A 3K8WA 4JB8B 4CO3A 2ZM6F 4DLGA 3H98A 3Q8UA 2QGFB 4NCGA 3TZYA 4OZ3A 1FA0A 3R5DA 5KT2A 2XB2D 1PC5A 3RW6A 3MR3A 4B3TF 3RU0A 2XBPA 3NGRA 1UEKA 1U0SA 3OR2A 3C46A 5F8LA 4DSKA 3FJ2A 3KWMA 4HH1A 1C1CA 1X5SA 2QT7A 4P9SA 3BGRA 4H4KC 2LMIA 1E6YA 1N48A 2CKWA 3H2VE 3GV8B 3FBCA 4ECZA 4OHXA 1LV5A 1C1BA 4CT8A 4URSA 4ILRA 3DRXA 4RW6B 2MJNA 2HNZB 3NMRA 4G6VB 2WZ1A 2UZAA 1GXUA 1KDNA 2IA0A 3ZNJ1 2E1RA 1WC3A 4PQUA 2CAJA 3CD6S 1J5EJ 1X4DA 2ZVIA 2XCAA 1HD1A 2J7UA 3UN5A 1RTHB 2HYIB 2HEKA 4J9VA 1R6VA 5BYRA 4DR3J 2ZJPQ 2B8QA 2LDIA 3UR3C 4QPXA 4DSLA 3IGVA 4F4AA 4HYKA 2QEXS 2ILZA 3M6WA 1FRJA 4Y2MA 1M5HA 2OPRA 3TVKA 4J91A 4QIVA 2R7QA 5RUBA 1U6BA 4WKYA 1SKWA 3IR5B 2G1HA 3NEKA 1CJKB 4PPDA 5E41A 1S9FA 2F7VA 2FHJD 1WC6A 2BKNA 4JI1F 2OUGA 3DLEA 5AE1A 3Q23A 4DV2F 2AZ1A 5F0UA 2XZWA 4IQMA 3VR1A 3TX0A 1HNZF 1WORA 2CFXA 4Y00A 4CM2A 1S0OA 4LF4F 2IC3A 1NK9A 4J90A 1JJ2R 4J9PA 1HYSB 3C6TB 3VAJA 2IRYA 2O5DA 1FX2A 3ZFVA 3MAQA 2QLWA 2HNZA 4I6YA 4Y2KA 4ZKAA 3GB0A 1UPPA 2M2BA 3BREA 3GZ7A 3ISZA 3QFWA 1LW2A 1C1BB 2ZHAA 4DUYJ 1T03B 4LF4J 4A8QA 2OPPB 3JQKA 3NAIA 4N8NA 1VGYA 5A8KA 4XPEA 5BYQA 2XHWA 2YPYA 1OQ3A 1R31A 2V4RA 4KR0B 4LQ3A 3MEGB 4AL6A 1CS4A 5KFEA 4AT1B 2FVCA 3GQCA 3NWGA 1FJEB 4RNOA 5J2MB 1BE4A 2MKCA 4MT1A 3JYTA 2D74B 1SL0A 2FLNA 2BR0A 1RAOA 2RF2B 2VONA 1KTQA 4TYAA 4LRCA 1RKJA 1TL3A 2BJ7A 2OKQA 3P4UB 4CLKA 3OFFA 3QT8A 4NMXA 4ETXA 1SKRA 3HVTB 2W9CB 4CLFA 1Q81T 5GAHU 1XNQJ 2HK2A 1NJZA 5DZ7A 3TVZA 1TK0A 1U6FA 5L8RC 4ZHRB 2HHSA 4I6WA 3BH6B 1RBOB 2WVEA 1T3NA 2Z8QA 1F3FA 2HS4A 2IJNA 4CYUA 3IN5A 2HLTA 2ZJQQ 1UETA 3UN3A 2DNPA 2OELA 1B0VA 1MWYA 2HWIA 1KQFB 4K4TA 5KG7A 2E5HA 1N32J 1EETB 5EWFA 4A8XA 4Q8EA 1S1XA 2DXEA 4P2SA 4TVAB 3G8TA 5GMEA 5LL6d 4CIOA 1H7XA 1IJEB 2HFNA 1N5YB 2D7SA 1NSAA 2HNYB 3R6GB 4L3NA 2OPSA 2RU9A 5KFNA 4DUTA 3EWGA 1BQXA 3Q8SB 3RAXA 2L48A 2OFHX 1U48A 4CM0A 2R8GA 3H5UA 4C8NA 3NL0A 4IFYA 4I67A 5CAAA 4LFAJ 3RW7A 1UZDA 4DG1A 4F4ZA 2J8AA 3POTA 4OI2A 4TXSA 2E5JA 1NSPA 3KHGA 4DR5J 3NCQA 4GKJJ 2DT9A 1N36F 1RHMB 3M2UB 5MAOA 2RUGA 2X1BA 1F5CA 2AKWB 1B3TA 4UY8T 5EX3A 3OXLA 4CP5A 3IG1B 1TQLA 2B9EA 1MMLA 4DR5F 2P9GA 3ZXWA 2OLWA 1XMOF 2A2DA 1FKOB 1XERA 1HNXF 3FBFA 4ETZA 2L08A 3CULA 5IS2A 2W2QP 4J9KA 1XMQF 1Y3JA 2HKEA 2PFFB 5C24A 1WC0A 4YOEA 1S6PA 2WCXA 1NPKA 3R5AA 4RNFA 3CCLS 2ADCA 5L9NA 3R5BA 5T7LB 4OHYA 1YJWS 5CD4H 1KFSA 1KVJA 3Q8VA 1LWXA 3N9UC 4I7FA 4A46A 1TAQA 4ZLLA 4YP3A 3IR7B 3K89A 3VAKA 4F2SA 2GGPA 3PIPQ 3GIRA 1WHYA 4WP9A 3VWSA 1YITS 4J5OA 1WC4A 3HSJA 3V4IA 1VIOA 2NXEA 1LXNA 1JXEA 1YZ6A 2ZKTA 1TTHB 3DXBA 3EJMA 4R25A 5LJ5Y 4JI8J 1H72C 3GFYA 4ECQA 5E3AA 4X84A 2EKYA 5BJRA 1T11A 3VCDA 1HBUB 5EGYA 4PWWA 3L7UA 5I42A 3PW5A 1QE1A 2E44A 3O6QA 3QAUA 3I55S 4WFNQ 1NSKL 3OR1B 4ZPDA 5DM6Q 5B08A 2VQEJ 4Y2AA 1J5OA 1T9YA 2BYCA 2HHTA 1TR0A 2QLXA 4LFBJ 2EK1A 3CCVS 1U6ZA 5CABA 1BQNB 2V0NA 2ZJRQ 1H38A 2MY8A 3OJUA 2DHHA 1VBZA 2JEIA 3P96A 2R7XA 3TARA 4YQWA 2FC8A 2W01A 3TUJC 1GXTA 1DAXA 1S1VB 2IYGA 3P3DA 1S9GA 3M8QB 4NLVA 2M9KA 4MKVA 1D1UA 2HFOA 2ZDOA 1ACMB 5IM0B 1REVB 1T94A 4DPWA 4IH7A 3IBCB 2ZHBA 4OZ2A 4PEOA 3H4BA 4DL5A 3M8PB 3CC4S 2HLUA 4PG6A 4RW8A 2CJBA 4BC9A 2HFVA 1KOOA 1X5TA 4NLUA 5KFUA 4ED0A 3X1LB 2D69A 2BJ3A 4DQIA 5DLGA 3DRRB 2B4VA 2KHDA 4CTAB 4I2QA 1C0UB 5H9EJ 3AA8A 4F8RA 2FHOB 3P45B 4K7QA 2UVVA 2A2CA 3O2IA
chains in the Genus database with same CATH topology
1VK8A 2YKMB 5DDOC 3OPKA 4M63A 1R7IA 1ZZFA 4MKAA 1PSDA 4FN5A 4KPYA 1WG1A 1ZYQA 4X2BA 1UFWA 4C98A 1QM9A 4WZQA 3NS6A 1N32F 2YKMA 4NXNF 5EN1A 2DIVA 1XR5A 4YB7A 2EI5A 2J76E 2MZQA 3CEDA 4CO5A 4MKBA 4C8ZA 4O3PA 4OX9F 4E0DA 2CPZA 3HLUA 1D8YA 3DRPA 3BZQA 1KFDA 2RNEA 2X1AA 1QAIA 2IBKA 2IJFA 3BN4A 4NCGB 2W4CA 4HT5A 5FD1A 3RBDA 1SV5B 1AXQA 3KOAA 2JZ5A 2IA6A 1SC6A 4JV1A 1NHUA 3SV3A 5A0YA 5CH7B 4Q44A 4ED1A 3NMAA 4NL5A 2Y0SD 2LVWA 4JBCA 2MHEA 2V8HA 4EBCA 1N5SA 3EUNA 2GX8A 4GC6A 1QSSA 4O3OA 1RDRA 1JMTA 3MM9B 3KLGB 3M30A 1NO8A 3EYZA 1E6VA 4Y28C 1DLOA 3DRSA 5LSRA 1SJ3P 4LFAF 1IKYB 3KLHA 4Q8FA 1Y4ZB 4HTJA 1CEZA 4MAKA 1AFJA 2ZZNA 4HDHA 3ITHB 1Y5NB 3SDEA 1TKZA 4P7TA 1LFWA 3SI8A 3IWXA 4HTIA 1UKUA 4ALZA 2YWFA 1UVLA 3WC2A 4HH0A 3MM6A 1E6VB 2IM0A 4DR6F 4WKRA 2AD9A 3R1LA 5K14B 2BACA 2BZ2A 2RILA 4U9RA 3RAMA 4JV2A 3DI6A 3IAS9 2ROPA 2HNDB 4F2RA 3TA1A 2V2KA 1UJ5A 1HWUA 5KT5A 2XY6A 2ATLA 4UQGA 2KXFA 3MECA 1M0SA 4F25A 1KLMA 1K73T 4NLRA 1QAYA 4YR2A 3L3CA 2WW8A 2A18A 1UVJA 1HQEA 2CQBA 4KSEB 3C3LA 2DCLA 2VG6A 3B8HA 1YVFA 2FDNA 1G1XA 3DLGB 4WJBA 4HHJA 1S72S 4DSEA 1TKTA 3UE2A 3UD4P 2DRAA 3OW2R 5LSLA 2Q3PA 1NU4A 3GYNA 3BQ1A 2R7VA 4ECXA 1NJIT 1CSJA 1Q8LA 4AYBD 4DUZF 2YH1A 3HHKA 2COLA 3OVBA 4EYHB 1NK8A 2MKJA 1OWXA 2GA7A 2O3DA 4O23A 3HFKA 3AAWB 2HMIA 3M32B 3NBPB 1GX5A 2BANB 2B7CB 2DD8S 5J2NA 4QIEA 2OPSB 1I1GA 5F3TA 2HHSA 3CJKA 2XEXA 5CYMA 2VFRA 1RT2B 4A8SA 3LWMA 1M5PC 1EETA 2OP5A 1WEZA 1RJJA 2YNIB 3M9NB 4PWDA 1FT8A 3V6HA 1N56A 3CJ3A 1W2IA 2UV8A 1KOHA 1ZZNA 1CC8A 1XN9A 1QSYA 3RYLA 5E5NA 2KM8C 4RU2A 3N0VA 2EG2A 2DO4A 5F8HA 4ELUA 1C0TB 4I0WA 2Q66A 1WI6A 4RW9A 5KFFA 2WTFA 1HWIA 4LF9F 1U1OA 4NZ0A 4EYIB 4IYQA 3R27A 2B43A 1J5EF 1JLFB 2G13A 3W7BA 2BOPA 2XMTA 3F44A 5KT4A 1HI8A 5J2MA 5HROB 2DITA 4I64A 4F4KA 5F0WA 3OUYB 3HPOA 1VQ6S 3LOUA 3M32A 3NBPA 5I3UB 3B82A 4FNIA 1RYSA 4YR0A 4Q0BA 2P6SA 4ATNA 4XDDA 2PA8D 1K0TA 2FLLA 2E5LF 1JWWA 2FPHX 1LK5A 4M95A 3GR1A 3SCIE 1LKZA 4NLYA 4C0OC 4PG8A 3VQSA 4ECTA 1ZTTA 1SJQA 5GMKa 3JB9k 1XMBA 5THWA 5C24B 4DL7A 3SMZA 4DUYF 4OI1A 2OJ3A 5M2UA 4B3MF 2FJEB 2KXHA 4C8YA 4FZVA 3I6PA 1H0HB 2E1AA 4WIIA 2DR5A 1NK5A 1LWFB 4GC7A 4C97A 1MNEA 3IAM9 2CQHA 1KC8T 3DI6B 2UXBF 5FLXY 4RBTA 3WX4A 5KG3A 3KK3A 3THTA 2U2FA 4XPCA 3G96A 3DLKA 2WOMB 2DPJA 4EBDA 4DDFA 2K7JA 2DNNA 4CO2A 2NYIA 3HKZD 2AGQA 2KDOA 3SDEB 5DQHA 2OD6A 2N3OA 1X7VA 3D1OA 3CCZA 3KK3B 1VC0A 4B3SF 1FNMA 2JLGA 5DDRC 3KLHB 2LEBA 2BQ3A 1IKVB 1S76D 1N8RT 1S0MA 2ABYA 1A7GE 3IS9A 1PO6A 3B4MA 3MTJA 2KHCA 1FJ7A 4PXCA 2DISA 1FF2A 1WD6A 3M6UA 3TAPA 4WFAQ 2KYZA 1NK0A 3DXSX 2VPWB 5B0BA 4H4KA 5M2RA 2XMKA 1FDAA 1U4BA 4PRFA 4K4SA 3QZ7A 1NEEA 2EFVA 4UY85 5K9FA 1UVIA 2RU3A 2DNYA 1VLYA 3SSSA 4DV7F 1HNVB 2B4PA 3MAHA 3HZGA 2ZOMA 3MMAA 5KOWA 3QZ8A 1UJ4A 2ZH1A 3V5RA 4ZPTR 2FVSA 2K1RB 2MZTA 3DOKB 3Q8PB 4K4UA 5G0RA 1B7FA 4G1IA 1B0PA 1VK3A 2JFDA 4BS2A 1NJXA 5K8OA 4DBQA 3OVAA 2OD4A 1GAOA 2OTLS 2V9KA 3CDBA 3CVKA 1RT1B 2ROGA 1NKBA 1A9NB 2JL9A 1FVQA 5B0FA 1YJNS 2K8GA 2MHNA 3MWBA 4I4BA 5K8NA 3M2VB 2DR8A 1HW9A 5F41A 5HN0A 3EGZA 5H9FJ 2GQ2A 5J2PB 5KFPA 4UW2A 1TUVA 3E51A 2PGCA 2I0XA 2C3UA 4XO0A 2AGPA 3R5CA 1KTVA 3HP6A 1JLAA 4NA2A 3OL7A 5J2QB 2Z2LA 3DLEB 3DRYA 4Q5VA 2XS5A 4I2QB 5LMNF 4KAIA 4KTQA 4WCEQ 2AX0A 3QO9B 1UA1A 1OO0B 3I5AA 4CO0A 4TU7A 3WDOA 5MLCV 2CPEA 3C6UB 2YNIA 4JUZA 2MQPA 1U45A 1LFPA 1ZPWX 4Q2MA 1N6QB 1S1VA 1ZH5A 1FEHA 2HG4A 1FDNA 3ISNC 3IGNA 2F40A 3G4SS 2VD3A 1FTCA 1JNRB 5KFZA 1T05B 3KLFB 4M5DA 2ASLA 4X65F 1FXRA 3HK2A 3FDSA 2R7RA 1JLGA 2AU0A 4LF5F 3T9NA 1QVFR 5HI7A 3ZZZA 1O51A 2JRSA 3LP1A 1QE1B 1FVSA 2KT3A 5D78A 4DEZA 1HBUA 3BB5A 4TYBA 3ENVA 2ERRA 1UWBB 5G4DA 1SBRA 2OH2A 2RJZA 2XMMA 3L95X 2VPZB 3M4XA 4F4XA 2FTRA 2KKHA 4GO5X 1VQ8S 5CYQA 1RKIA 2ASYA 1FXDA 3I82A 3N5BA 4A8MP 2LQ5A 1VQ9S 3CPWR 1U1LA 1D9FA 3KTQA 4G1QB 1SL1A 1QSLA 1JLQB 1RT4B 2FGOA 2IM2A 3N79A 4JI2F 2GHVC 5DRKA 1LK7A 3DLHA 1AROP 3ZZ0A 2N4CA 3C2PA 1SUQB 4NYPA 4RU9A 4YR3A 3H4DA 4JI6F 3UCUP 4ZVFA 2PI5A 3G6XA 4V19X 4B02A 5C25B 3SYZA 3DYAA 5GAEU 2E9TA 5B0EA 4RKUC 2NXUA 3D0GE 4J9SA 3RB3A 4FP9A 3OV7A 1YHQS 3ZZPA 3MM7A 2O66A 3R1HA 4C4WA 1QJHA 4PQAA 5D4PA 4URQU 5GAGU 4DV1F 1JLBB 2GW8A 4NZ6A 3DRSB 2E9RX 5JUMA 4J9RA 1VRTA 4A47A 5IT4A 4O44B 2MSSA 2AJ0A 2RQMA 1NK7A 2IM1A 3PZPA 2DCUB 1SJ1A 3G9CA 3D0HE 2AQ4A 2KFZA 3HF5A 5E3RA 3PVXA 1BQMA 3S01A 3QJJA 3MEEB 2OTJS 3G86A 2OMOA 5D6GA 4IH5A 4B08A 2WAQD 5KOXA 4O3QA 3LPYA 3Q22A 1D9DA 1LWCB 1P27B 1SH2A 3A1YG 1RT3B 1VQ5S 2W7OA 5AXKA 3DRPB 4H4OA 1TK8A 4KE5A 1SJ4P 1GX6A 3QGIA 5K5MA 4JI8F 2WRMA 1TL3B 5KFGA 5CZVA 3N5FA 2RF2A 1FD8A 2EC0A 1WEXA 5KFXA 2FJAB 1HI0P 2R8JA 3THVA 2PC6A 4ZP6A 1OQ6A 1Z1ZA 2N3LA 2IBOA 2RIJA 3DMJB 2DHSA 2EBGA 3NNHA 5A8RA 3ONQA 4IUFA 4C11A 4Y6IA 3FEXB 4HEA9 1RT1A 3GIIA 2XY5A 2LQJA 1S49A 2P9EA 4HT7A 2IMWP 2GJIA 3MUMP 2HGNA 2AYGA 3GG0A 4HL9A 2V8GA 3T5LA 2K1RA 2CDQA 4QYRA 3OHBA 2I2YA 4TQSA 1QUVA 3PR4A 1QLNA 1HYSA 3MD1A 2RKIB 2H9ZA 2ILYA 4CH7A 4DV4F 4NLPA 2VBXA 1U25A 1S1TA 3AHPA 3I31A 2XMWA 4O3RA 4NPOA 5A2QY 3DLLQ 3QLHA 1RISA 3M8SA 5FJ4A 2RQKA 1N5QA 4ZPBA 1X9MA 3BSAA 1HWKA 3U02A 1S0VA 2Z4PA 4L6V3 1UVMA 1GQEA 1RT5A 2D3UA 1VOMA 1BY9A 2W4DA 4MIAA 4J9LA 1S1TB 3I87A 4OX7A 1UAWA 1SH3A 2MQOA 2OPQA 5GAHI 2VG7B 2W4PA 1X4FA 3GILA 2KRRA 1L3KA 2RH3A 3O3LA 2FGCA 5DO2A 5KFQA 5KFDA 3HHLC 3HHEA 3MR2A 1OS5A 4DV5F 4PG5A 3ZZUA 2MXYA 4Z37A 1URRA 4DX8H 2CYYA 4X4OA 3DDKA 5DDPC 1ZM3A 2B51A 4GO7X 4KFBB 4FXWA 4C11B 4IRDA 2DTJA 4I2PA 4BDPA 1DQ8A 1KQGB 1R8AA 2XGQA 1H7WA 3LALA 3QJPA 3CCSS 4Y34A 1VMBA 3T1YF 1S79A 4KO0A 2GGPB 1DFDA 5I3PA 3KHLA 1KHVA 3I5BA 4OJHA 4YMEA 3OL8A 1MMDA 2UUTA 4ICLB 2C2RA 2CZ4A 2LU1A 1VIXA 4QCLA 2EFGA 1IJFB 2DNGA 2XI2A 1DRZA 3N28A 2FHMA 3QIPB 1FKOA 3NGDA 3G6VA 1TV6B 3FZ2A 4W92B 3VZIA 3T5KA 2RE1A 1TP7A 3K5PA 5KFTA 4ED2A 1WI8A 3LW5C 3M6VA 4O0IA 1CQMA 3OTBA 3FMWA 2MZ1A 2ZUGA 1JLEA 2I5JB 1T95A 1JLBA 1UJ6A 4Q0BB 3I4PA 2E1CA 3FSYA 1M5SA 1YBAA 2YX1A 3OBIA 2WSFC 4TY9A 1FRMA 2HGLA 3EGWB 3BR8A 2I5JA 1LXJA 4AL7A 4ED3A 2DNLA 2ZH7A 1JIHA 2B4UA 2DNQA 1XK8A 2Q6BA 3MM9A 4DR1F 2VFVA 1HNWF 2HPUA 2GIQA 4QW9A 3HX9A 3VF0B 3DYAB 4HDGA 2CJAA 4DS5A 1Q7YT 4X64F 3H5XA 4CCHA 4JI5F 3ZZTA 2NREA 2R4FA 1URNA 5EHHA 4DV0F 3M05A 2HGMA 2DNKA 3HVTA 1MU2B 2DGOA 3CJ2A 3ISND 3FZBA 3W3SA 4MIBA 2MJUA 1RT2A 4YDDB 1NK4A 2Y1JA 3PKMA 3LQVA 4MK8A 1HQUB 4PPZA 2I8EA 4RUHA 1XWLA 2RRBA 1HA1A 1WELA 2YWHA 2OFGX 3DM2B 3OVSA 1HWLA 3I5CA 3GIJA 2KRBA 5T41A 1RA6A 3AH6A 3CJ5A 3G6ES 1HMVB 2ZOFA 2ZH8A 3K8VA 4QIGA 1DQAA 3JAMY 5IT0A 3U1MA 4BCAA 3OTOF 3UD3P 1X0FA 5ADZA 5DM7Q 2QFJA 1XNQF 2QA2A 1H2VZ 3RB6A 4YFUA 1X9WA 1SL2A 4MYUA 4NXMF 3QGHA 1KNZA 2IAJB 2G9OA 4IOAQ 3M2RB 4X4SA 2J0WA 1N54B 2HWHA 4L72B 4Y0FA 3QGPA 2UUWA 3GIKA 1N34F 4CH1A 3DOMA 3B4DA 3MECB 3NNCA 2QA4S 1S9GB 1Y3KA 3M8QA 4V19J 3K0JA 3CMES 4RUAA 3DCAA 3PV8A 2XULA 2J0SD 4N77A 2YQ3A 3OXFA 2M70A 5L1KA 2F8EX 1GXLA 2BVZA 2L41A 2Y1IA 4K0KF 3T19A 1L3TA 3GV5B 4J9MA 3PW4A 2ZH6A 4XIUA 5HQ8A 2NR0A 5DS7A 2R9LA 1L3UA 2UUAF 1YJVA 5B0AA 2QSWA 3D1QA 3U27A 3SV4A 4EGLA 1MROA 1VQKS 4ZP9A 2PIIA 3BGFA 2KYXA 3KMQA 1ZBTA 3KK2B 2JEFA 5CCMA 2HQ3A 4WFYA 1ELOA 3KLGA 4U7UK 3D0IE 3HHLB